HHsearch alignment for GI: 254781085 and conserved domain: KOG3976

>KOG3976 consensus.
Probab=95.38  E-value=0.17  Score=27.21  Aligned_cols=77  Identities=14%  Similarity=0.173  Sum_probs=58.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999962288999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    8 LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKI   85 (173)
Q Consensus         8 w~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~   85 (173)
T Consensus        99 ~~~~s~lgl~~~~~k~~g~-ai~~~adk~~~k~~~~~~~arq~~ik~i~d~id~~~sqq~~~~~~~~lfd~~keni~l  175 (247)
T KOG3976          99 ISTLSFLGLTGLAIKKLGP-AIADWADKLIEKILSQLEEARQAHIKAISDAIDTEKSQQALASKTEYLFDVSKENIAL  175 (247)
T ss_pred             CHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0033699999999998559-9998867779999999999888679999987645666577888877645656667988