HHsearch alignment for GI: 254781085 and conserved domain: PRK06231

>PRK06231 F0F1 ATP synthase subunit B; Validated.
Probab=98.84  E-value=6.7e-06  Score=52.82  Aligned_cols=145  Identities=12%  Similarity=0.168  Sum_probs=96.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999999999622889999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRA   83 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a   83 (173)
T Consensus        45 fPn~~~Fia~lIaF~ILl~l-L~k~awKPI~k~Ld~R~---~kI~~~L~~Aeka----r~EAe~ll~e~e~~L~eAr~EA  116 (201)
T PRK06231         45 FPNFWVFIAHLIAFSILLLL-GIFLFWKPTQRFLNKRK---ELIEAEINQANEL----KQQAQQLLENAKQRHENALAQA  116 (201)
T ss_pred             CCCHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH---HHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78869999999999999999-99997878999999999---9999999999999----9999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   84 KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        84 ~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
T Consensus       117 ~eII~~Ak~~Ae~~~~ei~~~A~~eA~~i~e~A~~eIe~Ek~~A~~elr~eva~LAv~--aAeKiI~k~Ld~~~~  189 (201)
T PRK06231        117 KEIIDQANYEALQLKSELEKEANRQANLIIFQARQEIEKERRELKEQLQKESVELAML--AAEELIKKKVDREDD  189 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHCCHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999999999--999999866799989