HHsearch alignment for GI: 254781085 and conserved domain: PRK06569

>PRK06569 F0F1 ATP synthase subunit B'; Validated.
Probab=99.92  E-value=1e-22  Score=150.39  Aligned_cols=139  Identities=16%  Similarity=0.179  Sum_probs=134.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKIL   86 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~   86 (173)
T Consensus        14 fWL~itF~~ly~~~sk~~lPr-i~~~le~R~~~I~~dl~~A~~~k~eae~~~~~ye~~l~~Ak~eA~~i~~ea~~~l~~e   92 (157)
T PRK06569         14 FWLIVTFGLLYIFVYKFITPK-AEEIFNNRQTNIQDNITQADTLTLEVEKLNKYYNEEIDKTNTEIDRLKKEKIDSLESE   92 (157)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999998604-8779998999999889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999433999999
Q gi|254781085|r   87 AEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNS  146 (173)
Q Consensus        87 ~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~  146 (173)
T Consensus        93 ~~~k~~~le~~l~~~i~~aekeI~~~k~~a~~~i~~ia~eia~~iI~kl~G~k~n~s~l~  152 (157)
T PRK06569         93 FLIKKKNLEQDLKNSINQNIEDINLAAKQFRTNKSEAIIKLAVNIIEKITGTKADMNLLQ  152 (157)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH
T ss_conf             999999999999999999999999999987876999999999999999868887788764