HHsearch alignment for GI: 254781085 and conserved domain: PRK06669

>PRK06669 fliH flagellar assembly protein H; Validated.
Probab=95.70  E-value=0.13  Score=27.89  Aligned_cols=105  Identities=13%  Similarity=0.225  Sum_probs=77.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999-99999999999999999999999999---9999999999999999999
Q gi|254781085|r   55 ENILMQYKEKHSKVEEETREIILAAKHRAKI-LAEEGCQNIEQISALYLKDLEQKIHY---MKLEAKRLLYAKIADFSVE  130 (173)
Q Consensus        55 ~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~-~~e~~~~~a~~~~~~~~~~a~~~I~~---~~~~a~~~l~~~~~~la~~  130 (173)
T Consensus        87 s~~~~klq~~ie~~e~e~~~~le~a~~eG~eeG~e~G~~ea~~e~~~~i~~~~~ile~~~~~~~~~l~~~E~elv~lal~  166 (268)
T PRK06669         87 SSSRIKLEMQIEEAEEERKRLLEEAKAEGYEEGYEEGFEKAREEFQKLIDELKAILEEAIDEREEILESSEEEIVELALD  166 (268)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             35089999999999999999999999999999999999999999999999999999999999999999989999999999


Q ss_pred             HHHHHHHHHC--CHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999433--9999999999999999999
Q gi|254781085|r  131 IVREIISQKM--NDDVNSSIFEKTISSIQSC  159 (173)
Q Consensus       131 ~~~kil~~~l--~~~~~~~~I~~~i~~l~~~  159 (173)
T Consensus       167 IAkkVI~~~~~~~~~i~~~lvk~~l~evk~~  197 (268)
T PRK06669        167 IAKKVIKEISENSKEVALALVKELLKEVKDA  197 (268)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHCCC
T ss_conf             9999999997058999999999999973137