HHsearch alignment for GI: 254781085 and conserved domain: PRK07353

>PRK07353 F0F1 ATP synthase subunit B'; Validated.
Probab=99.95  E-value=4.9e-26  Score=169.67  Aligned_cols=138  Identities=17%  Similarity=0.258  Sum_probs=129.8

Q ss_pred             CCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989999-9999999999999962288999999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDETFLV-FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA   79 (173)
Q Consensus         1 m~~d~tfw~-~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a   79 (173)
T Consensus         2 ~~~n~Tl~~q~i~Flil~~il-~k~l~~Pi~~~ld~R~~~I~~~l~~A~~~~~ea~~~~~e~e~~l~~Ar~ea~~ii~~A   80 (140)
T PRK07353          2 FDFDATLPLMAVQFVLLTFIL-NALFYKPVGKVVEEREDYIRTNRAEAKEKLAEAEKLEAQYEQQLASARKQAQQVIAEA   80 (140)
T ss_pred             CCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             151288999999999999999-9998888999999999999888999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999943
Q gi|254781085|r   80 KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQK  139 (173)
Q Consensus        80 ~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~  139 (173)
T Consensus        81 ~~~a~~~~~~~~~~A~~e~~~~~~~A~~~Ie~ek~~a~~~l~~ev~~la~~ia~Kilg~K  140 (140)
T PRK07353         81 EAEADKLYAEALAEAQAEAQASKEKARREIEQQKQSALAQLEQQVDALSRQILEKLLAAK  140 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999999999999999999999999999999999999999999876699