HHsearch alignment for GI: 254781085 and conserved domain: PRK08404

>PRK08404 V-type ATP synthase subunit H; Validated.
Probab=95.87  E-value=0.11  Score=28.30  Aligned_cols=72  Identities=19%  Similarity=0.139  Sum_probs=46.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   56 NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF  127 (173)
Q Consensus        56 ~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~l  127 (173)
T Consensus        13 ~AEk~AeeRIE~Ak~eAK~Ii~kAkeEAk~iEeeii~kAeeea~~lIE~kk~EGE~EAkKi~eeGe~Eieel   84 (106)
T PRK08404         13 KAERLAEERIERAKEEAKKIIRKAKEEAKKIEEEIIKKAEEEAQKLIEKKKLEGEEEAKKILEEGEAEISEL   84 (106)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             988879999998888899999998999998799999999999999999988702788999999818689999