HHsearch alignment for GI: 254781085 and conserved domain: PRK13428

>PRK13428 F0F1 ATP synthase subunit delta; Provisional.
Probab=98.01  E-value=0.00091  Score=40.45  Aligned_cols=80  Identities=14%  Similarity=0.096  Sum_probs=44.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   54 SENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR  133 (173)
Q Consensus        54 a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~  133 (173)
T Consensus        62 LaeAr~EAa~IreeAr~~~~~I~ae~raqA~~Ea~RI~~~g~~Qiea~Rqq~v~~L-------R~e~G~~av~lA~~iVg  134 (445)
T PRK13428         62 VEDAKAEAHRVVEEARTDAERIAEQLRAQADVEAERIKVQGARQVQLLRQQLIRQL-------RLELGHESVRQARELVR  134 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999998899999999988889999999989999999999999999-------99987999999999986


Q ss_pred             HHHHHHC
Q ss_conf             9999433
Q gi|254781085|r  134 EIISQKM  140 (173)
Q Consensus       134 kil~~~l  140 (173)
T Consensus       135 e~l~D~a  141 (445)
T PRK13428        135 NHVADPA  141 (445)
T ss_pred             HHCCCHH
T ss_conf             5404388