HHsearch alignment for GI: 254781085 and conserved domain: PRK13453

>PRK13453 F0F1 ATP synthase subunit B; Provisional.
Probab=100.00  E-value=3.3e-30  Score=193.87  Aligned_cols=155  Identities=15%  Similarity=0.242  Sum_probs=148.8

Q ss_pred             CCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             798--999999999999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDE--TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         3 ~d~--tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
T Consensus        16 idw~t~~~q~I~F~il~~ll~kf-~~~pi~~~L~~R~~~I~~~l~~Ae~~k~eA~~~~~e~e~~L~~a~~ea~~Ii~~A~   94 (173)
T PRK13453         16 VEWGTVIVQVLTFIVLLALLKKF-AWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAK   94 (173)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97899999999999999999999-89899999999999999889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
T Consensus        95 ~~Ae~~~~~~~~~A~~ea~~i~~~A~~~Ie~ek~~a~~elr~ei~~lav~~A~Kil~~~l~~~~~~~LId~~i~e~Ge  172 (173)
T PRK13453         95 VQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGD  172 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999999999999999999999999999999999999999999998676999899999999986179