HHsearch alignment for GI: 254781085 and conserved domain: TIGR02499

>TIGR02499 HrpE_YscL_not type III secretion apparatus protein, HrpE/YscL family; InterPro: IPR012842 This entry is related to IPR009335 from INTERPRO, but is broader. IPR009335 from INTERPRO describes HrpE-like proteins, components of bacterial type III secretion systems primarily in bacteria that infect plants. This entry also includes the homologous proteins of animal pathogens, such as YscL of Yersinia pestis. This entry excludes the related protein FliH of the bacterial flagellar apparatus (see IPR000563 from INTERPRO)..
Probab=96.26  E-value=0.073  Score=29.40  Aligned_cols=100  Identities=8%  Similarity=0.077  Sum_probs=82.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999--99999999999999999999999999999999999999999999999
Q gi|254781085|r   59 MQYKEKHSKVEEETREIILAAKHRAKILAEE--GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREII  136 (173)
Q Consensus        59 ~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~--~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil  136 (173)
T Consensus        17 ~~A~~il~~A~~~A~~~~~~A~e~~e~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~a~~~~l   96 (183)
T TIGR02499        17 ARAQAILAAARQRAEAILADAEEEAEASRQLLKGYEQGLEQFWQEAAAQLVEWQQEAEQLEASLEERLAELVLQALEQIL   96 (183)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             84999999999999999999999999999999999999999999999999999999999999999999999999999986


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             9433999999999999999999
Q gi|254781085|r  137 SQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus       137 ~~~l~~~~~~~~I~~~i~~l~~  158 (173)
T Consensus        97 ~~~~~qQ~~~~~~~~~lr~~~~  118 (183)
T TIGR02499        97 GETLGQQDESERLVRLLRQLLA  118 (183)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHH
T ss_conf             5633589988999999999999