HHsearch alignment for GI: 254781085 and conserved domain: TIGR02926

>TIGR02926 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014275 A-ATPases (or A1A0-ATPase) (3.6.3.14 from EC) are found exclusively in Archaea and display a close resemblance in structure and subunit composition to V-ATPases, although their function in both ATP synthesis and ATP hydrolysis is closer to that of F-ATPases . A-ATPases are composed of two linked complexes: the A1 complex, consisting of seven subunits, contains the catalytic core that synthesizes/hydrolyses ATP, while the A0 complex, consisting of at least two subunits, forms the membrane-spanning pore . The rotary motor in A-ATPases is composed of only two subunits, the stator subunit I and the rotor subunit C . A-ATPases may have arisen as an adaptation to the different cellular needs and the more extreme environmental conditions faced by Archaeal species. This entry represents subunit H of the archaeal A-ATPase; it is unclear precisely where subunit H fits into the complex. More information about this protein can be found at Protein of the Month: ATP Synthases ..
Probab=96.87  E-value=0.028  Score=31.79  Aligned_cols=79  Identities=16%  Similarity=0.150  Sum_probs=69.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   53 KSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI  131 (173)
Q Consensus        53 ~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~  131 (173)
T Consensus         3 ~IK~AE~~A~~~i~eA~~~~~~~i~eAr~eA~~l~e~Ae~eA~~~~~e~i~~a~~~i~~E~~~I~~~~eke~e~~~~~A   81 (85)
T TIGR02926         3 EIKKAEEEAEELIEEAKEEREQRIAEAREEAKELLEEAEEEAKKLKEEIIEEAEEEIEKEAEKILEEGEKEIEELKSKA   81 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             8899899999998989999986689998998888899889889999888899999999879998866556399999960