Query         gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 173
No_of_seqs    115 out of 1862
Neff          8.2 
Searched_HMMs 39220
Date          Mon May 30 05:19:20 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781085.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK13455 F0F1 ATP synthase sub 100.0 3.4E-35 8.5E-40  222.8  25.0  159    1-159    24-182 (184)
  2 PRK09173 F0F1 ATP synthase sub 100.0 7.5E-35 1.9E-39  220.8  24.8  157    3-159     1-157 (159)
  3 PRK13461 F0F1 ATP synthase sub 100.0 1.7E-31 4.2E-36  201.4  24.3  156    1-157     1-158 (159)
  4 PRK13460 F0F1 ATP synthase sub 100.0   2E-31   5E-36  201.0  24.6  157    2-159    13-171 (173)
  5 PRK05759 F0F1 ATP synthase sub 100.0   2E-31 5.2E-36  200.9  24.1  155    1-156     1-156 (156)
  6 PRK06231 F0F1 ATP synthase sub 100.0 9.5E-31 2.4E-35  197.0  23.4  152    5-157    50-201 (201)
  7 PRK13453 F0F1 ATP synthase sub 100.0 3.3E-30 8.3E-35  193.9  23.9  155    3-158    16-172 (173)
  8 PRK07352 F0F1 ATP synthase sub 100.0 3.3E-29 8.5E-34  188.0  24.3  155    3-158    17-173 (174)
  9 COG0711 AtpF F0F1-type ATP syn 100.0 2.6E-27 6.7E-32  177.0  23.7  157    1-158     2-160 (161)
 10 CHL00019 atpF ATP synthase CF0 100.0 3.9E-27   1E-31  176.0  24.3  158    2-160    23-180 (184)
 11 PRK06568 F0F1 ATP synthase sub 100.0 9.9E-27 2.5E-31  173.7  21.5  142    2-144     3-144 (154)
 12 PRK13454 F0F1 ATP synthase sub 100.0 2.5E-26 6.3E-31  171.4  22.5  146    7-154    35-180 (181)
 13 TIGR01144 ATP_synt_b ATP synth 100.0 2.6E-26 6.5E-31  171.3  21.2  146   10-156     2-147 (147)
 14 PRK07353 F0F1 ATP synthase sub 100.0 4.9E-26 1.2E-30  169.7  21.4  138    1-139     2-140 (140)
 15 CHL00118 atpG ATP synthase CF0 100.0   6E-26 1.5E-30  169.1  21.6  137    1-138    19-156 (156)
 16 PRK09174 F0F1 ATP synthase sub 100.0 1.4E-25 3.5E-30  167.1  22.8  144    7-151    57-200 (204)
 17 PRK13428 F0F1 ATP synthase sub  99.9 4.5E-25 1.1E-29  164.1  22.5  165    6-171     4-169 (445)
 18 CHL00167 consensus              99.9 1.9E-24 4.9E-29  160.4  24.4  155    2-157    25-179 (182)
 19 PRK08476 F0F1 ATP synthase sub  99.9 6.5E-25 1.6E-29  163.1  20.8  136    1-137     1-140 (141)
 20 TIGR03321 alt_F1F0_F0_B altern  99.9 5.7E-24 1.5E-28  157.6  24.7  158    1-159     1-160 (246)
 21 PRK06569 F0F1 ATP synthase sub  99.9   1E-22 2.6E-27  150.4  21.7  139    7-146    14-152 (157)
 22 pfam00430 ATP-synt_B ATP synth  99.9 1.1E-22 2.8E-27  150.2  20.1  131    6-137     1-132 (132)
 23 PRK08475 F0F1 ATP synthase sub  99.9 6.7E-20 1.7E-24  134.0  20.9  122    6-128    27-148 (170)
 24 pfam05405 Mt_ATP-synt_B Mitoch  99.2 6.1E-08 1.5E-12   64.7  22.1  151    3-157    13-163 (163)
 25 PRK13454 F0F1 ATP synthase sub  99.0   1E-06 2.6E-11   57.5  21.4  146    2-155    24-177 (181)
 26 PRK06231 F0F1 ATP synthase sub  98.8 6.7E-06 1.7E-10   52.8  21.7  145    4-158    45-189 (201)
 27 PRK13453 F0F1 ATP synthase sub  98.6 3.5E-05 8.8E-10   48.7  20.9   63   66-128    69-131 (173)
 28 PRK07352 F0F1 ATP synthase sub  98.4 0.00013 3.3E-09   45.3  21.0  128   17-151    36-170 (174)
 29 PRK13460 F0F1 ATP synthase sub  98.4 0.00014 3.5E-09   45.3  21.0   64   64-127    65-128 (173)
 30 PRK08476 F0F1 ATP synthase sub  98.4 0.00016   4E-09   44.9  19.9  111   17-135    17-127 (141)
 31 PRK09174 F0F1 ATP synthase sub  98.3 0.00018 4.5E-09   44.6  19.9  148    2-156    46-201 (204)
 32 PRK13461 F0F1 ATP synthase sub  98.2 0.00033 8.5E-09   43.0  21.0  141    4-151     9-156 (159)
 33 PRK09173 F0F1 ATP synthase sub  98.2 0.00035   9E-09   42.8  20.7  143    5-154     6-156 (159)
 34 PRK06328 type III secretion sy  98.2 0.00047 1.2E-08   42.1  16.3  108   52-159    22-131 (223)
 35 CHL00118 atpG ATP synthase CF0  98.1  0.0006 1.5E-08   41.5  19.6  113   12-131    26-138 (156)
 36 PRK06569 F0F1 ATP synthase sub  98.0 0.00081 2.1E-08   40.7  19.0  139    2-147     3-149 (157)
 37 PRK13428 F0F1 ATP synthase sub  98.0 0.00091 2.3E-08   40.5  20.0   80   54-140    62-141 (445)
 38 PRK05759 F0F1 ATP synthase sub  98.0  0.0011 2.7E-08   40.0  20.7  114   14-135    11-124 (156)
 39 PRK07353 F0F1 ATP synthase sub  98.0  0.0011 2.8E-08   40.0  20.1  112   10-129     8-119 (140)
 40 PRK02292 V-type ATP synthase s  97.9  0.0017 4.3E-08   38.9  15.2  100   56-156    13-112 (187)
 41 PRK13455 F0F1 ATP synthase sub  97.8  0.0019 4.7E-08   38.7  20.7  151    5-164    20-174 (184)
 42 PRK01558 V-type ATP synthase s  97.8  0.0026 6.5E-08   37.8  16.4  100   51-154    14-113 (198)
 43 CHL00019 atpF ATP synthase CF0  97.7   0.003 7.8E-08   37.4  20.4  124   10-141    27-150 (184)
 44 PRK01005 V-type ATP synthase s  97.7  0.0031 7.8E-08   37.4  16.5  101   52-156    20-122 (208)
 45 pfam02326 YMF19 Plant ATP synt  97.6 0.00019 4.8E-09   44.4   6.3   58    7-67     13-70  (84)
 46 COG0711 AtpF F0F1-type ATP syn  97.6  0.0048 1.2E-07   36.3  21.8  110   17-134    16-125 (161)
 47 PRK06937 type III secretion sy  97.6  0.0052 1.3E-07   36.1  15.6  105   55-159    26-130 (204)
 48 TIGR01144 ATP_synt_b ATP synth  97.5  0.0054 1.4E-07   36.0  20.3  136    6-151     4-146 (147)
 49 PRK03963 V-type ATP synthase s  97.5  0.0067 1.7E-07   35.4  15.7   98   57-155    15-112 (198)
 50 PRK01005 V-type ATP synthase s  97.3    0.01 2.5E-07   34.4  13.3  105   53-157     9-119 (208)
 51 pfam00430 ATP-synt_B ATP synth  97.2   0.015 3.7E-07   33.5  19.8   61   67-127    51-111 (132)
 52 PRK08475 F0F1 ATP synthase sub  97.2   0.015 3.9E-07   33.4  18.9  125   25-156    41-169 (170)
 53 PRK00106 hypothetical protein;  97.1   0.017 4.4E-07   33.0  19.8   75   31-115    24-98  (535)
 54 TIGR03321 alt_F1F0_F0_B altern  97.1   0.019 4.7E-07   32.9  20.3   67   68-134    58-124 (246)
 55 TIGR02926 AhaH ATP synthase ar  96.9   0.028 7.2E-07   31.8  11.0   79   53-131     3-81  (85)
 56 PRK02292 V-type ATP synthase s  96.9   0.029 7.3E-07   31.8  13.3   78   62-139     8-85  (187)
 57 PRK01558 V-type ATP synthase s  96.9   0.029 7.5E-07   31.7  13.8   62   61-126    13-74  (198)
 58 PRK03963 V-type ATP synthase s  96.8   0.032 8.1E-07   31.5  13.2   41   67-107    40-80  (198)
 59 PRK01194 V-type ATP synthase s  96.7   0.038 9.8E-07   31.0  16.0   99   58-156    15-113 (185)
 60 CHL00167 consensus              96.5   0.055 1.4E-06   30.1  20.2  123   10-140    29-151 (182)
 61 PRK00409 recombination and DNA  96.5   0.057 1.5E-06   30.0  15.7   76   29-104   519-594 (780)
 62 COG2811 NtpF Archaeal/vacuolar  96.3   0.066 1.7E-06   29.7  13.8   79   52-130    10-88  (108)
 63 TIGR02499 HrpE_YscL_not type I  96.3   0.073 1.9E-06   29.4  15.8  100   59-158    17-118 (183)
 64 pfam12072 DUF3552 Domain of un  96.2   0.078   2E-06   29.2  18.5   18  124-141   143-160 (201)
 65 TIGR03319 YmdA_YtgF conserved   96.1   0.094 2.4E-06   28.8  18.3   18  124-141   141-158 (514)
 66 PRK09098 type III secretion sy  96.0   0.098 2.5E-06   28.7  17.1   96   55-150    35-141 (229)
 67 PRK08404 V-type ATP synthase s  95.9    0.11 2.9E-06   28.3  13.5   72   56-127    13-84  (106)
 68 pfam01991 vATP-synt_E ATP synt  95.9    0.11 2.9E-06   28.3  13.9   97   59-155     8-105 (195)
 69 PRK06669 fliH flagellar assemb  95.7    0.13 3.4E-06   27.9  17.8  105   55-159    87-197 (268)
 70 PRK06568 F0F1 ATP synthase sub  95.6    0.14 3.6E-06   27.8  19.4  100   16-123    13-112 (154)
 71 pfam01991 vATP-synt_E ATP synt  95.5    0.16 4.2E-06   27.4  16.4   41   67-107    31-71  (195)
 72 COG1390 NtpE Archaeal/vacuolar  95.4    0.17 4.3E-06   27.3  13.6   90   58-147    16-105 (194)
 73 KOG3976 consensus               95.4    0.17 4.5E-06   27.2  20.0   77    8-85     99-175 (247)
 74 COG2811 NtpF Archaeal/vacuolar  95.3    0.18 4.7E-06   27.1  14.9   86   51-136    20-106 (108)
 75 COG1390 NtpE Archaeal/vacuolar  94.9    0.24   6E-06   26.4  15.6   78   61-138     8-85  (194)
 76 PRK00106 hypothetical protein;  94.2    0.35   9E-06   25.4  21.6   76   19-97     16-91  (535)
 77 KOG2302 consensus               94.2    0.36 9.1E-06   25.4   9.1   65    1-69   1355-1419(1956)
 78 pfam06103 DUF948 Bacterial pro  92.8    0.62 1.6E-05   24.0  10.7   67    7-75      4-70  (90)
 79 pfam04612 GspM General secreti  92.5    0.67 1.7E-05   23.8   8.2   50    9-58     19-68  (159)
 80 pfam06635 NolV Nodulation prot  92.5    0.67 1.7E-05   23.8  15.3  101   60-160    31-131 (207)
 81 PRK11677 cytochrome d ubiquino  91.5    0.89 2.3E-05   23.1  11.5   84    7-98      2-85  (134)
 82 COG1317 FliH Flagellar biosynt  91.4    0.92 2.3E-05   23.0  16.0   61   96-160    95-157 (234)
 83 COG4046 Uncharacterized protei  91.2    0.77   2E-05   23.5   5.9   99    5-103     9-121 (368)
 84 COG4741 Predicted secreted end  90.6     1.1 2.8E-05   22.6  13.1   42    5-47      3-45  (175)
 85 PRK09731 putative general secr  90.3     1.2   3E-05   22.4   8.1   51    9-59     40-90  (178)
 86 pfam03179 V-ATPase_G Vacuolar   90.1     1.2 3.1E-05   22.3  12.5   44   65-108     9-52  (105)
 87 pfam06188 HrpE HrpE protein. T  89.5     1.4 3.5E-05   22.0  15.8   97   59-155    30-126 (191)
 88 PRK09039 hypothetical protein;  88.6     1.6   4E-05   21.7  20.7   20    7-26     26-45  (343)
 89 TIGR01147 V_ATP_synt_G V-type   87.5     1.8 4.7E-05   21.3  11.9   57   63-119    10-66  (114)
 90 COG1862 YajC Preprotein transl  86.9     1.4 3.6E-05   21.9   4.8   35    7-42      9-43  (97)
 91 PRK05585 yajC preprotein trans  85.1     2.1 5.3E-05   20.9   4.9   35    7-41     18-52  (107)
 92 TIGR02070 mono_pep_trsgly mono  84.5    0.82 2.1E-05   23.3   2.6   31    7-37     10-40  (228)
 93 MTH00169 ATP8 ATP synthase F0   83.2       3 7.6E-05   20.1   5.4   36    7-43     14-49  (71)
 94 pfam02699 YajC Preprotein tran  81.1     3.5 8.8E-05   19.7   4.7   30   11-40      6-35  (83)
 95 TIGR00739 yajC preprotein tran  80.3     2.1 5.2E-05   21.0   3.3   32    9-41      5-36  (86)
 96 PRK04654 sec-independent trans  79.9     3.9   1E-04   19.4  11.9   15    2-16      1-15  (214)
 97 pfam02108 FliH Flagellar assem  78.4     4.4 0.00011   19.1   9.3   55  102-156     7-63  (128)
 98 KOG1772 consensus               77.2     4.8 0.00012   18.9  13.7   37   64-100    21-57  (108)
 99 pfam05103 DivIVA DivIVA protei  74.9     5.5 0.00014   18.5  14.9   71   41-115    45-115 (131)
100 PRK00888 ftsB cell division pr  74.7     5.6 0.00014   18.5   8.6   19    8-26      3-21  (105)
101 PRK04098 sec-independent trans  74.6     5.6 0.00014   18.5  12.9   45    2-47      1-46  (153)
102 COG4512 AgrB Membrane protein   73.9     3.7 9.5E-05   19.5   3.2   25    2-26    101-125 (198)
103 PRK10361 DNA recombination pro  73.2     6.1 0.00016   18.3  23.3   51    4-54      2-55  (475)
104 COG4768 Uncharacterized protei  72.3     6.4 0.00016   18.1  18.6  104    8-115    10-113 (139)
105 PRK01770 sec-independent trans  70.0     7.2 0.00018   17.8  10.8   42    2-44      1-43  (171)
106 TIGR03142 cytochro_ccmI cytoch  68.9     7.6 0.00019   17.7   6.6   53    7-74      2-54  (117)
107 KOG1962 consensus               68.8     7.6 0.00019   17.7  11.6   11   13-23    105-115 (216)
108 pfam11119 DUF2633 Protein of u  67.6     5.7 0.00015   18.4   3.0   21    4-24      8-29  (59)
109 PRK06771 hypothetical protein;  67.2       8  0.0002   17.6   3.7   40    6-46      2-41  (93)
110 pfam07219 HemY_N HemY protein   67.0     8.3 0.00021   17.5   7.9   22    2-23     37-58  (134)
111 COG4736 CcoQ Cbb3-type cytochr  66.2     6.4 0.00016   18.1   3.0   31    6-37     11-41  (60)
112 TIGR02002 PTS-II-BC-glcB PTS s  65.2     5.1 0.00013   18.7   2.4   27    7-34    394-420 (518)
113 PRK05183 hscA chaperone protei  65.1     9.1 0.00023   17.3   9.5   76   38-118   512-587 (621)
114 TIGR02120 GspF general secreti  64.6     4.7 0.00012   18.9   2.1   17    5-21    184-200 (414)
115 pfam07431 DUF1512 Protein of u  64.6     9.3 0.00024   17.2   7.9   55    6-65      3-57  (356)
116 MTH00025 ATP8 ATP synthase F0   64.6     9.3 0.00024   17.2   4.7   34    7-41     14-47  (70)
117 COG3105 Uncharacterized protei  62.7      10 0.00026   17.0  12.3   86    1-94      1-86  (138)
118 TIGR02794 tolA_full protein To  62.6     7.7  0.0002   17.7   2.9   16    5-20      2-18  (452)
119 KOG2568 consensus               61.4     4.6 0.00012   19.0   1.6   15    3-17    420-434 (518)
120 PRK06531 yajC preprotein trans  60.0      11 0.00029   16.7   4.0   28   11-39      6-33  (120)
121 PRK05886 yajC preprotein trans  59.8      11 0.00029   16.7   5.0   24    7-31      4-27  (108)
122 TIGR01846 type_I_sec_HlyB type  59.6      11 0.00029   16.7   3.7   31    7-38    288-318 (703)
123 TIGR02759 TraD_Ftype type IV c  58.4      10 0.00026   17.0   2.9   23    6-28     23-45  (613)
124 pfam06295 DUF1043 Protein of u  57.3      13 0.00032   16.4  11.9   56   35-97     25-80  (128)
125 KOG3054 consensus               56.9      13 0.00033   16.4   3.5   21    4-24      2-22  (299)
126 PTZ00233 variable surface prot  56.1     5.1 0.00013   18.7   1.0   28   12-42    443-470 (509)
127 TIGR00785 dass transporter, di  55.4      11 0.00027   16.9   2.6   39    7-46    219-257 (473)
128 PRK00056 mtgA monofunctional b  55.4     8.9 0.00023   17.3   2.2   22   17-38     25-46  (226)
129 pfam03967 PRCH Photosynthetic   54.3      14 0.00036   16.1   3.4   22    2-23      8-29  (135)
130 pfam01496 V_ATPase_I V-type AT  54.2      10 0.00027   16.9   2.4   35   32-66     71-105 (707)
131 pfam06129 Chordopox_G3 Chordop  53.5       8  0.0002   17.6   1.7   23    9-31      4-26  (109)
132 PRK00269 zipA cell division pr  53.2      15 0.00037   16.0   3.0   27    1-27      1-27  (295)
133 COG3462 Predicted membrane pro  52.7      15 0.00038   16.0   3.7   32   38-69     85-116 (117)
134 pfam05756 S-antigen S-antigen   52.4     5.9 0.00015   18.3   0.9   22    9-30      5-26  (310)
135 COG4564 Signal transduction hi  52.1      15 0.00039   15.9   3.1   33    2-36    198-230 (459)
136 PRK10930 FtsH protease regulat  51.1      16 0.00041   15.8   9.3   49   47-95    247-295 (419)
137 PRK11029 FtsH protease regulat  51.0      16 0.00041   15.8  12.1   88   67-169   226-313 (334)
138 PRK05978 hypothetical protein;  50.4      16 0.00042   15.8   3.3   32    2-34     94-126 (149)
139 COG4942 Membrane-bound metallo  50.4      16 0.00042   15.8  19.9   77    8-85     12-88  (420)
140 pfam06667 PspB Phage shock pro  48.8      17 0.00044   15.6   5.8   21    1-21      1-21  (75)
141 cd03404 Band_7_HflK Band_7_Hfl  48.6      17 0.00045   15.6  13.5   19   28-46    131-149 (266)
142 cd00226 PRCH Photosynthetic re  47.5      18 0.00046   15.5   3.1   22    2-23      9-30  (246)
143 PRK09702 arbutin specific enzy  47.0      18 0.00047   15.5   4.1   27    7-34      9-35  (161)
144 PRK00404 tatB sec-independent   46.8      19 0.00048   15.4   9.4   40    2-42      1-41  (141)
145 pfam04791 LMBR1 LMBR1-like mem  46.3      19 0.00049   15.4  10.1   15   25-39    184-198 (419)
146 pfam05137 PilN Fimbrial assemb  45.9      19 0.00049   15.4  10.6   20   31-50     45-64  (162)
147 PRK00708 sec-independent trans  44.8      20 0.00051   15.3  11.6   40    2-42      1-41  (197)
148 PRK01433 hscA chaperone protei  44.1      21 0.00053   15.2  10.9   73   38-115   485-557 (595)
149 pfam05545 FixQ Cbb3-type cytoc  43.6      15 0.00038   16.0   1.8   22    6-27     12-33  (49)
150 pfam04011 LemA LemA family. Th  43.3      21 0.00054   15.1  19.6   23   26-48     36-58  (186)
151 pfam06936 Selenoprotein_S Sele  42.8      22 0.00055   15.1  10.7   21   14-35     40-60  (190)
152 PRK03427 cell division protein  39.9      24 0.00061   14.8   2.7   27    1-27      1-27  (331)
153 pfam00558 Vpu Vpu protein. The  39.5      24 0.00062   14.8   5.4   35   18-54     19-53  (81)
154 PRK10775 cell division protein  39.1      17 0.00042   15.7   1.5   30    4-34     22-51  (274)
155 pfam06170 DUF983 Protein of un  38.4      25 0.00065   14.7   2.9   32    2-33     49-80  (86)
156 COG5000 NtrY Signal transducti  37.8      26 0.00066   14.6   4.6   39  125-163   504-544 (712)
157 COG3242 Uncharacterized protei  37.8      26 0.00066   14.6   3.1   28    4-31      2-29  (62)
158 PRK06835 DNA replication prote  36.4      27  0.0007   14.5  10.4   78   79-161     5-82  (330)
159 PRK03554 tatA twin arginine tr  36.3      11 0.00027   16.9   0.1   11    5-15      4-14  (89)
160 pfam10961 DUF2763 Protein of u  36.0      25 0.00064   14.7   2.0   15    5-19     23-37  (91)
161 COG5349 Uncharacterized protei  36.0      28 0.00071   14.4   2.6   37    1-37     80-116 (126)
162 KOG4403 consensus               35.9      28 0.00071   14.4  16.6   27   43-69    253-279 (575)
163 PRK00191 tatA twin arginine tr  35.3      29 0.00073   14.4   5.6   33    1-35      1-33  (107)
164 pfam08269 Cache_2 Cache domain  34.6      29 0.00075   14.3   4.9   48   31-78      3-50  (95)
165 pfam04156 IncA IncA protein. C  34.3      30 0.00075   14.3  17.9   69   10-78     47-115 (186)
166 PRK12704 phosphodiesterase; Pr  34.1      30 0.00076   14.3  15.9   18   90-107    98-115 (455)
167 TIGR01069 mutS2 MutS2 family p  34.0      30 0.00076   14.2  11.9   92   21-113   528-623 (834)
168 PRK01371 sec-independent trans  33.6      30 0.00078   14.2   6.0   16    1-16      1-16  (135)
169 pfam07850 Renin_r Renin recept  33.0      31 0.00079   14.2   2.2   21    3-23     55-75  (98)
170 PRK13700 conjugal transfer pro  32.2      32 0.00082   14.1   3.2   19    7-25     31-49  (732)
171 pfam03245 Phage_lysis Bacterio  31.9      32 0.00083   14.0  11.9   30   49-78     54-83  (151)
172 PRK11091 aerobic respiration c  31.9      32 0.00083   14.0  15.1   72   20-98     69-140 (779)
173 PRK01100 putative accessory ge  31.6      33 0.00084   14.0   2.8   25    2-26    105-129 (207)
174 PRK09470 cpxA two-component se  30.9      34 0.00086   13.9   5.8   19   18-37    184-202 (461)
175 pfam05529 Bap31 B-cell recepto  30.5      34 0.00087   13.9  10.6   19  149-167   170-188 (192)
176 pfam02936 COX4 Cytochrome c ox  30.4      29 0.00074   14.3   1.6   27   10-36     84-110 (143)
177 KOG4075 consensus               30.1      35 0.00089   13.9   2.2   30    9-38    108-137 (167)
178 KOG2911 consensus               29.8      35  0.0009   13.8  15.4  129   39-172   230-362 (439)
179 KOG4686 consensus               29.4      36 0.00091   13.8   3.9   34    2-36    261-294 (459)
180 TIGR01932 hflC HflC protein; I  29.0      36 0.00093   13.7   6.9   45   68-112   243-287 (345)
181 PRK10747 putative protoheme IX  28.8      37 0.00094   13.7  14.1   22    2-23     36-57  (398)
182 COG4023 SBH1 Preprotein transl  28.6      37 0.00094   13.7   2.3   25    2-26     31-56  (57)
183 CHL00094 dnaK heat shock prote  28.5      37 0.00095   13.7  12.1   92   39-135   506-597 (622)
184 PRK04778 septation ring format  28.2      38 0.00096   13.7  18.0   85   29-113    30-125 (569)
185 pfam05297 Herpes_LMP1 Herpesvi  27.8      38 0.00097   13.6   3.2   14    4-17    134-147 (382)
186 pfam01920 Prefoldin_2 Prefoldi  27.1      39   0.001   13.6   6.6   13   33-45     67-79  (104)
187 pfam05439 JTB Jumping transloc  27.1      39   0.001   13.6   2.5   31    6-37     76-106 (114)
188 COG3149 PulM Type II secretory  26.9      40   0.001   13.5   6.5   36   19-58     49-84  (181)
189 pfam09911 DUF2140 Uncharacteri  26.9      17 0.00044   15.6  -0.1   25    5-29      5-29  (187)
190 PRK13386 fliH flagellar assemb  26.4      41   0.001   13.5  12.5   55  103-157   103-159 (236)
191 pfam05933 Fun_ATP-synt_8 Funga  26.4      41   0.001   13.5   4.7   34    3-37     10-43  (47)
192 pfam06160 EzrA Septation ring   26.3      41   0.001   13.5  17.8   85   28-112    25-120 (559)
193 COG0233 Frr Ribosome recycling  25.8      42  0.0011   13.4   9.8   74   34-108   110-183 (187)
194 TIGR00890 2A0111 Oxalate/Forma  25.6      42  0.0011   13.4   4.2   33    1-33    238-272 (429)
195 PTZ00227 variable surface prot  25.5      42  0.0011   13.4   3.2   38    5-45    329-366 (418)
196 pfam10183 ESSS ESSS subunit of  25.4      30 0.00077   14.2   0.9   36    5-40     87-122 (151)
197 TIGR01495 ETRAMP early transcr  25.0      39 0.00099   13.6   1.4   41   11-51      6-57  (99)
198 PRK01919 tatB sec-independent   24.6      44  0.0011   13.3  11.8   15    2-16      1-15  (169)
199 KOG2262 consensus               24.5      44  0.0011   13.3   2.5   17    7-23    314-330 (761)
200 pfam10831 DUF2556 Protein of u  23.9      45  0.0012   13.2   2.1   18    6-23      4-21  (53)
201 COG1766 fliF Flagellar basal b  23.8      46  0.0012   13.2   4.1   27   11-38    448-474 (545)
202 PRK09510 tolA cell envelope in  23.8      46  0.0012   13.2  18.6   40    9-48     18-75  (402)
203 pfam10857 DUF2701 Protein of u  23.6      46  0.0012   13.2   4.0   27   17-43     12-38  (63)
204 PRK13411 molecular chaperone D  23.6      46  0.0012   13.2  10.1   21   63-83    525-545 (655)
205 TIGR02978 phageshock_pspC phag  23.2      47  0.0012   13.1   3.8   45   26-70     60-112 (128)
206 pfam09578 Spore_YabQ Spore cor  23.2      47  0.0012   13.1   2.4   18    3-20     35-52  (80)
207 PRK09040 hypothetical protein;  22.8      48  0.0012   13.1   6.1   18    5-24     13-30  (215)
208 KOG0206 consensus               22.7      48  0.0012   13.1   3.7   10    5-14   1050-1059(1151)
209 pfam09838 DUF2065 Uncharacteri  22.6      48  0.0012   13.0   3.7   30    7-36      1-30  (57)
210 PRK09458 pspB phage shock prot  22.3      49  0.0012   13.0   5.2   20    1-20      1-20  (75)
211 pfam10112 Halogen_Hydrol 5-bro  22.2      49  0.0012   13.0  18.2   21    3-23     29-49  (199)
212 PRK11466 hybrid sensory histid  22.0      50  0.0013   13.0  21.6   36    6-42    332-369 (912)
213 KOG4304 consensus               21.9      50  0.0013   13.0   5.4   57   22-85     31-87  (250)
214 TIGR02302 aProt_lowcomp conser  21.8      48  0.0012   13.0   1.4  117   42-161   526-668 (899)
215 TIGR00895 2A0115 MFS transport  20.9      52  0.0013   12.8   4.9   55    2-56    172-231 (413)
216 cd00922 Cyt_c_Oxidase_IV Cytoc  20.4      54  0.0014   12.8   1.6   25   11-35     85-109 (136)
217 pfam11694 DUF3290 Protein of u  20.4      54  0.0014   12.8   3.4   35    3-39     14-48  (149)

No 1  
>PRK13455 F0F1 ATP synthase subunit B; Provisional
Probab=100.00  E-value=3.4e-35  Score=222.81  Aligned_cols=159  Identities=25%  Similarity=0.455  Sum_probs=155.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99798999999999999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      |..||||||.|+|+||+++|+|+++|+||.++||+|.+.|+++|++|+.++++|++++++|++++.+++.++..|+.+|+
T Consensus        24 ~~~d~~FWv~IsFvif~~iL~~~~vp~~I~~~LD~R~~~I~~dLdeAe~lreEAe~lLaeye~~l~~A~~EA~~Ii~~Ak  103 (184)
T PRK13455         24 SLSNTDFIVTLAFLLFIGILVYFKVPGMIGGMLDKRAEGIRSELEEARALREEAQTLLASYERKQREVQEQADRIVANAR  103 (184)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88895499999999999999999558999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999994339999999999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC  159 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~  159 (173)
                      .+++...+++..+++.+++++...|+.+|..++.++..+++++++++|+.++++++++++|++++.++|+++|+++++.
T Consensus       104 ~~A~~~~~~~~~~a~~~i~r~~~~Ae~~I~~~k~~A~~eir~~a~~lAi~aA~kii~~~l~~~~~~~LId~~I~el~~~  182 (184)
T PRK13455        104 DEAQAAAEQAKADLEASIARRLAAAEDQIASAEAAAVRAVRDRAISVAVAAAADVIAKQMTAAEANALIDEAIKEVEAK  182 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999888899999999999999986579998999999999999765


No 2  
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=100.00  E-value=7.5e-35  Score=220.77  Aligned_cols=157  Identities=31%  Similarity=0.542  Sum_probs=154.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79899999999999999999962288999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR   82 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~   82 (173)
                      ||+|||++|+|++||++|+||++|+||.++|++|.+.|.++|++|+..+.+|+.++.+|+.++.+++.++..|+.+|+.+
T Consensus         1 ~d~~FW~~I~fvi~~~ll~~~~~p~~i~~~Ld~R~~~I~~~l~~Ae~~~~eAe~~~~e~e~~l~~A~~ea~~Ii~~A~~~   80 (159)
T PRK09173          1 MDATFWAFVGLVLFLALVVYLKVPGMIGRSLDERADRIKNELDEARRLREEAQQLLAEYQRKRKEAEKEAADIVAAAERE   80 (159)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98129999999999999999977899999999999999999999998899999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999994339999999999999999999
Q gi|254781085|r   83 AKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC  159 (173)
Q Consensus        83 a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~  159 (173)
                      ++...+++..+++.+++++...|+.+|..++.+++.+++.+++++|+.++++++++++|+++++++|+++|+++++.
T Consensus        81 a~~~~~~~~~~a~~~~~~~~~~Ae~~I~~~~~~A~~elk~~~~~lai~~a~kii~~~ld~~~~~~Li~~~i~ev~~~  157 (159)
T PRK09173         81 AEALTAEAKRKTEEYVARRNKLAEQKIAQAEADAINAVRASAVDLAVAAAGKLLAEKVDAKAAGELFKDALAQVKTR  157 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999989999999999999999999999999999999986679998999999999999764


No 3  
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=100.00  E-value=1.7e-31  Score=201.37  Aligned_cols=156  Identities=16%  Similarity=0.254  Sum_probs=150.4

Q ss_pred             CCCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989--999999999999999996228899999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDET--FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus         1 m~~d~t--fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      |+|||+  ||.+|+|++|+++|.|| +|+||.++|++|++.|.++|++|+..+.+++..+++|+.++.+++.++..|+.+
T Consensus         1 m~in~~t~i~q~inF~il~~il~kf-~~~pi~~~l~~R~~~I~~~l~~Ae~~~~ea~~~~~e~e~~L~~a~~ea~~Ii~~   79 (159)
T PRK13461          1 MEINIPTIIATIINFIILLLILKHF-FFDKIKAVIDSRQSEIDEKIEKADEDAEKARELKLKNERILKSAKEEGKKIVEE   79 (159)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9785999999999999999999999-788899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999943399999999999999999
Q gi|254781085|r   79 AKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ  157 (173)
Q Consensus        79 a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~  157 (173)
                      |+.+++...+++..+|+.++++++.+|+.+|+.++..++.+++.+++++|+.+++++|++++|+++|.++|+++|+++|
T Consensus        80 A~~~A~~~~~~i~~~A~~ea~~i~~~A~~~Ie~e~~~a~~el~~ev~~la~~~A~kil~~~ld~~~~~~lid~~i~elG  158 (159)
T PRK13461         80 YKSKAENVYEEIVKEAHEEAESIIERAKLEIQREKEKAEYEIKNQAVDLAVLLSSKALEESIDESEHRELIKDFISKVG  158 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCC
T ss_conf             9999999999999999999999999999999999999999999999999999999999877599989999999997858


No 4  
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=100.00  E-value=2e-31  Score=200.96  Aligned_cols=157  Identities=16%  Similarity=0.295  Sum_probs=149.8

Q ss_pred             CCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989--9999999999999999962288999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDET--FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA   79 (173)
Q Consensus         2 ~~d~t--fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a   79 (173)
                      .+||.  ||++|+|++||++|+|| +|+||.++|++|++.|.++|++|+..+.+|++.+.+|+.++.+++.++..|+.+|
T Consensus        13 ~~n~~~~iw~~i~F~il~~il~kf-~~~pi~~~Ld~R~~~I~~~l~~Ae~~k~eA~~~~~e~e~~L~~A~~ea~~Ii~~A   91 (173)
T PRK13460         13 DVNPGLVVWTLVTFLVVVLVLKKF-AWDVILKALDERASGVQNDINKASELRLEAEALLKDYEARLNSAKDEANAIVAEA   91 (173)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             898779999999999999999999-6888999999999999988999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999994339999999999999999999
Q gi|254781085|r   80 KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC  159 (173)
Q Consensus        80 ~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~  159 (173)
                      +.+++...+++..+++.+++.+++.|+.+|+.++..+..+++.+++++|+.+++++++.++|+++|.++|+++|++++..
T Consensus        92 ~~~Ae~~~~~~~~~A~~ea~~i~~~A~~~Ie~ek~~A~~~lr~ei~~lav~~A~kii~~~ld~~~~~~lid~~i~elgk~  171 (173)
T PRK13460         92 KSDALKLKNKLLEETNNEVKAQKDQAVKEIELAKGKALSQLQNQIVEMTITIASKVLEKQLKKEDYKAFIETELAKLGKL  171 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999999999999999999999999987759998999999999873004


No 5  
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=100.00  E-value=2e-31  Score=200.88  Aligned_cols=155  Identities=21%  Similarity=0.317  Sum_probs=150.3

Q ss_pred             CCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989-9999999999999999962288999999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDET-FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA   79 (173)
Q Consensus         1 m~~d~t-fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a   79 (173)
                      |+||+| ||.+|+|+|||++|+|| +||||.++|+.|++.|.+.+++|+..+.++++++.+|+.++.+++.++..++.++
T Consensus         1 m~~n~T~~~~~I~F~il~~ll~~~-~~~pi~~~l~~R~~~I~~~l~~Ae~~~~~a~~~~~e~~~~l~~a~~ea~~ii~~a   79 (156)
T PRK05759          1 MNINATLIGQLIAFLILVWFCMKF-VWPPIMKALEERQKKIADGLAAAERAKKELEAAQAKAEEQLAEARAEAAEIIEQA   79 (156)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             966199999999999999999999-7878999999999999989999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999994339999999999999999
Q gi|254781085|r   80 KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI  156 (173)
Q Consensus        80 ~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l  156 (173)
                      +.+++...+++..+++.+++.++..++.+|..++.++..+++.+++++|+.+++++++.++|++.+.++|+++|++|
T Consensus        80 ~~~a~~~~~~~~~~a~~e~~~~~~~a~~~I~~e~~~a~~~l~~~i~~la~~~a~kil~~~l~~~~~~~lid~~i~~l  156 (156)
T PRK05759         80 KKRAAQIIEEAKAEAEAEAARIKAQAQAEIEQERKRAREELRKQVADLAVAGAEKILGRELDAAAHSDLIDKLIAEL  156 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHC
T ss_conf             99999999999999999999999999999999999999999999999999999999886779998999999987439


No 6  
>PRK06231 F0F1 ATP synthase subunit B; Validated
Probab=100.00  E-value=9.5e-31  Score=196.98  Aligned_cols=152  Identities=18%  Similarity=0.270  Sum_probs=145.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999996228899999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAK   84 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~   84 (173)
                      ..||.+|+|+|++++| ++|+|+|+.++|++|+++|+++|++|+..+.+|++++++|+..+.+++.++++|+.+|+.+|+
T Consensus        50 ~Fia~lIaF~ILl~lL-~k~awKPI~k~Ld~R~~kI~~~L~~Aekar~EAe~ll~e~e~~L~eAr~EA~eII~~Ak~~Ae  128 (201)
T PRK06231         50 VFIAHLIAFSILLLLG-IFLFWKPTQRFLNKRKELIEAEINQANELKQQAQQLLENAKQRHENALAQAKEIIDQANYEAL  128 (201)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999-999787899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999943399999999999999999
Q gi|254781085|r   85 ILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ  157 (173)
Q Consensus        85 ~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~  157 (173)
                      ...+++..+|+.++++++.+|+.+|+.++.++..+++.+++++|+.++++++++++|+++++++|+++|++++
T Consensus       129 ~~~~ei~~~A~~eA~~i~e~A~~eIe~Ek~~A~~elr~eva~LAv~aAeKiI~k~Ld~~~~~~LIde~IkeLe  201 (201)
T PRK06231        129 QLKSELEKEANRQANLIIFQARQEIEKERRELKEQLQKESVELAMLAAEELIKKKVDREDDDKLVDEFIRELE  201 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCC
T ss_conf             9999999999999999999999999999999999999999999999999999866799989999999986548


No 7  
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=100.00  E-value=3.3e-30  Score=193.87  Aligned_cols=155  Identities=15%  Similarity=0.242  Sum_probs=148.8

Q ss_pred             CCH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             798--999999999999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDE--TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         3 ~d~--tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      +||  -||.+|+|++|+++|++| +|+||.++|++|++.|.++|++|+..+.+++..+++|+.++.+++.++..|+.+|+
T Consensus        16 idw~t~~~q~I~F~il~~ll~kf-~~~pi~~~L~~R~~~I~~~l~~Ae~~k~eA~~~~~e~e~~L~~a~~ea~~Ii~~A~   94 (173)
T PRK13453         16 VEWGTVIVQVLTFIVLLALLKKF-AWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAK   94 (173)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97899999999999999999999-89899999999999999889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      .+++.+.+++..+|+.+++.++.+|+.+|+.++..+..+++.+++++|+.++++++++.+|++++.++|+++|+++++
T Consensus        95 ~~Ae~~~~~~~~~A~~ea~~i~~~A~~~Ie~ek~~a~~elr~ei~~lav~~A~Kil~~~l~~~~~~~LId~~i~e~Ge  172 (173)
T PRK13453         95 VQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGD  172 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999999999999999999999999999999999999999999998676999899999999986179


No 8  
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=99.97  E-value=3.3e-29  Score=188.02  Aligned_cols=155  Identities=14%  Similarity=0.228  Sum_probs=147.6

Q ss_pred             CCHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79899--9999999999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDETF--LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         3 ~d~tf--w~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      ||+++  |-+|+|+||+++|+|| +|+||.++|++|++.|.++|++|+..+.+|++.+.+|+.++.+++.++..|+.+|+
T Consensus        17 ~n~~~l~~~iInf~Il~~iL~~f-~~~pi~~~L~~R~~~I~~~l~~Ae~~k~eA~~~l~e~e~~l~~a~~ea~~Ii~~A~   95 (174)
T PRK07352         17 LNLNLLETNLINLAIVIGLLYYF-LRGFLGKILERRREAILQALKEAEERLRKAAQALAEAQQKLAQAQQEAERIRADAK   95 (174)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89128999999999999999999-59899999999999999999999999999999999999999987999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      .+++.+.+++..+++.++++++..|+.+|+.++.++..+++.+++++|+.+++++++.++|+++|.++||++|++++.
T Consensus        96 ~~a~~~~~~~~~~A~~e~e~i~~~A~~~Ie~e~~~a~~elr~ei~~lAi~~A~kil~~~ld~~~~~~lId~~I~~lGg  173 (174)
T PRK07352         96 ARAEAIRQEIEKQAIEDMARLKQTAAADLSAEAERVIAQLRREAAELAIAKAESQLPGRLDEAAQQRLIDRSIANLGG  173 (174)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCC
T ss_conf             999999999999999999999999999999999999999999999999999999998774999999999999997479


No 9  
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=99.96  E-value=2.6e-27  Score=177.00  Aligned_cols=157  Identities=26%  Similarity=0.411  Sum_probs=149.8

Q ss_pred             CCCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989--999999999999999996228899999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDET--FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus         1 m~~d~t--fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      |++.+|  ||.+++|++|+|+++|| +|||+.++|++|+.+|.++|++|+..+.+++.++.+|+..+.+++.++..|+.+
T Consensus         2 ~~~~~~~~~~~~i~F~ill~ll~~~-~~~pi~~~l~~R~~~I~~~l~~A~~~~~ea~~~~~~~~~~l~~Ar~~a~~Ii~~   80 (161)
T COG0711           2 MNFNDTNILWQLIAFVILLWLLKKF-VWKPILKALDERQAKIADDLAEAERLKEEAQALLAEYEQELEEAREQASEIIEQ   80 (161)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7521247999999999999999999-686799999999999998899999989999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   79 AKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        79 a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      |+.+++.+.+++..+++.++++++..+..+|..+++++..+|+.++.++++.+++++++..+|...+..+|+.++.++++
T Consensus        81 A~~~a~~~~~e~~~~a~~e~~r~~~~a~~~I~~e~~~a~~~l~~~~~~la~~~aekll~~~~~~~~~~~lid~~~~~l~~  160 (161)
T COG0711          81 AKKEAEQIAEEIKAEAEEELERIKEAAEAEIEAEKERALEELRAEVAELAVAIAEKLLGKKVDEAAQKDLIDAFIAELGE  160 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999998999999999999999999999999999999999999999999999999989875789899999999986334


No 10 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=99.96  E-value=3.9e-27  Score=175.99  Aligned_cols=158  Identities=13%  Similarity=0.154  Sum_probs=151.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH   81 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~   81 (173)
                      |+|.--|-+|||+|++++|+|| .|+|+.++|++|++.|.++|++|+..+.+|++.+++|+.++.+|+.++.+|+.+|+.
T Consensus        23 N~niletnlINl~Ivi~iL~~f-~~~~L~~~L~~R~~~I~~~I~eAE~~~~eA~~~L~e~~~~L~~A~~eA~~I~~~A~~  101 (184)
T CHL00019         23 NTDILETNLINLSVVLGVLIYF-GKGVLSDLLDNRKQRILNTIRNSEERREEAIEKLEKARARLRQAEIEADEIRVNGYS  101 (184)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7409999999999999999999-599999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999943399999999999999999999
Q gi|254781085|r   82 RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH  160 (173)
Q Consensus        82 ~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~~  160 (173)
                      .++..++++...++.+++++.+.|...|..++.++..++|.+++++|+..++++++..+|++.|.++||.+|..++..+
T Consensus       102 ~ae~~k~~i~~~a~~e~erl~~~A~~~I~~E~~kA~~elr~ev~~lAl~~a~k~L~~~Ld~~~q~~LId~~I~~LG~~~  180 (184)
T CHL00019        102 EIEREKLNLINSTYEDLERLENYKNETIRFEQQRAINQVRQQVFQLALQRALGTLNSCLNNELHLRTIDANIGLLGAMK  180 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999999999999999999999999999999999999999999999999866499999999999999871622


No 11 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=99.96  E-value=9.9e-27  Score=173.68  Aligned_cols=142  Identities=22%  Similarity=0.323  Sum_probs=136.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH   81 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~   81 (173)
                      .+|+||||+|+|+||+ +|+|+++|++|.+.||.|...|..++++|+.++++|++++.+|++++..++.++.+|+..|+.
T Consensus         3 fiDatFWVaISF~IFv-~Liy~k~pk~I~~~LD~kI~eIK~~ideAekLkeEAk~lL~e~ekKi~~~~~e~~emI~~Ak~   81 (154)
T PRK06568          3 FLDESFWLAVSFVIFV-YLIYRPAKKAILNSLDAKILEVQEKVLKAEKLKEDAALLFEQTNAQIKKLETLRSQMIEESNE   81 (154)
T ss_pred             CCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7540699999999999-999987589999889999999999998999878999999999999998789999999998689


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999994339999
Q gi|254781085|r   82 RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDV  144 (173)
Q Consensus        82 ~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~  144 (173)
                      +++....+...+.++.++.+...|..+|.+.+.+|.+++++++++.++..+++++....+.+.
T Consensus        82 ~aEk~i~~~~kk~~~~~e~kkk~A~~kI~Q~K~~AikdIkn~~~~~~i~~v~~~~kn~~~s~~  144 (154)
T PRK06568         82 VTKKIIQEKTKEIEEFLEHKKSDAIQLIQNQKSTASKELQDEFCDEVIKLVSEYFQSVKLSES  144 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH
T ss_conf             999999999999999999889869999999999999999999999999999999976001077


No 12 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=99.96  E-value=2.5e-26  Score=171.37  Aligned_cols=146  Identities=13%  Similarity=0.215  Sum_probs=139.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKIL   86 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~   86 (173)
                      ||++|+|++||++++++++| ||.++|++|+++|.++|+.|+..+.+++++..+|+..|.+++.++..|+.+++.+++..
T Consensus        35 FWl~i~F~ily~vl~k~~lP-rI~~vLe~R~~~I~~dL~~Ae~~k~eAe~~~~~ye~~L~~Ar~eA~~ii~eAr~~a~~~  113 (181)
T PRK13454         35 FWLLVTLVAIYFVLTRVALP-RIGAVLAERQGTITNDLAAAEELKQKAVEAEKAYNKALADARAEAQRIVAETRAEIQAE  113 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999998-88989999999999889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999943399999999999999
Q gi|254781085|r   87 AEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTIS  154 (173)
Q Consensus        87 ~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~  154 (173)
                      .+....+++.+++.++..|+.+|...+..++.+|+..+.+++.++++++.| ++|++.....|+..++
T Consensus       114 ~~~~~~~a~~el~~~i~~AE~~I~~~K~~Am~~i~~iA~d~a~~Iv~kL~g-k~~~~~v~aaV~~~~k  180 (181)
T PRK13454        114 LDVAIAKADAEIAAKAAESEKRIAEIRAGALESVEEVAKDTAEALVAALGG-KADAAAVDAAVAQRMK  180 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHC
T ss_conf             999999999999999999999999999988999999999999999999857-5877889999998747


No 13 
>TIGR01144 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005864   ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , .  F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis . These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient.   This entry represents subunit B from the F0 complex in F-ATPases found in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B .   More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0046933 hydrogen ion transporting ATP synthase activity rotational mechanism, 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0015986 ATP synthesis coupled proton transport, 0016469 proton-transporting two-sector ATPase complex.
Probab=99.95  E-value=2.6e-26  Score=171.28  Aligned_cols=146  Identities=19%  Similarity=0.266  Sum_probs=140.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999622889999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   10 FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEE   89 (173)
Q Consensus        10 ~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~   89 (173)
                      +++|+||+|+ +++|+||||..+|+.|+..|.++|..|+..++++.......+..+.+|+.++..|+.+|.+.+....++
T Consensus         2 ~~~F~llv~f-~~KY~w~Pl~~~~~~R~~~IA~~L~~AE~~~~~~~~~~~~~~~~l~~AK~~A~~ii~~A~k~~~~~~ee   80 (147)
T TIGR01144         2 LISFILLVWF-CKKYVWPPLAKAIETRQKKIADDLASAERAKKEAALAQKEAQVLLKEAKDEAQEIIENANKRGSEILEE   80 (147)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7999999999-988623799999998899859889999998888999998988999988888889999987888886999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999994339999999999999999
Q gi|254781085|r   90 GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI  156 (173)
Q Consensus        90 ~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l  156 (173)
                      +...|+.+.++++..|+.+|+.++.+++++||.++++|||.+++|++++++|+..+..+||+++.+|
T Consensus        81 ~~~~A~~e~~ki~~~A~~EI~~~~~~Ar~~Lr~~Va~L~V~~AeKii~~~iD~~~~~d~id~~~~~l  147 (147)
T TIGR01144        81 IKAEAREEREKILASARAEIEAEKERAREELRKQVADLAVAGAEKIIEREIDKQAQKDLIDKLVAEL  147 (147)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999898899999988445999999999999999999999999999988789999888999987319


No 14 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=99.95  E-value=4.9e-26  Score=169.67  Aligned_cols=138  Identities=17%  Similarity=0.258  Sum_probs=129.8

Q ss_pred             CCCCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989999-9999999999999962288999999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDETFLV-FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA   79 (173)
Q Consensus         1 m~~d~tfw~-~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a   79 (173)
                      ++||+||++ +|+|++|+++| ++|+|+||.++|++|++.|.+++++|+..+.+++.++.+|+..+.+++.++..|+.++
T Consensus         2 ~~~n~Tl~~q~i~Flil~~il-~k~l~~Pi~~~ld~R~~~I~~~l~~A~~~~~ea~~~~~e~e~~l~~Ar~ea~~ii~~A   80 (140)
T PRK07353          2 FDFDATLPLMAVQFVLLTFIL-NALFYKPVGKVVEEREDYIRTNRAEAKEKLAEAEKLEAQYEQQLASARKQAQQVIAEA   80 (140)
T ss_pred             CCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             151288999999999999999-9998888999999999999888999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999943
Q gi|254781085|r   80 KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQK  139 (173)
Q Consensus        80 ~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~  139 (173)
                      +.+++...+++..+++.+++..+..|+.+|+.++..++.+++.++.++|+.+++|+||.+
T Consensus        81 ~~~a~~~~~~~~~~A~~e~~~~~~~A~~~Ie~ek~~a~~~l~~ev~~la~~ia~Kilg~K  140 (140)
T PRK07353         81 EAEADKLYAEALAEAQAEAQASKEKARREIEQQKQSALAQLEQQVDALSRQILEKLLAAK  140 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999999999999999999999999999999999999999999876699


No 15 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=99.95  E-value=6e-26  Score=169.14  Aligned_cols=137  Identities=18%  Similarity=0.327  Sum_probs=129.0

Q ss_pred             CCCCHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9979899999-999999999999962288999999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDETFLVF-MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA   79 (173)
Q Consensus         1 m~~d~tfw~~-i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a   79 (173)
                      ++||+||++. |+|+||+++| ++|+|+||.++|++|++.|.+++++|+..+.++++++.+|+..+.+++.++..++.++
T Consensus        19 ~~~n~Tl~~q~i~FliL~~lL-~kf~~~Pi~~~ld~R~~~I~~~l~~Ae~~~~ea~~~~~eye~~L~~Ar~Ea~~ii~~A   97 (156)
T CHL00118         19 FDFNATLPLMALQFLLLMVLL-NAIFYKPIGKILDEREEYIRSNLAKASSKLAKANELTAQYEEQLSKARKEAQLLIAQS   97 (156)
T ss_pred             CCCCHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             086589999999999999999-9998989999999999999988999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999994
Q gi|254781085|r   80 KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQ  138 (173)
Q Consensus        80 ~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~  138 (173)
                      +.+++...+.+..+++.+++..+..++.+|+.++.++..+++.++.++|+.+++|+|++
T Consensus        98 ~~~a~~~~~~i~~~A~~ea~~~i~~A~~eIe~ek~~a~~el~~ev~~la~~ia~Kil~k  156 (156)
T CHL00118         98 QKEAQEIVQEELKQAQKNAESLVEEATKQLEIQKEQALKSLESQVDTLSDQIKSKLLSK  156 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999999999999999999999987585


No 16 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=99.95  E-value=1.4e-25  Score=167.07  Aligned_cols=144  Identities=19%  Similarity=0.297  Sum_probs=139.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKIL   86 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~   86 (173)
                      ||++|+|++||+++.++++| +|.++|++|+++|.++|++|+.++.+++..+++|+..|.+++.++..|+.+++.+++..
T Consensus        57 fWL~I~F~~lY~~~sk~~lP-rI~~vLe~R~~~I~~DLe~Ae~lk~EAe~~~a~Ye~~LaeAR~eA~~Ii~~Ar~~a~~~  135 (204)
T PRK09174         57 LWLAITFGLFYLFLSRVILP-RIGGIIETRRDRIAQDLDQAARLKQEADAAVAAYEQELAQARSKAASIAQAAREAAKAK  135 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999760-37779999999998799999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999943399999999999
Q gi|254781085|r   87 AEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEK  151 (173)
Q Consensus        87 ~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~  151 (173)
                      .+....+++.+++.++..++.+|...+..++.+|+..+.+++..+++++++.++|+......|+.
T Consensus       136 ~e~~~a~~ea~L~~kia~AE~~I~~~r~~Al~~V~~IA~d~A~~iV~~L~G~~v~~~~v~~aV~a  200 (204)
T PRK09174        136 AEAERAEIEASLEKKLKEAEERIAAIKAKAMADVGSIAEETAAAIVEQLIGGTADKASVSAAVKA  200 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99999999999999999999999999998799999999999999999986899999999999987


No 17 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=99.95  E-value=4.5e-25  Score=164.07  Aligned_cols=165  Identities=12%  Similarity=0.178  Sum_probs=151.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999962288999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKI   85 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~   85 (173)
                      ..|-+|.|.++||++||| ++||+.++|++|++.|++.|..|+....+++..+++|++.+.+++.|+..|..+|+.+++.
T Consensus         4 fIgqLI~Faii~f~~~Kf-VvP~~~k~l~eR~daIeggie~Ae~Aqaea~~al~~y~~qLaeAr~EAa~IreeAr~~~~~   82 (445)
T PRK13428          4 FIGQLIGFAVIVFLVVRF-VVPPVRRLMAAQQDAVRQQLADSATAADKLAEADQAHAKAVEDAKAEAHRVVEEARTDAER   82 (445)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999-8527999999999999988999999999999999999999999999999999999988999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999433-999999999999999999999974
Q gi|254781085|r   86 LAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK  164 (173)
Q Consensus        86 ~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l-~~~~~~~~I~~~i~~l~~~~k~~~  164 (173)
                      +.+++..+|..++++++.+++.+|+.++.++..++|.++..+|++.+++++++.+ |...+...||+|+++|+++-...-
T Consensus        83 I~ae~raqA~~Ea~RI~~~g~~Qiea~Rqq~v~~LR~e~G~~av~lA~~iVge~l~D~a~qs~tVDRFL~eLd~map~~~  162 (445)
T PRK13428         83 IAEQLRAQADVEAERIKVQGARQVQLLRQQLIRQLRLELGHESVRQARELVRNHVADPAQQSATVDRFLDELDAMAPSTA  162 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             99999988889999999989999999999999999999879999999999865404388876159888999871388723


Q ss_pred             HHHHHHC
Q ss_conf             0044312
Q gi|254781085|r  165 NTTETLG  171 (173)
Q Consensus       165 n~~~~~~  171 (173)
                      ..+-|+.
T Consensus       163 ~~~~~~~  169 (445)
T PRK13428        163 DVDYPLL  169 (445)
T ss_pred             HHCCHHH
T ss_conf             2222667


No 18 
>CHL00167 consensus
Probab=99.94  E-value=1.9e-24  Score=160.38  Aligned_cols=155  Identities=15%  Similarity=0.162  Sum_probs=150.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH   81 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~   81 (173)
                      |+|.-.|-+||+++++++|+|| .++|+++.|++|++.|.+.|++|+....+|.+.+.+++.++..++.++.+|+.+++.
T Consensus        25 NtnilETNlINl~ivigiL~~f-g~~~L~~~L~~Rke~I~~~I~eAE~r~~eA~~~L~eak~~L~qA~~eA~~Ir~~a~~  103 (182)
T CHL00167         25 NPDILEANVINILILLSGLIYL-GKNFLGSSLEERQQKVLEAIQESEERLEQANSRLSESEKQLAQAQIVIEQIKKEAEK  103 (182)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7439999999999999999998-467689899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999943399999999999999999
Q gi|254781085|r   82 RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ  157 (173)
Q Consensus        82 ~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~  157 (173)
                      .++.++++....++.+++++...+...|..++.++..+++.+++.+|+..+.+.++..+|++.|.++||.+|..++
T Consensus       104 ~ae~~k~~i~~~a~~d~erl~~~a~~~I~~E~~ra~~qlr~qv~~lAl~ka~~~L~~~Ld~~~q~~lId~~I~~Lg  179 (182)
T CHL00167        104 TARKVKSSILAQGKLDIERLTNNGKSSIETAEKQIKKQIQQQITFLAIKRVTLQLENQMTPNLQLRIIDNNIAKLG  179 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999999999899999999999999999999999999998866499999999999999867


No 19 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=99.94  E-value=6.5e-25  Score=163.15  Aligned_cols=136  Identities=21%  Similarity=0.276  Sum_probs=128.4

Q ss_pred             CCCCHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989----9999999999999999962288999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDET----FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREII   76 (173)
Q Consensus         1 m~~d~t----fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~   76 (173)
                      |.+|+.    ||.+|+|++++|+| ++|+|+||.++|++|.+.|.+++++|+..+.+++++..+|+..+.+++.++..|+
T Consensus         1 ~ml~~n~~~~i~~~i~FliL~~iL-~kflykPi~k~ld~R~~~I~~~l~~A~~~~~ea~~l~~e~e~~L~~Ar~ea~~ii   79 (141)
T PRK08476          1 MMLDINPYLMLLTFVVFLLLIVIL-NSWLYKPLLKFMDNRNASIKNDLEKVKTNSSESVEINAEIEAILKNAREEANKIR   79 (141)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             965776779999999999999999-9995878999999999999988999999899999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   77 LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIIS  137 (173)
Q Consensus        77 ~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~  137 (173)
                      .+++.+++...+.+...++.+++..++.+..+|+.++.+++.+|+.++.+||+.+++|+..
T Consensus        80 ~~A~~~A~~~~~~~~~~Ar~eae~~~~~a~~~ie~ek~~a~~~L~~qv~~Ls~~ia~Ki~~  140 (141)
T PRK08476         80 QEAIAAAKEEAEQKIEAKKEELESKYEAFAQQLANQKQELKEQLLSQMPEFKEALNAKLSK  140 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999999999999999999999999999999999999998899999999986735


No 20 
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=99.94  E-value=5.7e-24  Score=157.65  Aligned_cols=158  Identities=13%  Similarity=0.232  Sum_probs=149.6

Q ss_pred             CCCCH-HHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99798-999-9999999999999996228899999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDE-TFL-VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus         1 m~~d~-tfw-~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      |+||| ||. -+|||+||+|+| ++|+|+||.++|++|++.|.+.+++|+..+.+|+++..+|+.++.++..++..++.+
T Consensus         1 M~idw~T~~~q~iNfliL~~lL-~rFl~~Pv~~~i~~R~~~I~~~l~~A~~~~~eA~~~~~~~e~~~~~~~~e~~~~l~~   79 (246)
T TIGR03321         1 MLIDWFTVIAQLINFLILVWLL-KRFLYRPILDAMDAREKKIAGELADADTKKREAEQERREYEEKNEELDQQREVLLTK   79 (246)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9010999999999999999999-999688999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   79 AKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        79 a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      ++.+++..++....+++.+++.....++..+..++......++..+..++..+++++|+.-.|.+....+++.++..|.+
T Consensus        80 A~~eAe~er~~ll~~Ar~eae~~r~~~~~~l~~E~~~~~~~l~~r~~~~~~~ia~k~L~~Lad~~le~~~v~~f~~rL~~  159 (246)
T TIGR03321        80 AKEEAQAERQRLLDEAREEADEIREKWQEALRREQAALSDELRRRTGAEVFAIARKVLTDLADTDLEERMVDVFVQRLRT  159 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999866324799999999999871


Q ss_pred             H
Q ss_conf             9
Q gi|254781085|r  159 C  159 (173)
Q Consensus       159 ~  159 (173)
                      .
T Consensus       160 l  160 (246)
T TIGR03321       160 L  160 (246)
T ss_pred             C
T ss_conf             9


No 21 
>PRK06569 F0F1 ATP synthase subunit B'; Validated
Probab=99.92  E-value=1e-22  Score=150.39  Aligned_cols=139  Identities=16%  Similarity=0.179  Sum_probs=134.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKIL   86 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~   86 (173)
                      ||++|+|++||++++++++|+ |.++|++|+++|.++|++|+..+.+++..+.+|+..+.+++.++..+..+++......
T Consensus        14 fWL~itF~~ly~~~sk~~lPr-i~~~le~R~~~I~~dl~~A~~~k~eae~~~~~ye~~l~~Ak~eA~~i~~ea~~~l~~e   92 (157)
T PRK06569         14 FWLIVTFGLLYIFVYKFITPK-AEEIFNNRQTNIQDNITQADTLTLEVEKLNKYYNEEIDKTNTEIDRLKKEKIDSLESE   92 (157)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999998604-8779998999999889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999433999999
Q gi|254781085|r   87 AEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNS  146 (173)
Q Consensus        87 ~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~  146 (173)
                      .+......+++++..+..++.+|...+.+++..+...+.++|.+++++++|.++|.+...
T Consensus        93 ~~~k~~~le~~l~~~i~~aekeI~~~k~~a~~~i~~ia~eia~~iI~kl~G~k~n~s~l~  152 (157)
T PRK06569         93 FLIKKKNLEQDLKNSINQNIEDINLAAKQFRTNKSEAIIKLAVNIIEKITGTKADMNLLQ  152 (157)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH
T ss_conf             999999999999999999999999999987876999999999999999868887788764


No 22 
>pfam00430 ATP-synt_B ATP synthase B/B' CF(0). Part of the CF(0) (base unit) of the ATP synthase. The base unit is thought to translocate protons through membrane (inner membrane in mitochondria, thylakoid membrane in plants, cytoplasmic membrane in bacteria). The B subunits are thought to interact with the stalk of the CF(1) subunits. This domain should not be confused with the ab CF(1) proteins (in the head of the ATP synthase) which are found in pfam00006
Probab=99.92  E-value=1.1e-22  Score=150.24  Aligned_cols=131  Identities=23%  Similarity=0.308  Sum_probs=124.3

Q ss_pred             HHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999-9999999999999996228899999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    6 TFL-VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAK   84 (173)
Q Consensus         6 tfw-~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~   84 (173)
                      ||| .+|+|++||++|+|| +||||.++|++|++.|.+++++|+..+.+++..+.+|+..+.+++.++..++.+++.+++
T Consensus         1 tl~~qlI~F~il~~il~~~-~~~pi~~~l~~R~~~I~~~l~~a~~~~~ea~~~~~~~e~~l~~a~~ea~~i~~~a~~~a~   79 (132)
T pfam00430         1 TLETNLINFLILVGLLIYF-GYKPLGKILDERKEKIANNIKEAEERLKQAAALLAEAEQQLAQARAEASEIINNAKKEAQ   79 (132)
T ss_pred             CHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9888999999999999999-798899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999
Q gi|254781085|r   85 ILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIIS  137 (173)
Q Consensus        85 ~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~  137 (173)
                      ...+.+..+++.+++.++..++.+|..++..++.+++.+++++|+.+++|++|
T Consensus        80 ~~~~~~~~~a~~e~~~~~~~a~~~i~~e~~~a~~~l~~e~~~la~~~aekilG  132 (132)
T pfam00430        80 KLKEEILAEAQKDAERLLESARAEIEQEKEQALAELRQQVAALAVQIAEKLLG  132 (132)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999999999999999999999999999999999999999999999976559


No 23 
>PRK08475 F0F1 ATP synthase subunit B; Validated
Probab=99.87  E-value=6.7e-20  Score=134.04  Aligned_cols=122  Identities=18%  Similarity=0.216  Sum_probs=116.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999962288999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKI   85 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~   85 (173)
                      -||.++||+||+++|+|| +++|+.++|.+|++.|.+.|++++....+|++.+.++++++.+++.++..|+..|+.+++.
T Consensus        27 ii~r~iNf~I~~gIL~yf-~~kpi~~~l~~R~~~I~~~L~eae~~~~eA~~~l~~~~~kLe~Ak~eA~~Iie~Akkeae~  105 (170)
T PRK08475         27 IIERTINFLIFVGILWYF-AAKPIKNFYKSRINSISKRLEEIQAKLKESKEKKKDALKKLEEAKEKAELIVETAKKEAYI  105 (170)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             599999999999999999-2878999999899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999
Q gi|254781085|r   86 LAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS  128 (173)
Q Consensus        86 ~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la  128 (173)
                      ..+.+..+++.+++++..+++..+..+.+.+.++++.++.+-.
T Consensus       106 ~kq~I~~~a~~eie~L~~~a~e~i~~E~rka~~el~~eil~e~  148 (170)
T PRK08475        106 LTQKIEKQTKDDIENLIKSFEEQMDFEVRKIKRELVEEILNEL  148 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999998


No 24 
>pfam05405 Mt_ATP-synt_B Mitochondrial ATP synthase B chain precursor (ATP-synt_B). The Fo sector of the ATP synthase is a membrane bound complex which mediates proton transport. It is composed of nine different polypeptide subunits (a, b, c, d, e, f, g F6, A6L).
Probab=99.18  E-value=6.1e-08  Score=64.68  Aligned_cols=151  Identities=18%  Similarity=0.271  Sum_probs=104.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79899999999999999999962288999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR   82 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~   82 (173)
                      +|.-||++++|++|+++++++ +++++..++|.|.+.|.+.++++.....++-+..-++++++.........+....++.
T Consensus        13 ~neE~~val~fi~f~~~~~K~-~G~~i~~~lD~~~e~i~~~l~~~r~~~~~a~~~~ie~~k~~~~~~~~~~~l~~~~ke~   91 (163)
T pfam05405        13 VNEETIVALCFIGFLIFVYKS-LGPSIKEWLDKRIEKIQDELNQSRNLHEKALKERIEYVKKLQSVVEETKVLFEVSKET   91 (163)
T ss_pred             ECCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             754499999999999999998-1088999999989999999998888789999999999999999999899999982467


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999943399999999999999999
Q gi|254781085|r   83 AKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ  157 (173)
Q Consensus        83 a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~  157 (173)
                      +....+....+-...+......--.-.-......+...+.+.++   -+..++...--++...+..+...|.+|+
T Consensus        92 ~al~~e~~~~~~~~~v~~evk~~Ld~~v~~e~~~r~~~Q~~~v~---~v~~~V~~~i~~~~~~k~~l~~~I~~l~  163 (163)
T pfam05405        92 VALEAEAFERELQAALAREIKSKLDTLVRKESSVRQREQDHLVN---WVISSVLKELSPPKFQKKSLQESIADLE  163 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             99777999999999999999999999999998999999999999---9999999870791679999999988609


No 25 
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=98.98  E-value=1e-06  Score=57.53  Aligned_cols=146  Identities=9%  Similarity=0.167  Sum_probs=99.9

Q ss_pred             CCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             979899999999-9999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSL-IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         2 ~~d~tfw~~i~f-~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      .||+++|.--.| +++.|+++|+++++.+.--+..   -+...=+.......+|++...    ....+..+-...+.+|+
T Consensus        24 Qld~~~f~sQiFWl~i~F~ily~vl~k~~lPrI~~---vLe~R~~~I~~dL~~Ae~~k~----eAe~~~~~ye~~L~~Ar   96 (181)
T PRK13454         24 QLDFDTFPNQIFWLLVTLVAIYFVLTRVALPRIGA---VLAERQGTITNDLAAAEELKQ----KAVEAEKAYNKALADAR   96 (181)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH
T ss_conf             99902407899999999999999999999988898---999999999988999999999----99999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999-------99999999999999994339999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY-------AKIADFSVEIVREIISQKMNDDVNSSIFEKTI  153 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~-------~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i  153 (173)
                      .++..+..+...++...++.....++.++.....++...|.       ..+.+++.+++..++.+-.+ .....-|...+
T Consensus        97 ~eA~~ii~eAr~~a~~~~~~~~~~a~~el~~~i~~AE~~I~~~K~~Am~~i~~iA~d~a~~Iv~kL~g-k~~~~~v~aaV  175 (181)
T PRK13454         97 AEAQRIVAETRAEIQAELDVAIAKADAEIAAKAAESEKRIAEIRAGALESVEEVAKDTAEALVAALGG-KADAAAVDAAV  175 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999988999999999999999999857-58778899999


Q ss_pred             HH
Q ss_conf             99
Q gi|254781085|r  154 SS  155 (173)
Q Consensus       154 ~~  155 (173)
                      ++
T Consensus       176 ~~  177 (181)
T PRK13454        176 AQ  177 (181)
T ss_pred             HH
T ss_conf             98


No 26 
>PRK06231 F0F1 ATP synthase subunit B; Validated
Probab=98.84  E-value=6.7e-06  Score=52.82  Aligned_cols=145  Identities=12%  Similarity=0.168  Sum_probs=96.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98999999999999999999622889999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRA   83 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a   83 (173)
                      =|++|+++.-+|-|++|+++ +++.+=+-+-.--+.=+   +..++..++|++.    .........+....+.+|+.++
T Consensus        45 fPn~~~Fia~lIaF~ILl~l-L~k~awKPI~k~Ld~R~---~kI~~~L~~Aeka----r~EAe~ll~e~e~~L~eAr~EA  116 (201)
T PRK06231         45 FPNFWVFIAHLIAFSILLLL-GIFLFWKPTQRFLNKRK---ELIEAEINQANEL----KQQAQQLLENAKQRHENALAQA  116 (201)
T ss_pred             CCCHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH---HHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78869999999999999999-99997878999999999---9999999999999----9999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   84 KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        84 ~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      +.+++++...|+...+.....|+.+......++..++..+-...--++-..+..-.+.  .-.++|.+.++.-..
T Consensus       117 ~eII~~Ak~~Ae~~~~ei~~~A~~eA~~i~e~A~~eIe~Ek~~A~~elr~eva~LAv~--aAeKiI~k~Ld~~~~  189 (201)
T PRK06231        117 KEIIDQANYEALQLKSELEKEANRQANLIIFQARQEIEKERRELKEQLQKESVELAML--AAEELIKKKVDREDD  189 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHCCHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999999999--999999866799989


No 27 
>PRK13453 F0F1 ATP synthase subunit B; Provisional
Probab=98.61  E-value=3.5e-05  Score=48.69  Aligned_cols=63  Identities=13%  Similarity=0.140  Sum_probs=32.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   66 SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS  128 (173)
Q Consensus        66 ~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la  128 (173)
                      .....+....+.+++.++..++.++..++....+..+..|+.+......++..++..+-....
T Consensus        69 ~~~~~e~e~~L~~a~~ea~~Ii~~A~~~Ae~~~~~~~~~A~~ea~~i~~~A~~~Ie~ek~~a~  131 (173)
T PRK13453         69 QKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAI  131 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999999999999999999999999999999999999999


No 28 
>PRK07352 F0F1 ATP synthase subunit B; Validated
Probab=98.40  E-value=0.00013  Score=45.34  Aligned_cols=128  Identities=6%  Similarity=-0.048  Sum_probs=68.4

Q ss_pred             HHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999996228899---999999999999999999999999999----99999999999999999999999999999999
Q gi|254781085|r   17 LVIVVYLRIPSILL---SFLDAHADKIRDDIFEARRLREKSENI----LMQYKEKHSKVEEETREIILAAKHRAKILAEE   89 (173)
Q Consensus        17 ~~il~~~~~~~~i~---~~l~~R~~~I~~~l~~A~~~~~~a~~~----~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~   89 (173)
                      ++.++|.++.+.+.   ..+.+--+.-.....+|+....+.++.    ..+....+.+++.++..+..+...++....+.
T Consensus        36 L~~f~~~pi~~~L~~R~~~I~~~l~~Ae~~k~eA~~~l~e~e~~l~~a~~ea~~Ii~~A~~~a~~~~~~~~~~A~~e~e~  115 (174)
T PRK07352         36 LYYFLRGFLGKILERRREAILQALKEAEERLRKAAQALAEAQQKLAQAQQEAERIRADAKARAEAIRQEIEKQAIEDMAR  115 (174)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99995989999999999999999999999999999999999999998799999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999943399999999999
Q gi|254781085|r   90 GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEK  151 (173)
Q Consensus        90 ~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~  151 (173)
                      +...++.+++.....+..++.       .++-..+...+..+..+-+.........+.+|+.
T Consensus       116 i~~~A~~~Ie~e~~~a~~elr-------~ei~~lAi~~A~kil~~~ld~~~~~~lId~~I~~  170 (174)
T PRK07352        116 LKQTAAADLSAEAERVIAQLR-------REAAELAIAKAESQLPGRLDEAAQQRLIDRSIAN  170 (174)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             999999999999999999999-------9999999999999998774999999999999997


No 29 
>PRK13460 F0F1 ATP synthase subunit B; Provisional
Probab=98.39  E-value=0.00014  Score=45.25  Aligned_cols=64  Identities=11%  Similarity=0.108  Sum_probs=38.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   64 KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF  127 (173)
Q Consensus        64 ~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~l  127 (173)
                      .......+....+.+|+.++..++..+..++....+.....|+.++....+++..++..+-...
T Consensus        65 eA~~~~~e~e~~L~~A~~ea~~Ii~~A~~~Ae~~~~~~~~~A~~ea~~i~~~A~~~Ie~ek~~A  128 (173)
T PRK13460         65 EAEALLKDYEARLNSAKDEANAIVAEAKSDALKLKNKLLEETNNEVKAQKDQAVKEIELAKGKA  128 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999999999999999


No 30 
>PRK08476 F0F1 ATP synthase subunit B'; Validated
Probab=98.37  E-value=0.00016  Score=44.90  Aligned_cols=111  Identities=8%  Similarity=0.104  Sum_probs=80.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999996228899999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   17 LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ   96 (173)
Q Consensus        17 ~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~   96 (173)
                      |++| ++++.+.+-+-+       .+-+++=+..-...-..-.........+..+...++.+|+.++..+++++..+++.
T Consensus        17 FliL-~~iL~kflykPi-------~k~ld~R~~~I~~~l~~A~~~~~ea~~l~~e~e~~L~~Ar~ea~~ii~~A~~~A~~   88 (141)
T PRK08476         17 FLLL-IVILNSWLYKPL-------LKFMDNRNASIKNDLEKVKTNSSESVEINAEIEAILKNAREEANKIRQEAIAAAKE   88 (141)
T ss_pred             HHHH-HHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999-999999958789-------99999999999988999999899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999
Q gi|254781085|r   97 ISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREI  135 (173)
Q Consensus        97 ~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~ki  135 (173)
                      ..+..+..|+.+++...+.+..++..+......+.-.++
T Consensus        89 ~~~~~~~~Ar~eae~~~~~a~~~ie~ek~~a~~~L~~qv  127 (141)
T PRK08476         89 EAEQKIEAKKEELESKYEAFAQQLANQKQELKEQLLSQM  127 (141)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999999999999889


No 31 
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=98.34  E-value=0.00018  Score=44.58  Aligned_cols=148  Identities=12%  Similarity=0.149  Sum_probs=108.1

Q ss_pred             CCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             979899999999-9999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSL-IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         2 ~~d~tfw~~i~f-~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      .||+++|.--.| +++.|+++|+++++.+   +-.=..-+.+.=+......++|+++..+.+..+.    +-...+.+|+
T Consensus        46 qld~~t~~sQifWL~I~F~~lY~~~sk~~---lPrI~~vLe~R~~~I~~DLe~Ae~lk~EAe~~~a----~Ye~~LaeAR  118 (204)
T PRK09174         46 PFDSTHYASQLLWLAITFGLFYLFLSRVI---LPRIGGIIETRRDRIAQDLDQAARLKQEADAAVA----AYEQELAQAR  118 (204)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHH
T ss_conf             99834508999999999999999999997---6037779999999998799999999999999999----9999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999-------99999999999999994339999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY-------AKIADFSVEIVREIISQKMNDDVNSSIFEKTI  153 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~-------~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i  153 (173)
                      .++..+..+...++..+++.....++.++.....++...|.       ..+..++.+++..++.+.++.+....-+...+
T Consensus       119 ~eA~~Ii~~Ar~~a~~~~e~~~a~~ea~L~~kia~AE~~I~~~r~~Al~~V~~IA~d~A~~iV~~L~G~~v~~~~v~~aV  198 (204)
T PRK09174        119 SKAASIAQAAREAAKAKAEAERAEIEASLEKKLKEAEERIAAIKAKAMADVGSIAEETAAAIVEQLIGGTADKASVSAAV  198 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999987999999999999999999868999999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254781085|r  154 SSI  156 (173)
Q Consensus       154 ~~l  156 (173)
                      +..
T Consensus       199 ~aa  201 (204)
T PRK09174        199 KAA  201 (204)
T ss_pred             HHH
T ss_conf             875


No 32 
>PRK13461 F0F1 ATP synthase subunit B; Provisional
Probab=98.23  E-value=0.00033  Score=42.98  Aligned_cols=141  Identities=18%  Similarity=0.177  Sum_probs=58.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH
Q ss_conf             989999999999999999996228899---999999999999999999999999999999----9999999999999999
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLRIPSILL---SFLDAHADKIRDDIFEARRLREKSENILMQ----YKEKHSKVEEETREII   76 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~~~~~i~---~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~----~~~~l~~a~~ea~~i~   76 (173)
                      =|++..++.|++++..++|.++.+.+.   ..+.+--+.-...-.+|+....+.+..+.+    ....+.+++.++..+.
T Consensus         9 i~q~inF~il~~il~kf~~~pi~~~l~~R~~~I~~~l~~Ae~~~~ea~~~~~e~e~~L~~a~~ea~~Ii~~A~~~A~~~~   88 (159)
T PRK13461          9 IATIINFIILLLILKHFFFDKIKAVIDSRQSEIDEKIEKADEDAEKARELKLKNERILKSAKEEGKKIVEEYKSKAENVY   88 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999788899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999943399999999999
Q gi|254781085|r   77 LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEK  151 (173)
Q Consensus        77 ~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~  151 (173)
                      .....+|....+.....++.+++.....+..++.       .++-+.+...|..+.++-+....+....+.+|++
T Consensus        89 ~~i~~~A~~ea~~i~~~A~~~Ie~e~~~a~~el~-------~ev~~la~~~A~kil~~~ld~~~~~~lid~~i~e  156 (159)
T PRK13461         89 EEIVKEAHEEAESIIERAKLEIQREKEKAEYEIK-------NQAVDLAVLLSSKALEESIDESEHRELIKDFISK  156 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999-------9999999999999998775999899999999978


No 33 
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=98.21  E-value=0.00035  Score=42.84  Aligned_cols=143  Identities=13%  Similarity=0.083  Sum_probs=74.8

Q ss_pred             HHHHHHHHHHHHHHHHHHH-HHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999999999999-622889---99999999999999999999999999999----999999999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYL-RIPSIL---LSFLDAHADKIRDDIFEARRLREKSENIL----MQYKEKHSKVEEETREII   76 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~-~~~~~i---~~~l~~R~~~I~~~l~~A~~~~~~a~~~~----~~~~~~l~~a~~ea~~i~   76 (173)
                      |++..++.|+++++.+.+. ++-+.+   ...+.+--+.-...-.+|+....+.+..+    .+.+..+.+++.++..+.
T Consensus         6 W~~I~fvi~~~ll~~~~~p~~i~~~Ld~R~~~I~~~l~~Ae~~~~eAe~~~~e~e~~l~~A~~ea~~Ii~~A~~~a~~~~   85 (159)
T PRK09173          6 WAFVGLVLFLALVVYLKVPGMIGRSLDERADRIKNELDEARRLREEAQQLLAEYQRKRKEAEKEAADIVAAAEREAEALT   85 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999997789999999999999999999999889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999943399999999999999
Q gi|254781085|r   77 LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTIS  154 (173)
Q Consensus        77 ~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~  154 (173)
                      .++..+++...+.....++.+++.....|..++.       .++-+.+...+..+..+-+..+-+....+.+|.+.=.
T Consensus        86 ~~~~~~a~~~~~~~~~~Ae~~I~~~~~~A~~elk-------~~~~~lai~~a~kii~~~ld~~~~~~Li~~~i~ev~~  156 (159)
T PRK09173         86 AEAKRKTEEYVARRNKLAEQKIAQAEADAINAVR-------ASAVDLAVAAAGKLLAEKVDAKAAGELFKDALAQVKT  156 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999899999999999999999-------9999999999999998667999899999999999976


No 34 
>PRK06328 type III secretion system protein; Validated
Probab=98.16  E-value=0.00047  Score=42.13  Aligned_cols=108  Identities=12%  Similarity=0.123  Sum_probs=81.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   52 EKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI  131 (173)
Q Consensus        52 ~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~  131 (173)
                      .+.=..+...+..+..++.++..++.++..+++..+++.......+.-..-..-...+..+.......++..++++++.+
T Consensus        22 ae~y~~~~~A~eilE~Ak~~Ae~~~~ea~~e~e~~~eea~~~G~~eG~~~~~~~la~~~~e~~~~~~~~e~~lv~lvl~a  101 (223)
T PRK06328         22 PEAFSALLDAKELLEKTKEDSEAYTQETHEECAELREEAKNQGFKEGSEAWSKQLAFLEKETQALRIQVKEALVPLAIAS  101 (223)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999987499999999999999999999999999999999889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHCC--HHHHHHHHHHHHHHHHHH
Q ss_conf             9999994339--999999999999999999
Q gi|254781085|r  132 VREIISQKMN--DDVNSSIFEKTISSIQSC  159 (173)
Q Consensus       132 ~~kil~~~l~--~~~~~~~I~~~i~~l~~~  159 (173)
                      ++|+++..++  ++.--.+|...|..+.+.
T Consensus       102 arKIIg~el~~~pe~vl~iVr~aL~~vr~~  131 (223)
T PRK06328        102 VKKIIGKELELHPETIVSIISEALKELTQN  131 (223)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHC
T ss_conf             999988887608899999999999998618


No 35 
>CHL00118 atpG ATP synthase CF0 B' subunit; Validated
Probab=98.10  E-value=0.0006  Score=41.50  Aligned_cols=113  Identities=13%  Similarity=0.144  Sum_probs=76.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999962288999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   12 SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGC   91 (173)
Q Consensus        12 ~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~   91 (173)
                      .+.++-|+++++++++.+-+       .|.+-+++=+..-...-..-............+....+.+|+.++..++.+..
T Consensus        26 ~~q~i~FliL~~lL~kf~~~-------Pi~~~ld~R~~~I~~~l~~Ae~~~~ea~~~~~eye~~L~~Ar~Ea~~ii~~A~   98 (156)
T CHL00118         26 PLMALQFLLLMVLLNAIFYK-------PIGKILDEREEYIRSNLAKASSKLAKANELTAQYEEQLSKARKEAQLLIAQSQ   98 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999898-------99999999999999889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999
Q gi|254781085|r   92 QNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI  131 (173)
Q Consensus        92 ~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~  131 (173)
                      ..+....+.++.+|+.++.....++..++..+-...--++
T Consensus        99 ~~a~~~~~~i~~~A~~ea~~~i~~A~~eIe~ek~~a~~el  138 (156)
T CHL00118         99 KEAQEIVQEELKQAQKNAESLVEEATKQLEIQKEQALKSL  138 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999


No 36 
>PRK06569 F0F1 ATP synthase subunit B'; Validated
Probab=98.04  E-value=0.00081  Score=40.74  Aligned_cols=139  Identities=11%  Similarity=0.132  Sum_probs=97.1

Q ss_pred             CCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             979899999999-9999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSL-IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         2 ~~d~tfw~~i~f-~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      .||++||.--.| +++.|.++|+++++.+   |-.=...+...-+.......+|+++..+.+.    +..+-...+.+|+
T Consensus         3 Qld~~~~~sQifWL~itF~~ly~~~sk~~---lPri~~~le~R~~~I~~dl~~A~~~k~eae~----~~~~ye~~l~~Ak   75 (157)
T PRK06569          3 QFDIATYYSQIFWLIVTFGLLYIFVYKFI---TPKAEEIFNNRQTNIQDNITQADTLTLEVEK----LNKYYNEEIDKTN   75 (157)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH
T ss_conf             99822408999999999999999999998---6048779998999999889999999999999----9999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHCCHHHHHH
Q ss_conf             9999999999999999999999999999999999999999-------999999999999999994339999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL-------YAKIADFSVEIVREIISQKMNDDVNSS  147 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l-------~~~~~~la~~~~~kil~~~l~~~~~~~  147 (173)
                      .+|..+..+..+++..+++......+.++..+-.++.+++       ...+.+.+.+++..++++-.+......
T Consensus        76 ~eA~~i~~ea~~~l~~e~~~k~~~le~~l~~~i~~aekeI~~~k~~a~~~i~~ia~eia~~iI~kl~G~k~n~s  149 (157)
T PRK06569         76 TEIDRLKKEKIDSLESEFLIKKKNLEQDLKNSINQNIEDINLAAKQFRTNKSEAIIKLAVNIIEKITGTKADMN  149 (157)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHH
T ss_conf             99999999999999999999999999999999999999999999987876999999999999999868887788


No 37 
>PRK13428 F0F1 ATP synthase subunit delta; Provisional
Probab=98.01  E-value=0.00091  Score=40.45  Aligned_cols=80  Identities=14%  Similarity=0.096  Sum_probs=44.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   54 SENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR  133 (173)
Q Consensus        54 a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~  133 (173)
                      ..+...++.+...+++.++..|+.+++.+|+.+.+.+...++..++...+++-.++       +.++-..+++++..++.
T Consensus        62 LaeAr~EAa~IreeAr~~~~~I~ae~raqA~~Ea~RI~~~g~~Qiea~Rqq~v~~L-------R~e~G~~av~lA~~iVg  134 (445)
T PRK13428         62 VEDAKAEAHRVVEEARTDAERIAEQLRAQADVEAERIKVQGARQVQLLRQQLIRQL-------RLELGHESVRQARELVR  134 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999998899999999988889999999989999999999999999-------99987999999999986


Q ss_pred             HHHHHHC
Q ss_conf             9999433
Q gi|254781085|r  134 EIISQKM  140 (173)
Q Consensus       134 kil~~~l  140 (173)
                      .-|....
T Consensus       135 e~l~D~a  141 (445)
T PRK13428        135 NHVADPA  141 (445)
T ss_pred             HHCCCHH
T ss_conf             5404388


No 38 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=97.98  E-value=0.0011  Score=40.05  Aligned_cols=114  Identities=11%  Similarity=0.096  Sum_probs=66.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999996228899999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   14 IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQN   93 (173)
Q Consensus        14 ~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~   93 (173)
                      +|-|++| ++++++++.+-+   ...+...-+.......+|+....+.+..    ..+....+.+++.++..++.....+
T Consensus        11 ~I~F~il-~~ll~~~~~~pi---~~~l~~R~~~I~~~l~~Ae~~~~~a~~~----~~e~~~~l~~a~~ea~~ii~~a~~~   82 (156)
T PRK05759         11 LIAFLIL-VWFCMKFVWPPI---MKALEERQKKIADGLAAAERAKKELEAA----QAKAEEQLAEARAEAAEIIEQAKKR   82 (156)
T ss_pred             HHHHHHH-HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999-999999978789---9999999999998999999999999999----9999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999
Q gi|254781085|r   94 IEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREI  135 (173)
Q Consensus        94 a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~ki  135 (173)
                      +....+.....++.+++....++...+..+......++-..+
T Consensus        83 a~~~~~~~~~~a~~e~~~~~~~a~~~I~~e~~~a~~~l~~~i  124 (156)
T PRK05759         83 AAQIIEEAKAEAEAEAARIKAQAQAEIEQERKRAREELRKQV  124 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999999999999999999


No 39 
>PRK07353 F0F1 ATP synthase subunit B'; Validated
Probab=97.97  E-value=0.0011  Score=39.96  Aligned_cols=112  Identities=11%  Similarity=0.128  Sum_probs=70.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999622889999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   10 FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEE   89 (173)
Q Consensus        10 ~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~   89 (173)
                      ++.-++.|++| ++++++.+-+       .|.+-+++=+..-...-..-............+....+.+|+.++..++..
T Consensus         8 l~~q~i~Flil-~~il~k~l~~-------Pi~~~ld~R~~~I~~~l~~A~~~~~ea~~~~~e~e~~l~~Ar~ea~~ii~~   79 (140)
T PRK07353          8 LPLMAVQFVLL-TFILNALFYK-------PVGKVVEEREDYIRTNRAEAKEKLAEAEKLEAQYEQQLASARKQAQQVIAE   79 (140)
T ss_pred             HHHHHHHHHHH-HHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999-9999999888-------899999999999988899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999
Q gi|254781085|r   90 GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV  129 (173)
Q Consensus        90 ~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~  129 (173)
                      +...+....+..+..|+.++......+..++..+-...-.
T Consensus        80 A~~~a~~~~~~~~~~A~~e~~~~~~~A~~~Ie~ek~~a~~  119 (140)
T PRK07353         80 AEAEADKLYAEALAEAQAEAQASKEKARREIEQQKQSALA  119 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999


No 40 
>PRK02292 V-type ATP synthase subunit E; Provisional
Probab=97.87  E-value=0.0017  Score=38.91  Aligned_cols=100  Identities=13%  Similarity=0.097  Sum_probs=81.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   56 NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREI  135 (173)
Q Consensus        56 ~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~ki  135 (173)
                      +...+....+.+|+.++..|+.+|..+++.+...+..+++.+++.+..+.......+.+...-..+..+.+-+...+..-
T Consensus        13 ~A~~ea~~I~~eA~~ea~~I~~~a~~~ae~~~~~~~~~a~~ea~~~~~r~~ssA~Le~r~~~L~ak~e~i~~v~~~a~~~   92 (187)
T PRK02292         13 EARAEVSEIRAEADERAEEIIAEAEADAKDILGDAEAEAEEDIEQLRQQEISSANLEAKRARLNARKEVLEEVYNQVEDA   92 (187)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999998779999999999999999999999999


Q ss_pred             HHHHCCHHHHHHHHHHHHHHH
Q ss_conf             994339999999999999999
Q gi|254781085|r  136 ISQKMNDDVNSSIFEKTISSI  156 (173)
Q Consensus       136 l~~~l~~~~~~~~I~~~i~~l  156 (173)
                      |..- +.+.+..++...+...
T Consensus        93 L~~l-~~~~~~~llk~ll~~~  112 (187)
T PRK02292         93 IASL-PGDKREELLKNLLDAD  112 (187)
T ss_pred             HHCC-CCHHHHHHHHHHHHHC
T ss_conf             8668-9115999999999874


No 41 
>PRK13455 F0F1 ATP synthase subunit B; Provisional
Probab=97.84  E-value=0.0019  Score=38.65  Aligned_cols=151  Identities=10%  Similarity=0.106  Sum_probs=90.1

Q ss_pred             HHHHHH--HHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999--999999--9999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    5 ETFLVF--MSLIIF--LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         5 ~tfw~~--i~f~il--~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      +.||.+  -.|.++  |++++.+++|.|+.+.+.   ....+..+..+...++|+++..+.+..+.+.    +..+.+++
T Consensus        20 ~~~~~~~d~~FWv~IsFvif~~iL~~~~vp~~I~---~~LD~R~~~I~~dLdeAe~lreEAe~lLaey----e~~l~~A~   92 (184)
T PRK13455         20 GPFFSLSNTDFIVTLAFLLFIGILVYFKVPGMIG---GMLDKRAEGIRSELEEARALREEAQTLLASY----ERKQREVQ   92 (184)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHH
T ss_conf             9988888954999999999999999995589999---9999999999999999999999999999999----99999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999943399999999999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH  160 (173)
Q Consensus        81 ~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~~  160 (173)
                      .+++.++.++..++....+.....++..+......+...+...-.+...++=.....-.+.  .-.++|.+.++.=....
T Consensus        93 ~EA~~Ii~~Ak~~A~~~~~~~~~~a~~~i~r~~~~Ae~~I~~~k~~A~~eir~~a~~lAi~--aA~kii~~~l~~~~~~~  170 (184)
T PRK13455         93 EQADRIVANARDEAQAAAEQAKADLEASIARRLAAAEDQIASAEAAAVRAVRDRAISVAVA--AAADVIAKQMTAAEANA  170 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHCCHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999998888999999999--99999986579998999


Q ss_pred             HHHH
Q ss_conf             9974
Q gi|254781085|r  161 QMDK  164 (173)
Q Consensus       161 k~~~  164 (173)
                      -+++
T Consensus       171 LId~  174 (184)
T PRK13455        171 LIDE  174 (184)
T ss_pred             HHHH
T ss_conf             9999


No 42 
>PRK01558 V-type ATP synthase subunit E; Provisional
Probab=97.76  E-value=0.0026  Score=37.84  Aligned_cols=100  Identities=12%  Similarity=0.114  Sum_probs=75.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   51 REKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE  130 (173)
Q Consensus        51 ~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~  130 (173)
                      ++-.++-..+..+.+.+|+.++..|+.+|+.+|+.+.    .+|+.+++.....++..+.....++...+++.+.++-..
T Consensus        14 ~eGVekg~~eA~~IIa~A~~~A~~Iv~~Ae~eAe~i~----~~AekeA~~~k~~~~~aL~~A~rd~ll~lk~~i~~~~~~   89 (198)
T PRK01558         14 KDGLEEAERLANEIILNAKEEAEAIVLKAEEEAKELK----AKAEKEANDYKRHSLEASRQAIRDLIIGFEKNLKSLFKA   89 (198)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9878899999999999999999999999999999999----999998999999679999999999999999999999999


Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             999999943399999999999999
Q gi|254781085|r  131 IVREIISQKMNDDVNSSIFEKTIS  154 (173)
Q Consensus       131 ~~~kil~~~l~~~~~~~~I~~~i~  154 (173)
                      .+...+..-+|++--.++|-...+
T Consensus        90 ~v~~~v~~~~d~~~L~~lIl~v~~  113 (198)
T PRK01558         90 ALKDEVAEVYDSNFLRELIIRVVD  113 (198)
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             999999986389999999999987


No 43 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=97.71  E-value=0.003  Score=37.41  Aligned_cols=124  Identities=12%  Similarity=0.086  Sum_probs=72.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999622889999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   10 FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEE   89 (173)
Q Consensus        10 ~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~   89 (173)
                      +.+.+|=+++|+.. ++....++|-+==+.=+..   ......+|++...+.+..+.    +++.-+.+|+.+++.++.+
T Consensus        27 letnlINl~Ivi~i-L~~f~~~~L~~~L~~R~~~---I~~~I~eAE~~~~eA~~~L~----e~~~~L~~A~~eA~~I~~~   98 (184)
T CHL00019         27 LETNLINLSVVLGV-LIYFGKGVLSDLLDNRKQR---ILNTIRNSEERREEAIEKLE----KARARLRQAEIEADEIRVN   98 (184)
T ss_pred             HHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999-9999599999999999999---99999999999999999999----9999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999999999999999999999999999999999999999999994339
Q gi|254781085|r   90 GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN  141 (173)
Q Consensus        90 ~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~  141 (173)
                      +...++...+.+..+++.+++..+..+...+..+-...-.++-..+..--+.
T Consensus        99 A~~~ae~~k~~i~~~a~~e~erl~~~A~~~I~~E~~kA~~elr~ev~~lAl~  150 (184)
T CHL00019         99 GYSEIEREKLNLINSTYEDLERLENYKNETIRFEQQRAINQVRQQVFQLALQ  150 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999


No 44 
>PRK01005 V-type ATP synthase subunit E; Provisional
Probab=97.71  E-value=0.0031  Score=37.40  Aligned_cols=101  Identities=15%  Similarity=0.153  Sum_probs=67.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999999-999
Q gi|254781085|r   52 EKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF-SVE  130 (173)
Q Consensus        52 ~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~l-a~~  130 (173)
                      +-.++-..+..+.+.+|+.++..|+.+|+.+|+.+    +.+|+++++......+..+...-.++...++..+.+. -.+
T Consensus        20 EGVe~g~~eA~~II~~A~~qA~~Ii~~Ae~eAe~i----l~~A~keAe~~~~~~~s~L~~A~rqav~aLk~~i~~~if~~   95 (208)
T PRK01005         20 ETLKPAEDEAGAIVHNAKEQAKRIIEEAQEEAQQI----IRSAEETADQKLKQGESALVQAGKRSLESLKQAVENKIFRE   95 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             87778999999999999999999999999999999----99999999999996799999999999999999999999999


Q ss_pred             HHHHHHHHHC-CHHHHHHHHHHHHHHH
Q ss_conf             9999999433-9999999999999999
Q gi|254781085|r  131 IVREIISQKM-NDDVNSSIFEKTISSI  156 (173)
Q Consensus       131 ~~~kil~~~l-~~~~~~~~I~~~i~~l  156 (173)
                      .+...+..-+ |++--.++|-..+...
T Consensus        96 ~l~~~V~~~~~d~e~l~~LI~e~v~~~  122 (208)
T PRK01005         96 SLVEWLEHVLTDPEVSAKLVQALVQAI  122 (208)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             999999998658999999999999986


No 45 
>pfam02326 YMF19 Plant ATP synthase F0. This family corresponds to subunit 8 (YMF19) of the F0 complex of plant and algae mitochondrial F-ATPases (EC:3.6.1.34).
Probab=97.61  E-value=0.00019  Score=44.41  Aligned_cols=58  Identities=10%  Similarity=0.225  Sum_probs=42.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK   67 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~   67 (173)
                      ||+++.|+++|++++++++|+ |.++|+.|...+.....  ...+.+-......+...+..
T Consensus        13 fWl~~~f~~~y~~~~~~~lP~-i~~il~~R~~~~~~~~~--~~~~~~~~~~~~~~d~~i~~   70 (84)
T pfam02326        13 FWLCLFFFTFYIFLLNFILPK-ISRILKLRKKLLSSLIS--SKLGKEQSLLGVSKDSLLAN   70 (84)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH--HHHCCCCCCCHHHHHHHHHH
T ss_conf             999999999999999933045-88999999999998888--87543731000317999997


No 46 
>COG0711 AtpF F0F1-type ATP synthase, subunit b [Energy production and conversion]
Probab=97.58  E-value=0.0048  Score=36.25  Aligned_cols=110  Identities=15%  Similarity=0.162  Sum_probs=61.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999996228899999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   17 LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ   96 (173)
Q Consensus        17 ~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~   96 (173)
                      |++|+|+ +++++-+-+.+=   +...-+.......+|+....+.+    .+..+...-+.+++.++..+++.+..+++.
T Consensus        16 F~ill~l-l~~~~~~pi~~~---l~~R~~~I~~~l~~A~~~~~ea~----~~~~~~~~~l~~Ar~~a~~Ii~~A~~~a~~   87 (161)
T COG0711          16 FVILLWL-LKKFVWKPILKA---LDERQAKIADDLAEAERLKEEAQ----ALLAEYEQELEEAREQASEIIEQAKKEAEQ   87 (161)
T ss_pred             HHHHHHH-HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999-999968679999---99999999988999999899999----999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999
Q gi|254781085|r   97 ISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE  134 (173)
Q Consensus        97 ~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~k  134 (173)
                      ..+....+++.........+..++..+-...--++-..
T Consensus        88 ~~~e~~~~a~~e~~r~~~~a~~~I~~e~~~a~~~l~~~  125 (161)
T COG0711          88 IAEEIKAEAEEELERIKEAAEAEIEAEKERALEELRAE  125 (161)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999999999999999999999999999999


No 47 
>PRK06937 type III secretion system protein; Reviewed
Probab=97.55  E-value=0.0052  Score=36.07  Aligned_cols=105  Identities=12%  Similarity=0.082  Sum_probs=78.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   55 ENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE  134 (173)
Q Consensus        55 ~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~k  134 (173)
                      -..+-+....+..++.++..|+.+|+...+...+....+...+......+.-........+....+......++..+++|
T Consensus        26 ~~~~~~A~~ile~A~~~A~~i~~~A~~~~e~~~~~Gy~eG~~ea~~e~ae~i~~~~~~~~~~~~~le~~l~~lv~~av~k  105 (204)
T PRK06937         26 YQSLLSAEELVEAARQRAAEIEAEAREVYEQQKQLGYEAGLDEARTEQAELILETVLQCQEFYRGIEQQMSEVVLEAVRK  105 (204)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99984399999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9994339999999999999999999
Q gi|254781085|r  135 IISQKMNDDVNSSIFEKTISSIQSC  159 (173)
Q Consensus       135 il~~~l~~~~~~~~I~~~i~~l~~~  159 (173)
                      +++.-.+.+..-.++...+..+.+.
T Consensus       106 Ilg~~d~~el~~~~v~~al~~v~~~  130 (204)
T PRK06937        106 ILNDYDDVERTLQVVREALALVSNQ  130 (204)
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             8654683899999999999997359


No 48 
>TIGR01144 ATP_synt_b ATP synthase F0, B subunit; InterPro: IPR005864   ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , .  F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis . These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient.   This entry represents subunit B from the F0 complex in F-ATPases found in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B .   More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0046933 hydrogen ion transporting ATP synthase activity rotational mechanism, 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0015986 ATP synthesis coupled proton transport, 0016469 proton-transporting two-sector ATPase complex.
Probab=97.54  E-value=0.0054  Score=35.96  Aligned_cols=136  Identities=9%  Similarity=0.083  Sum_probs=103.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999996228-------899999999999999999999999999999999999999999999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPS-------ILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~-------~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      +|.+++.|+-   =++|-++-.       .|.+.|..=...=..--.--............+....+..|+.....+..+
T Consensus         4 ~F~llv~f~~---KY~w~Pl~~~~~~R~~~IA~~L~~AE~~~~~~~~~~~~~~~~l~~AK~~A~~ii~~A~k~~~~~~ee   80 (147)
T TIGR01144         4 SFILLVWFCK---KYVWPPLAKAIETRQKKIADDLASAERAKKEAALAQKEAQVLLKEAKDEAQEIIENANKRGSEILEE   80 (147)
T ss_pred             HHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999998---8623799999998899859889999998888999998988999988888889999987888886999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999943399999999999
Q gi|254781085|r   79 AKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEK  151 (173)
Q Consensus        79 a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~  151 (173)
                      ++.+|......+...++.+++....+|+..+.       .++-+-++.+|-.++.+-+......+.-+++|+.
T Consensus        81 ~~~~A~~e~~ki~~~A~~EI~~~~~~Ar~~Lr-------~~Va~L~V~~AeKii~~~iD~~~~~d~id~~~~~  146 (147)
T TIGR01144        81 IKAEAREEREKILASARAEIEAEKERAREELR-------KQVADLAVAGAEKIIEREIDKQAQKDLIDKLVAE  146 (147)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998988999999884459999999999999-------9999999999999998878999988899998731


No 49 
>PRK03963 V-type ATP synthase subunit E; Provisional
Probab=97.47  E-value=0.0067  Score=35.42  Aligned_cols=98  Identities=13%  Similarity=0.072  Sum_probs=68.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   57 ILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREII  136 (173)
Q Consensus        57 ~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil  136 (173)
                      ...+.+..+.+|+.++..|+.+|..+++.........+..+++..............+...-..+..+.+-+...+.+-|
T Consensus        15 A~~~a~~Il~eA~~eae~I~~~a~~~a~~~~~~~~~k~~~ea~~~~~r~~s~a~l~~r~~~L~ak~e~i~~v~~~a~~~L   94 (198)
T PRK03963         15 AEQKIEYILSEARKEAEKIKEEARRRAEARAEWILRRAKTQAELEKQRIIANARLEVRRKRLEVQEEYISKVLEEVRERL   94 (198)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999989999999999999999999998


Q ss_pred             HHHCCHHHHHHHHHHHHHH
Q ss_conf             9433999999999999999
Q gi|254781085|r  137 SQKMNDDVNSSIFEKTISS  155 (173)
Q Consensus       137 ~~~l~~~~~~~~I~~~i~~  155 (173)
                      .. ++.+.+..++...+.+
T Consensus        95 ~~-l~~~~Y~~~l~~Li~~  112 (198)
T PRK03963         95 AE-LPEEEYFETLKALLKE  112 (198)
T ss_pred             HC-CCCCHHHHHHHHHHHH
T ss_conf             75-6730389999999999


No 50 
>PRK01005 V-type ATP synthase subunit E; Provisional
Probab=97.33  E-value=0.01  Score=34.42  Aligned_cols=105  Identities=16%  Similarity=0.164  Sum_probs=54.0

Q ss_pred             HHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999-99999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   53 KSENILMQ-YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI  131 (173)
Q Consensus        53 ~a~~~~~~-~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~  131 (173)
                      +.+++... |..-+..++.++.+|+.+|+.+|+.+++++..+|+..+..-...|+.....-+......-++.+.+|-..+
T Consensus         9 kiq~Lidki~~EGVe~g~~eA~~II~~A~~qA~~Ii~~Ae~eAe~il~~A~keAe~~~~~~~s~L~~A~rqav~aLk~~i   88 (208)
T PRK01005          9 KLKQICDALREETLKPAEDEAGAIVHNAKEQAKRIIEEAQEEAQQIIRSAEETADQKLKQGESALVQAGKRSLESLKQAV   88 (208)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999999877789999999999999999999999999999999999999999999679999999999999999999


Q ss_pred             HHH----HHHHHCCHHH-HHHHHHHHHHHHH
Q ss_conf             999----9994339999-9999999999999
Q gi|254781085|r  132 VRE----IISQKMNDDV-NSSIFEKTISSIQ  157 (173)
Q Consensus       132 ~~k----il~~~l~~~~-~~~~I~~~i~~l~  157 (173)
                      ...    .+...+.... ...++.+.|.++-
T Consensus        89 ~~~if~~~l~~~V~~~~~d~e~l~~LI~e~v  119 (208)
T PRK01005         89 ENKIFRESLVEWLEHVLTDPEVSAKLVQALV  119 (208)
T ss_pred             HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             9999999999999998658999999999999


No 51 
>pfam00430 ATP-synt_B ATP synthase B/B' CF(0). Part of the CF(0) (base unit) of the ATP synthase. The base unit is thought to translocate protons through membrane (inner membrane in mitochondria, thylakoid membrane in plants, cytoplasmic membrane in bacteria). The B subunits are thought to interact with the stalk of the CF(1) subunits. This domain should not be confused with the ab CF(1) proteins (in the head of the ATP synthase) which are found in pfam00006
Probab=97.18  E-value=0.015  Score=33.46  Aligned_cols=61  Identities=8%  Similarity=0.104  Sum_probs=33.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   67 KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF  127 (173)
Q Consensus        67 ~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~l  127 (173)
                      ....+....+.+++.++..+......++....+..+..++.++.....++..++..+....
T Consensus        51 ~~~~~~e~~l~~a~~ea~~i~~~a~~~a~~~~~~~~~~a~~e~~~~~~~a~~~i~~e~~~a  111 (132)
T pfam00430        51 ALLAEAEQQLAQARAEASEIINNAKKEAQKLKEEILAEAQKDAERLLESARAEIEQEKEQA  111 (132)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999999999999


No 52 
>PRK08475 F0F1 ATP synthase subunit B; Validated
Probab=97.17  E-value=0.015  Score=33.37  Aligned_cols=125  Identities=14%  Similarity=0.141  Sum_probs=93.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             22889999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   25 IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKD  104 (173)
Q Consensus        25 ~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~  104 (173)
                      +|..+.+.+.+   ...+.-+.......++++.+.+....+.+++.    -+.+|+.++..+++.+..++...-+++..+
T Consensus        41 L~yf~~kpi~~---~l~~R~~~I~~~L~eae~~~~eA~~~l~~~~~----kLe~Ak~eA~~Iie~Akkeae~~kq~I~~~  113 (170)
T PRK08475         41 LWYFAAKPIKN---FYKSRINSISKRLEEIQAKLKESKEKKKDALK----KLEEAKEKAELIVETAKKEAYILTQKIEKQ  113 (170)
T ss_pred             HHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99992878999---99989999999999999999999999999999----999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHH----HHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999433999----9999999999999
Q gi|254781085|r  105 LEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDD----VNSSIFEKTISSI  156 (173)
Q Consensus       105 a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~----~~~~~I~~~i~~l  156 (173)
                      ++.+|+..+.++...+..+.-...-++++.++.+-++.+    +++.+++-.++.+
T Consensus       114 a~~eie~L~~~a~e~i~~E~rka~~el~~eil~e~~~~~~~~l~~~~~~~~~~kkv  169 (170)
T PRK08475        114 TKDDIENLIKSFEEQMDFEVRKIKRELVEEILNELFESKKVSLDQSECVNIILKKV  169 (170)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHC
T ss_conf             99999999999999999999999999999999998727134568999999998643


No 53 
>PRK00106 hypothetical protein; Provisional
Probab=97.11  E-value=0.017  Score=33.02  Aligned_cols=75  Identities=19%  Similarity=0.206  Sum_probs=40.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   31 SFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIH  110 (173)
Q Consensus        31 ~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~  110 (173)
                      ..+..+...+...+..|+.          +......+|+.++..|+.+|+.+++....++.-+++.++.....+.+.++.
T Consensus        24 ~~~~~~k~~~~~~~~~a~~----------~A~~~~~~Ae~eA~~i~~~A~~eae~~kke~~leAKee~~~~r~e~e~e~~   93 (535)
T PRK00106         24 IKLKSAKEAAELTLLNAEQ----------EAVNLRGKAEVDAEHIKKTAKRESKALRKELLLEAKEEARKYREEIEQEFK   93 (535)
T ss_pred             HHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9998888768989999999----------999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHH
Q ss_conf             99999
Q gi|254781085|r  111 YMKLE  115 (173)
Q Consensus       111 ~~~~~  115 (173)
                      ..+.+
T Consensus        94 ~rr~e   98 (535)
T PRK00106         94 SERQE   98 (535)
T ss_pred             HHHHH
T ss_conf             99999


No 54 
>TIGR03321 alt_F1F0_F0_B alternate F1F0 ATPase, F0 subunit B. CC and in principle may run in either direction. This model represents the F0 subunit B of this apparent second ATP synthase.
Probab=97.08  E-value=0.019  Score=32.86  Aligned_cols=67  Identities=13%  Similarity=0.116  Sum_probs=34.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   68 VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE  134 (173)
Q Consensus        68 a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~k  134 (173)
                      .+.+....+.+...+.....+.+..+++.+-+.++.+|+.+++..+..+...+..+-..+.....+.
T Consensus        58 ~~~~~e~~~~~~~~e~~~~l~~A~~eAe~er~~ll~~Ar~eae~~r~~~~~~l~~E~~~~~~~l~~r  124 (246)
T TIGR03321        58 ERREYEEKNEELDQQREVLLTKAKEEAQAERQRLLDEAREEADEIREKWQEALRREQAALSDELRRR  124 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999999999999999999


No 55 
>TIGR02926 AhaH ATP synthase archaeal, H subunit; InterPro: IPR014275   A-ATPases (or A1A0-ATPase) (3.6.3.14 from EC) are found exclusively in Archaea and display a close resemblance in structure and subunit composition to V-ATPases, although their function in both ATP synthesis and ATP hydrolysis is closer to that of F-ATPases . A-ATPases are composed of two linked complexes: the A1 complex, consisting of seven subunits, contains the catalytic core that synthesizes/hydrolyses ATP, while the A0 complex, consisting of at least two subunits, forms the membrane-spanning pore . The rotary motor in A-ATPases is composed of only two subunits, the stator subunit I and the rotor subunit C . A-ATPases may have arisen as an adaptation to the different cellular needs and the more extreme environmental conditions faced by Archaeal species.  This entry represents subunit H of the archaeal A-ATPase; it is unclear precisely where subunit H fits into the complex.   More information about this protein can be found at Protein of the Month: ATP Synthases ..
Probab=96.87  E-value=0.028  Score=31.79  Aligned_cols=79  Identities=16%  Similarity=0.150  Sum_probs=69.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   53 KSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI  131 (173)
Q Consensus        53 ~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~  131 (173)
                      +..+.-......+..|+.++..++.+|+.+|..+.+.+..+|....+.++..++.++..+....+..=...+-++....
T Consensus         3 ~IK~AE~~A~~~i~eA~~~~~~~i~eAr~eA~~l~e~Ae~eA~~~~~e~i~~a~~~i~~E~~~I~~~~eke~e~~~~~A   81 (85)
T TIGR02926         3 EIKKAEEEAEELIEEAKEEREQRIAEAREEAKELLEEAEEEAKKLKEEIIEEAEEEIEKEAEKILEEGEKEIEELKSKA   81 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             8899899999998989999986689998998888899889889999888899999999879998866556399999960


No 56 
>PRK02292 V-type ATP synthase subunit E; Provisional
Probab=96.87  E-value=0.029  Score=31.75  Aligned_cols=78  Identities=14%  Similarity=0.161  Sum_probs=38.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999999943
Q gi|254781085|r   62 KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQK  139 (173)
Q Consensus        62 ~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~  139 (173)
                      ++.+.+++.++..|+.+|+.+++.+...+..+|....+.....++.+......+....-+-.+-......-+.++..-
T Consensus         8 ~~I~~~A~~ea~~I~~eA~~ea~~I~~~a~~~ae~~~~~~~~~a~~ea~~~~~r~~ssA~Le~r~~~L~ak~e~i~~v   85 (187)
T PRK02292          8 EDIRDEARAEVSEIRAEADERAEEIIAEAEADAKDILGDAEAEAEEDIEQLRQQEISSANLEAKRARLNARKEVLEEV   85 (187)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999999999999999999999999999999999877999999999999999999


No 57 
>PRK01558 V-type ATP synthase subunit E; Provisional
Probab=96.86  E-value=0.029  Score=31.70  Aligned_cols=62  Identities=23%  Similarity=0.183  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   61 YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD  126 (173)
Q Consensus        61 ~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~  126 (173)
                      |+.-+..++.++.+|+.+|+.+|+.++.+    |+.+++.++..|+.+.+..+......++..+-+
T Consensus        13 ~~eGVekg~~eA~~IIa~A~~~A~~Iv~~----Ae~eAe~i~~~AekeA~~~k~~~~~aL~~A~rd   74 (198)
T PRK01558         13 KKDGLEEAERLANEIILNAKEEAEAIVLK----AEEEAKELKAKAEKEANDYKRHSLEASRQAIRD   74 (198)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99878899999999999999999999999----999999999999998999999679999999999


No 58 
>PRK03963 V-type ATP synthase subunit E; Provisional
Probab=96.81  E-value=0.032  Score=31.49  Aligned_cols=41  Identities=15%  Similarity=0.089  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999
Q gi|254781085|r   67 KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQ  107 (173)
Q Consensus        67 ~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~  107 (173)
                      ++......+...+..+++.........++..+....-.++.
T Consensus        40 ~a~~~~~~~~~k~~~ea~~~~~r~~s~a~l~~r~~~L~ak~   80 (198)
T PRK03963         40 RAEARAEWILRRAKTQAELEKQRIIANARLEVRRKRLEVQE   80 (198)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999899999999


No 59 
>PRK01194 V-type ATP synthase subunit E; Provisional
Probab=96.71  E-value=0.038  Score=31.03  Aligned_cols=99  Identities=14%  Similarity=0.069  Sum_probs=81.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   58 LMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIIS  137 (173)
Q Consensus        58 ~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~  137 (173)
                      ..+....+.++..++..|..++...+..+......+++.+++.+..+.......+........+..+.+-+...+..-+.
T Consensus        15 e~k~k~I~~ea~~ea~~i~~ea~~k~~~i~~~~~~rae~e~~~i~~~ii~sA~le~kk~~l~a~~e~ld~~~~~~~e~i~   94 (185)
T PRK01194         15 EEKKKEINDEYSKRIEKLEKECDSKIQSIKEYYEKKMRAEISRLKKSIIDKANIEARSIKREKRREILKDYLDIAYEHLM   94 (185)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98999999999999999999899999999999999888999999999998750788999999999999999999999986


Q ss_pred             HHCCHHHHHHHHHHHHHHH
Q ss_conf             4339999999999999999
Q gi|254781085|r  138 QKMNDDVNSSIFEKTISSI  156 (173)
Q Consensus       138 ~~l~~~~~~~~I~~~i~~l  156 (173)
                      .-.....+.+++...+..-
T Consensus        95 ~~~~~k~Y~~lL~kLi~~A  113 (185)
T PRK01194         95 NITKSKEYDSILNKMIEVA  113 (185)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             6877755899999999999


No 60 
>CHL00167 consensus
Probab=96.48  E-value=0.055  Score=30.13  Aligned_cols=123  Identities=15%  Similarity=0.142  Sum_probs=76.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999622889999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   10 FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEE   89 (173)
Q Consensus        10 ~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~   89 (173)
                      +-+.+|=+++|+...+ ....++|.+==+.=+..   ....-.+|++...+....+.+++    .-+.+|+.+++.++.+
T Consensus        29 lETNlINl~ivigiL~-~fg~~~L~~~L~~Rke~---I~~~I~eAE~r~~eA~~~L~eak----~~L~qA~~eA~~Ir~~  100 (182)
T CHL00167         29 LEANVINILILLSGLI-YLGKNFLGSSLEERQQK---VLEAIQESEERLEQANSRLSESE----KQLAQAQIVIEQIKKE  100 (182)
T ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999-98467689899999999---99999999999999999999999----9999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999999999999999999999999999999999999999999999433
Q gi|254781085|r   90 GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM  140 (173)
Q Consensus        90 ~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l  140 (173)
                      +...+....+....++..++++.+..+...+..+-.....++-..+...-+
T Consensus       101 a~~~ae~~k~~i~~~a~~d~erl~~~a~~~I~~E~~ra~~qlr~qv~~lAl  151 (182)
T CHL00167        101 AEKTARKVKSSILAQGKLDIERLTNNGKSSIETAEKQIKKQIQQQITFLAI  151 (182)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999989999999999999999999999


No 61 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=96.45  E-value=0.057  Score=30.03  Aligned_cols=76  Identities=18%  Similarity=0.284  Sum_probs=57.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   29 LLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKD  104 (173)
Q Consensus        29 i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~  104 (173)
                      +..-|++.+........+++..+.+++.+..+++......+.+...++.+++.+++....++..+++..+....+.
T Consensus       519 li~~l~~~~~~~e~~~~~~~~~~~e~~~~~~~l~~~~~~l~~~~~~~~~~~~~ea~~~i~~a~~e~~~~i~~lk~~  594 (780)
T PRK00409        519 LIASLEELERELEEKAEEAEKLLKEAEKLKEELEEQKEKLQEREDKLLLEAEEEAQQAIKEAKKEAAEIIKELRQL  594 (780)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999974


No 62 
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion]
Probab=96.34  E-value=0.066  Score=29.66  Aligned_cols=79  Identities=15%  Similarity=0.160  Sum_probs=59.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   52 EKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE  130 (173)
Q Consensus        52 ~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~  130 (173)
                      .+..+.-......+.+++.++..++.+|+.++..+.++...++....+..+..++.++..+...++.+=...+.++...
T Consensus        10 ~eIk~aE~~ad~~IeeAkEe~~~~i~eAr~eareiieeaE~eA~~~~~e~l~~~~ee~e~ea~eI~~~ae~~~~~~~~k   88 (108)
T COG2811          10 REIKKAEISADEEIEEAKEEAEQIIKEAREEAREIIEEAEEEAEKLAQEILEEAREEAEEEAEEILAEAEKEASAILSK   88 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999988658999999998899899999988999999999999999999999889888999999998889779999888


No 63 
>TIGR02499 HrpE_YscL_not type III secretion apparatus protein, HrpE/YscL family; InterPro: IPR012842    This entry is related to IPR009335 from INTERPRO, but is broader. IPR009335 from INTERPRO describes HrpE-like proteins, components of bacterial type III secretion systems primarily in bacteria that infect plants. This entry also includes the homologous proteins of animal pathogens, such as YscL of Yersinia pestis. This entry excludes the related protein FliH of the bacterial flagellar apparatus (see IPR000563 from INTERPRO)..
Probab=96.26  E-value=0.073  Score=29.40  Aligned_cols=100  Identities=8%  Similarity=0.077  Sum_probs=82.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999--99999999999999999999999999999999999999999999999
Q gi|254781085|r   59 MQYKEKHSKVEEETREIILAAKHRAKILAEE--GCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREII  136 (173)
Q Consensus        59 ~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~--~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil  136 (173)
                      ......+.+|+..+..|+..|.++++.....  ....+....-..-..--..-.....+....+.+.+..+...+++++|
T Consensus        17 ~~A~~il~~A~~~A~~~~~~A~e~~e~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~a~~~~l   96 (183)
T TIGR02499        17 ARAQAILAAARQRAEAILADAEEEAEASRQLLKGYEQGLEQFWQEAAAQLVEWQQEAEQLEASLEERLAELVLQALEQIL   96 (183)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             84999999999999999999999999999999999999999999999999999999999999999999999999999986


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             9433999999999999999999
Q gi|254781085|r  137 SQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus       137 ~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      +.-++..+...++-..+..+-.
T Consensus        97 ~~~~~qQ~~~~~~~~~lr~~~~  118 (183)
T TIGR02499        97 GETLGQQDESERLVRLLRQLLA  118 (183)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHH
T ss_conf             5633589988999999999999


No 64 
>pfam12072 DUF3552 Domain of unknown function (DUF3552). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is about 200 amino acids in length. This domain is found associated with pfam00013, pfam01966. This domain has a single completely conserved residue A that may be functionally important.
Probab=96.21  E-value=0.078  Score=29.22  Aligned_cols=18  Identities=22%  Similarity=0.486  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999994339
Q gi|254781085|r  124 IADFSVEIVREIISQKMN  141 (173)
Q Consensus       124 ~~~la~~~~~kil~~~l~  141 (173)
                      ++.++.+-+.+.|-..+.
T Consensus       143 iaglt~eEAk~~Ll~~~e  160 (201)
T pfam12072       143 ISGLTAEEAKEILLEEVE  160 (201)
T ss_pred             HHCCCHHHHHHHHHHHHH
T ss_conf             869999999999999999


No 65 
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=96.05  E-value=0.094  Score=28.78  Aligned_cols=18  Identities=22%  Similarity=0.457  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHHHCC
Q ss_conf             999999999999994339
Q gi|254781085|r  124 IADFSVEIVREIISQKMN  141 (173)
Q Consensus       124 ~~~la~~~~~kil~~~l~  141 (173)
                      ++.++.+-+.+.|-..+.
T Consensus       141 iAgLT~eEAKe~Ll~~le  158 (514)
T TIGR03319       141 ISGLTQEEAKEILLEEVE  158 (514)
T ss_pred             HHCCCHHHHHHHHHHHHH
T ss_conf             858999999999999999


No 66 
>PRK09098 type III secretion system protein HrpB; Validated
Probab=96.02  E-value=0.098  Score=28.68  Aligned_cols=96  Identities=10%  Similarity=0.105  Sum_probs=52.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999-----------9999999999999999999999999999999
Q gi|254781085|r   55 ENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQ-----------NIEQISALYLKDLEQKIHYMKLEAKRLLYAK  123 (173)
Q Consensus        55 ~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~-----------~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~  123 (173)
                      ..+..+....|..++.++..|+.+|+.+++.+......           +.....-..-..--........++...++..
T Consensus        35 ~~~~~~~~~~L~~Ar~eA~~Il~~Ar~~A~~I~~~Ar~e~e~a~~~GY~eG~~ral~e~~~r~a~~~~~~~~~~~~m~~r  114 (229)
T PRK09098         35 AAVHAERDAVLAAARDRAERIAAEARAQAEALLEDARREADRSARLGYAAGLRQALAEWHARGADHAFAERRAARRMRER  114 (229)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999899999999999999999999999999999999999999988999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             999999999999994339999999999
Q gi|254781085|r  124 IADFSVEIVREIISQKMNDDVNSSIFE  150 (173)
Q Consensus       124 ~~~la~~~~~kil~~~l~~~~~~~~I~  150 (173)
                      ..++....+++++...-........+.
T Consensus       115 La~iV~~AVekIv~~e~~~aL~~ra~~  141 (229)
T PRK09098        115 LAEIVAAAVEQIVHGEDPAALFARAAQ  141 (229)
T ss_pred             HHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             999999999999971398889999999


No 67 
>PRK08404 V-type ATP synthase subunit H; Validated
Probab=95.87  E-value=0.11  Score=28.30  Aligned_cols=72  Identities=19%  Similarity=0.139  Sum_probs=46.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   56 NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF  127 (173)
Q Consensus        56 ~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~l  127 (173)
                      ......+.++..++.++..|+..|+.+|..+.+.+...|..+...++..++..-+.+-...+.+=...+..+
T Consensus        13 ~AEk~AeeRIE~Ak~eAK~Ii~kAkeEAk~iEeeii~kAeeea~~lIE~kk~EGE~EAkKi~eeGe~Eieel   84 (106)
T PRK08404         13 KAERLAEERIERAKEEAKKIIRKAKEEAKKIEEEIIKKAEEEAQKLIEKKKLEGEEEAKKILEEGEAEISEL   84 (106)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             988879999998888899999998999998799999999999999999988702788999999818689999


No 68 
>pfam01991 vATP-synt_E ATP synthase (E/31 kDa) subunit. This family includes the vacuolar ATP synthase E subunit, as well as the archaebacterial ATP synthase E subunit.
Probab=95.86  E-value=0.11  Score=28.28  Aligned_cols=97  Identities=14%  Similarity=0.033  Sum_probs=45.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999994
Q gi|254781085|r   59 MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQ  138 (173)
Q Consensus        59 ~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~  138 (173)
                      ++.+..+.+|+.++..++..+..++.........++..+++..............+...-.-+.++.+-..+-+.+-|..
T Consensus         8 ~ka~eI~~~A~~e~~~~k~~~~~~~~~~~~~~~~k~~k~~~~~~~~~~S~a~~~~R~~~L~ak~e~i~~v~~~a~~kL~~   87 (195)
T pfam01991         8 EKAEEIRAEAEEEFEIEKAEAVEEAEKKIEEIYEKKEKQAEMEKQIIISNAKNEARLKVLNAREELLDEVFEEAKEKLAN   87 (195)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999986


Q ss_pred             HC-CHHHHHHHHHHHHHH
Q ss_conf             33-999999999999999
Q gi|254781085|r  139 KM-NDDVNSSIFEKTISS  155 (173)
Q Consensus       139 ~l-~~~~~~~~I~~~i~~  155 (173)
                      -. |++.+..++...|.+
T Consensus        88 l~~d~~~Y~~~L~~Li~~  105 (195)
T pfam01991        88 LPEDKDEYKDLLKDLIVQ  105 (195)
T ss_pred             HCCCHHHHHHHHHHHHHH
T ss_conf             206777899999999999


No 69 
>PRK06669 fliH flagellar assembly protein H; Validated
Probab=95.70  E-value=0.13  Score=27.89  Aligned_cols=105  Identities=13%  Similarity=0.225  Sum_probs=77.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999-99999999999999999999999999---9999999999999999999
Q gi|254781085|r   55 ENILMQYKEKHSKVEEETREIILAAKHRAKI-LAEEGCQNIEQISALYLKDLEQKIHY---MKLEAKRLLYAKIADFSVE  130 (173)
Q Consensus        55 ~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~-~~e~~~~~a~~~~~~~~~~a~~~I~~---~~~~a~~~l~~~~~~la~~  130 (173)
                      .....+.+..+.+...+....+..|+.++.. -.+....++..+.+..+.++..-++.   .......+...+++++++.
T Consensus        87 s~~~~klq~~ie~~e~e~~~~le~a~~eG~eeG~e~G~~ea~~e~~~~i~~~~~ile~~~~~~~~~l~~~E~elv~lal~  166 (268)
T PRK06669         87 SSSRIKLEMQIEEAEEERKRLLEEAKAEGYEEGYEEGFEKAREEFQKLIDELKAILEEAIDEREEILESSEEEIVELALD  166 (268)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             35089999999999999999999999999999999999999999999999999999999999999999989999999999


Q ss_pred             HHHHHHHHHC--CHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999433--9999999999999999999
Q gi|254781085|r  131 IVREIISQKM--NDDVNSSIFEKTISSIQSC  159 (173)
Q Consensus       131 ~~~kil~~~l--~~~~~~~~I~~~i~~l~~~  159 (173)
                      ++.++++..+  ++..-..++...+.++...
T Consensus       167 IAkkVI~~~~~~~~~i~~~lvk~~l~evk~~  197 (268)
T PRK06669        167 IAKKVIKEISENSKEVALALVKELLKEVKDA  197 (268)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHCCC
T ss_conf             9999999997058999999999999973137


No 70 
>PRK06568 F0F1 ATP synthase subunit B; Validated
Probab=95.65  E-value=0.14  Score=27.77  Aligned_cols=100  Identities=17%  Similarity=0.120  Sum_probs=70.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999622889999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   16 FLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIE   95 (173)
Q Consensus        16 l~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~   95 (173)
                      =|++++ .++|.|+.+.+.+   .....+.+......+|+++..+.+..|.+.+.+    +.++..++...+..+...++
T Consensus        13 SF~IFv-~Liy~k~pk~I~~---~LD~kI~eIK~~ideAekLkeEAk~lL~e~ekK----i~~~~~e~~emI~~Ak~~aE   84 (154)
T PRK06568         13 SFVIFV-YLIYRPAKKAILN---SLDAKILEVQEKVLKAEKLKEDAALLFEQTNAQ----IKKLETLRSQMIEESNEVTK   84 (154)
T ss_pred             HHHHHH-HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHH
T ss_conf             999999-9999875899998---899999999999989998789999999999999----98789999999998689999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999
Q gi|254781085|r   96 QISALYLKDLEQKIHYMKLEAKRLLYAK  123 (173)
Q Consensus        96 ~~~~~~~~~a~~~I~~~~~~a~~~l~~~  123 (173)
                      ..+.......+.-++..+..+.+.+...
T Consensus        85 k~i~~~~kk~~~~~e~kkk~A~~kI~Q~  112 (154)
T PRK06568         85 KIIQEKTKEIEEFLEHKKSDAIQLIQNQ  112 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999998898699999999


No 71 
>pfam01991 vATP-synt_E ATP synthase (E/31 kDa) subunit. This family includes the vacuolar ATP synthase E subunit, as well as the archaebacterial ATP synthase E subunit.
Probab=95.45  E-value=0.16  Score=27.36  Aligned_cols=41  Identities=15%  Similarity=0.145  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999
Q gi|254781085|r   67 KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQ  107 (173)
Q Consensus        67 ~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~  107 (173)
                      .++.....+...+..++..........+...+...+-.++.
T Consensus        31 ~~~~~~~~~~~k~~k~~~~~~~~~~S~a~~~~R~~~L~ak~   71 (195)
T pfam01991        31 EAEKKIEEIYEKKEKQAEMEKQIIISNAKNEARLKVLNARE   71 (195)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999999999


No 72 
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion]
Probab=95.42  E-value=0.17  Score=27.29  Aligned_cols=90  Identities=18%  Similarity=0.039  Sum_probs=62.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   58 LMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIIS  137 (173)
Q Consensus        58 ~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~  137 (173)
                      ..+.+....+++.++..+..++...++...+.....++.+++....++......+-....-+.+.++.+-..+.+...|.
T Consensus        16 ~eeak~I~~eA~~eae~i~~ea~~~~~~~~~~~~~~~~~ea~~~~~~iis~A~le~r~~~Le~~ee~l~~~~~~~~e~L~   95 (194)
T COG1390          16 EEEAEEILEEAREEAEKIKEEAKREAEEAIEEILRKAEKEAERERQRIISSALLEARRKLLEAKEEILESVFEAVEEKLR   95 (194)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999989999999999999999999999999899999999999998999999999999999999999999997


Q ss_pred             HHCCHHHHHH
Q ss_conf             4339999999
Q gi|254781085|r  138 QKMNDDVNSS  147 (173)
Q Consensus       138 ~~l~~~~~~~  147 (173)
                      .-.++.....
T Consensus        96 ~i~~~~~~~~  105 (194)
T COG1390          96 NIASDPEYES  105 (194)
T ss_pred             CCCCCCCHHH
T ss_conf             2767731678


No 73 
>KOG3976 consensus
Probab=95.38  E-value=0.17  Score=27.21  Aligned_cols=77  Identities=14%  Similarity=0.173  Sum_probs=58.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999962288999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    8 LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKI   85 (173)
Q Consensus         8 w~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~   85 (173)
                      .+.++|++|+++..+++-| .+....|.+.++|.+.++++.+..-++-..--+.++....+.....-+....++.+.-
T Consensus        99 ~~~~s~lgl~~~~~k~~g~-ai~~~adk~~~k~~~~~~~arq~~ik~i~d~id~~~sqq~~~~~~~~lfd~~keni~l  175 (247)
T KOG3976          99 ISTLSFLGLTGLAIKKLGP-AIADWADKLIEKILSQLEEARQAHIKAISDAIDTEKSQQALASKTEYLFDVSKENIAL  175 (247)
T ss_pred             CHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             0033699999999998559-9998867779999999999888679999987645666577888877645656667988


No 74 
>COG2811 NtpF Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion]
Probab=95.30  E-value=0.18  Score=27.07  Aligned_cols=86  Identities=17%  Similarity=0.126  Sum_probs=52.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999-9999999999
Q gi|254781085|r   51 REKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL-LYAKIADFSV  129 (173)
Q Consensus        51 ~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~-l~~~~~~la~  129 (173)
                      -...++...+..+.+.+|+.++..|+.++..++....++....++.+++........+-.+........ -...+...++
T Consensus        20 d~~IeeAkEe~~~~i~eAr~eareiieeaE~eA~~~~~e~l~~~~ee~e~ea~eI~~~ae~~~~~~~~ka~~~k~~~~a~   99 (108)
T COG2811          20 DEEIEEAKEEAEQIIKEAREEAREIIEEAEEEAEKLAQEILEEAREEAEEEAEEILAEAEKEASAILSKAAEGKVVEAAL   99 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999889989999998899999999999999999999988988899999999888977999988867657899999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254781085|r  130 EIVREII  136 (173)
Q Consensus       130 ~~~~kil  136 (173)
                      ..+.++|
T Consensus       100 ~~~~~~l  106 (108)
T COG2811         100 SEFLAIL  106 (108)
T ss_pred             HHHHHHH
T ss_conf             9999875


No 75 
>COG1390 NtpE Archaeal/vacuolar-type H+-ATPase subunit E [Energy production and conversion]
Probab=94.94  E-value=0.24  Score=26.44  Aligned_cols=78  Identities=21%  Similarity=0.198  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999999994
Q gi|254781085|r   61 YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQ  138 (173)
Q Consensus        61 ~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~  138 (173)
                      .+....+++.++.+|..+|..+++.+.+++...+....+.....++.+....+..++.....++........++++..
T Consensus         8 i~~I~~~a~eeak~I~~eA~~eae~i~~ea~~~~~~~~~~~~~~~~~ea~~~~~~iis~A~le~r~~~Le~~ee~l~~   85 (194)
T COG1390           8 IKKILREAEEEAEEILEEAREEAEKIKEEAKREAEEAIEEILRKAEKEAERERQRIISSALLEARRKLLEAKEEILES   85 (194)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999998999999999999999999999999989999999999999899999999999999999


No 76 
>PRK00106 hypothetical protein; Provisional
Probab=94.21  E-value=0.35  Score=25.43  Aligned_cols=76  Identities=24%  Similarity=0.142  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999962288999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   19 IVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQI   97 (173)
Q Consensus        19 il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~   97 (173)
                      ++.|++++..+.+.=..-...+.+.-.+|...+.+|+.   +.+..+.+++.++..+..++.-+|+........+++.+
T Consensus        16 ~iG~~~~~~~~~~~k~~~~~~~~~a~~~A~~~~~~Ae~---eA~~i~~~A~~eae~~kke~~leAKee~~~~r~e~e~e   91 (535)
T PRK00106         16 VLGYALISIKLKSAKEAAELTLLNAEQEAVNLRGKAEV---DAEHIKKTAKRESKALRKELLLEAKEEARKYREEIEQE   91 (535)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98999999999888876898999999999999999999---99999999999999999999999999999999999999


No 77 
>KOG2302 consensus
Probab=94.20  E-value=0.36  Score=25.41  Aligned_cols=65  Identities=17%  Similarity=0.299  Sum_probs=36.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989999999999999999996228899999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE   69 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~   69 (173)
                      ||.|+  |+++-|++|++|+.+|++--.+..+.++-..--+  -+++++++.--++.+...+++..+|+
T Consensus      1355 ~nhnp--wmllYfIsfllIvsffVlnmfVgvvvenfhKcrq--hqe~EeArRreEKrLrrlekkrR~Aq 1419 (1956)
T KOG2302        1355 LNHNP--WMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQ--HQEAEEARRREEKRLRRLEKKRRAAQ 1419 (1956)
T ss_pred             CCCCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             25881--7899999999999999999999999999999988--77889998889999999999887504


No 78 
>pfam06103 DUF948 Bacterial protein of unknown function (DUF948). This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=92.81  E-value=0.62  Score=24.03  Aligned_cols=67  Identities=9%  Similarity=0.244  Sum_probs=45.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999996228899999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREI   75 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i   75 (173)
                      +...+.|+++++++++. +. .+.+.|++=...+..-=.+......++++++.+....+.+.+.+...+
T Consensus         4 ~i~AiAf~vLvi~l~~~-L~-~~~~tl~~~~~Ti~~l~~~vd~i~~et~~lL~ktN~L~~DVn~K~~~l   70 (90)
T pfam06103         4 LIIAIAFLVLVIFLIKT-LK-SLSKTLDEVNKTLAGLTKQVDGITTETEDLLAKTNVLLEDVNGKVETL   70 (90)
T ss_pred             HHHHHHHHHHHHHHHHH-HH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999-99-999999999999999998789899999999998888999999899974


No 79 
>pfam04612 GspM General secretion pathway, M protein. This is a family of membrane proteins involved in the secretion of a number of molecules in Gram-negative bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the EpsM protein interacts with the EpsL protein, and also forms homodimers.
Probab=92.55  E-value=0.67  Score=23.82  Aligned_cols=50  Identities=14%  Similarity=0.143  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999962288999999999999999999999999999999
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL   58 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~   58 (173)
                      +.+..++++++++|+++|.|+....+.-+................+....
T Consensus        19 l~~~~~~l~~~l~y~~lw~Pl~~~~~~~~~~~~~~~~~l~~~~~~~~~~~   68 (159)
T pfam04612        19 LAVLGAVLLLVLLYLGLWQPLSQRRARAQRRLQAARQLLAWLQEQAPEIR   68 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999988999999999999999999999999999999


No 80 
>pfam06635 NolV Nodulation protein NolV. This family consists of several nodulation protein NolV sequences from different Rhizobium species. The function of this family is unclear.
Probab=92.54  E-value=0.67  Score=23.82  Aligned_cols=101  Identities=11%  Similarity=0.057  Sum_probs=69.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999943
Q gi|254781085|r   60 QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQK  139 (173)
Q Consensus        60 ~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~  139 (173)
                      +..+-+..++.++..+..++..-.++.+...-.+..++.......--.+-..+-......+-++...+++++++++|+.=
T Consensus        31 da~~~ieAA~~~A~~vr~~A~~ayE~~r~~Gye~G~~~g~~E~A~li~qt~ae~~~y~a~lE~~l~~lVle~vRkiLg~f  110 (207)
T pfam06635        31 DAAKACAAAERHLQHVRGWARAAYERELAQGHAEGAKAGAEEMAALIAQATAELAQRKAVLEQELPQLVFEILRDLLGAF  110 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             69999999999999999999999999999889999999999999999999999999999999999999999999998604


Q ss_pred             CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             399999999999999999999
Q gi|254781085|r  140 MNDDVNSSIFEKTISSIQSCH  160 (173)
Q Consensus       140 l~~~~~~~~I~~~i~~l~~~~  160 (173)
                      -+.+..-..+-.+|+.+.+.+
T Consensus       111 D~~Ell~r~vR~AL~~~~~~k  131 (207)
T pfam06635       111 DPGELLVMAVRHAIEQQYKGA  131 (207)
T ss_pred             CHHHHHHHHHHHHHHHHHCCC
T ss_conf             948899999999999873387


No 81 
>PRK11677 cytochrome d ubiquinol oxidase subunit III; Provisional
Probab=91.48  E-value=0.89  Score=23.09  Aligned_cols=84  Identities=7%  Similarity=0.030  Sum_probs=49.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKIL   86 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~   86 (173)
                      .|..+...+++++++-+++.+..... -.++...+.+|+       +++..+.+|+..+.+==.+...++..........
T Consensus         2 ~W~~ali~lvvGiiIG~~~~R~~~~~-~~~q~~Le~eLe-------~~k~el~~Yr~ev~~HF~~tA~Ll~~l~~~Y~~l   73 (134)
T PRK11677          2 TWEYALIGLVVGIIIGAVAMRFGNRK-LRQQQALQYELE-------KNKAELEEYRQELVDHFARSAELLDTMAKDYRQL   73 (134)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             28999999999999999999981751-167999999999-------9999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999999
Q gi|254781085|r   87 AEEGCQNIEQIS   98 (173)
Q Consensus        87 ~e~~~~~a~~~~   98 (173)
                      .+..-..+..-.
T Consensus        74 yqHlA~~a~~Ll   85 (134)
T PRK11677         74 YQHMAKSSSELL   85 (134)
T ss_pred             HHHHHHHHHHHC
T ss_conf             999998899876


No 82 
>COG1317 FliH Flagellar biosynthesis/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=91.37  E-value=0.92  Score=23.02  Aligned_cols=61  Identities=10%  Similarity=0.262  Sum_probs=42.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH--HHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999943399--999999999999999999
Q gi|254781085|r   96 QISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMND--DVNSSIFEKTISSIQSCH  160 (173)
Q Consensus        96 ~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~--~~~~~~I~~~i~~l~~~~  160 (173)
                      .....++..+...++    .....+..+..++++.+++++++..+..  +.-..+|..+|..+....
T Consensus        95 e~~~~li~~~~~~~~----~~~~~~e~qLv~lvl~ia~~Vi~~~~~~~~~~ll~~v~e~L~~~~~~~  157 (234)
T COG1317          95 ERLAKLIAEFQAELE----ALKEVVEKQLVQLVLEIARKVIGKELELDPEALLAAVREALEEVPLFA  157 (234)
T ss_pred             HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999----999999999999999999999856531288999999999999711666


No 83 
>COG4046 Uncharacterized protein conserved in archaea [Function unknown]
Probab=91.15  E-value=0.77  Score=23.47  Aligned_cols=99  Identities=13%  Similarity=0.180  Sum_probs=53.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH----
Q ss_conf             899999999999999999962288-9999999999999999999999999999999999999-9999999999999----
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYLRIPSI-LLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH-SKVEEETREIILA----   78 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~~~~~~-i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l-~~a~~ea~~i~~~----   78 (173)
                      ..||.+...+++++++++.++|+. ..--..--...|.+.+...+....+|.+...++...- .+++.-.+++.+-    
T Consensus         9 ~p~~il~~~~i~~vllfil~~~g~n~~~qv~lf~r~Ieg~l~~le~~~~~a~~~~~~~~~~~~~e~es~l~r~~effVI~   88 (368)
T COG4046           9 SPFWILDILGIAFVLLFILLLPGMNARVQVSLFSRYIEGALAELEKMENDAMKKVVELAVPRRDEAESTLERYAEFFVIP   88 (368)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHEECC
T ss_conf             70899999999999999999647661674134787788899999998889999999985122222577999987634228


Q ss_pred             --------HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             --------9999999999999999999999999
Q gi|254781085|r   79 --------AKHRAKILAEEGCQNIEQISALYLK  103 (173)
Q Consensus        79 --------a~~~a~~~~e~~~~~a~~~~~~~~~  103 (173)
                              --...+...+......+..+.+...
T Consensus        89 Pv~idP~gIi~R~~~Ll~~~~dr~~~~v~r~~p  121 (368)
T COG4046          89 PVDIDPAGIIDRLRHLLEMGEDRFRKLVRRLVP  121 (368)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             346782226999999998605889999997287


No 84 
>COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase [Nucleotide transport and metabolism]
Probab=90.64  E-value=1.1  Score=22.61  Aligned_cols=42  Identities=19%  Similarity=0.359  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999999-9999622889999999999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVI-VVYLRIPSILLSFLDAHADKIRDDIFEA   47 (173)
Q Consensus         5 ~tfw~~i~f~il~~i-l~~~~~~~~i~~~l~~R~~~I~~~l~~A   47 (173)
                      ++|+.++.|++++.+ +.++++ +.+.+-++.+...+...+..+
T Consensus         3 ~vil~~iv~il~lvl~~l~~~I-r~lq~~~e~k~~~l~e~l~~~   45 (175)
T COG4741           3 IVILILIVFILALVLYLLRAYI-RSLQGKVESKARELEETLQKA   45 (175)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             6289999999999999999999-999999998899999999999


No 85 
>PRK09731 putative general secretion pathway protein YghD; Provisional
Probab=90.30  E-value=1.2  Score=22.44  Aligned_cols=51  Identities=12%  Similarity=0.259  Sum_probs=36.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999622889999999999999999999999999999999
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM   59 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~   59 (173)
                      +..|-+++++.++|..+|.|+..-.+.-+..|+.+...-.-.+++|.++.+
T Consensus        40 v~~~gavLll~i~YwgiWqP~~~R~e~aq~~iq~e~qlL~wvk~~A~~I~a   90 (178)
T PRK09731         40 LLAAVVFLFSVGYYVLIWQPLSERIEQQETMLQQLVAMNTRLKSAAPDIIA   90 (178)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             998799999999999988369899999999999999999999988789999


No 86 
>pfam03179 V-ATPase_G Vacuolar (H+)-ATPase G subunit. This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialized cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation.
Probab=90.08  E-value=1.2  Score=22.33  Aligned_cols=44  Identities=20%  Similarity=0.201  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999
Q gi|254781085|r   65 HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQK  108 (173)
Q Consensus        65 l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~  108 (173)
                      |-.|..+|..|+.+|+..-.....++..+|..+++....+-+.+
T Consensus         9 LL~AEk~A~~iV~~AR~~k~~rLKqAK~EA~~EI~~yR~~kE~e   52 (105)
T pfam03179         9 LLQAEKEAAEIVNEARKRRAKRLKQAKEEAEKEIEEYRAQREAE   52 (105)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999878889999999999999999999


No 87 
>pfam06188 HrpE HrpE protein. This family consists of several bacterial HrpE proteins. The exact function of this family is unknown but it is thought that HrpE is involved in the secretion of HrpZ (harpinPss).
Probab=89.46  E-value=1.4  Score=22.04  Aligned_cols=97  Identities=8%  Similarity=0.105  Sum_probs=67.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999994
Q gi|254781085|r   59 MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQ  138 (173)
Q Consensus        59 ~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~  138 (173)
                      ......+.+|+..|..|+..+.++++...+.....++...=..-..--.....++......+-..+..+...+..++|.+
T Consensus        30 ~~A~~il~~Ar~QA~~il~~a~~~ae~~~~~~~eqA~a~FWqqA~a~L~~w~~qRe~~~~~l~~~~~~ll~qAL~~LLde  109 (191)
T pfam06188        30 LLARTLLEDARQQAEQILDLAEEKAEALQQRAEEQAEAAFWQQANALLQEWQQQREQLEQQALSAADQLLNQALQQLLDE  109 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             98999999999999999999999999999989999999999999999999999999999999999999999999998646


Q ss_pred             HCCHHHHHHHHHHHHHH
Q ss_conf             33999999999999999
Q gi|254781085|r  139 KMNDDVNSSIFEKTISS  155 (173)
Q Consensus       139 ~l~~~~~~~~I~~~i~~  155 (173)
                      -.+......++-..+..
T Consensus       110 ~~~~qR~~ALlRqLl~~  126 (191)
T pfam06188       110 TPLPQRLQALLRQLLAS  126 (191)
T ss_pred             CCHHHHHHHHHHHHHHH
T ss_conf             98489999999999983


No 88 
>PRK09039 hypothetical protein; Validated
Probab=88.65  E-value=1.6  Score=21.70  Aligned_cols=20  Identities=10%  Similarity=0.388  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIP   26 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~   26 (173)
                      +.+++.|+++++++..+++-
T Consensus        26 LLmViIFvL~IFvv~Q~~Ls   45 (343)
T PRK09039         26 LLLVIMFLLTVFVVAQFFLS   45 (343)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999


No 89 
>TIGR01147 V_ATP_synt_G V-type ATPase, G subunit; InterPro: IPR005124 This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialised cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation..
Probab=87.45  E-value=1.8  Score=21.26  Aligned_cols=57  Identities=11%  Similarity=0.119  Sum_probs=35.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   63 EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL  119 (173)
Q Consensus        63 ~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~  119 (173)
                      ..|..|..+|.+++.+|+..=.....++..+|..+++....+=+.+...-.......
T Consensus        10 q~LL~AEKrAaekVseARkrk~~RlKqAK~EA~~EvE~Yk~QrE~EFK~FEa~~~G~   66 (114)
T TIGR01147        10 QQLLQAEKRAAEKVSEARKRKQKRLKQAKEEAQKEVEKYKQQREKEFKEFEAKHLGG   66 (114)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             989999999989889999988788788899999989998887889988999986388


No 90 
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=86.93  E-value=1.4  Score=21.95  Aligned_cols=35  Identities=11%  Similarity=0.369  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999996228899999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRD   42 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~   42 (173)
                      +-.++-|++ ++.+.||.+++|=.+-..+|++.+.+
T Consensus         9 ~~~ll~~vl-~~~ifyFli~RPQrKr~K~~~~ml~s   43 (97)
T COG1862           9 LVLLLPLVL-IFAIFYFLIIRPQRKRMKEHQELLNS   43 (97)
T ss_pred             HHHHHHHHH-HHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             779999999-99999986167889999999999974


No 91 
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=85.07  E-value=2.1  Score=20.95  Aligned_cols=35  Identities=11%  Similarity=0.107  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIR   41 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~   41 (173)
                      .|..+.++++++.+.||++++|=.+-..++++.+.
T Consensus        18 ~~~~ll~~ili~~vfYfl~iRPQ~Kr~ke~~~m~~   52 (107)
T PRK05585         18 GLTSLLPLVVFFAIFYFLIIRPQQKRQKEHKKMLS   52 (107)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             67999999999999998742648899999999998


No 92 
>TIGR02070 mono_pep_trsgly monofunctional biosynthetic peptidoglycan transglycosylase; InterPro: IPR011812    This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain, which describes transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are proteobacteria that produce murein (peptidoglycan).; GO: 0016763 transferase activity transferring pentosyl groups, 0009252 peptidoglycan biosynthetic process, 0009274 peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=84.53  E-value=0.82  Score=23.32  Aligned_cols=31  Identities=13%  Similarity=0.467  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHA   37 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~   37 (173)
                      +.+++++.+|+.+++|.++|+|.+.+|..|+
T Consensus        10 ~vl~~~l~~~~~~~~wR~~pp~~s~~M~~~~   40 (228)
T TIGR02070        10 VVLLLNLAVFALVALWRFVPPPVSAFMVERK   40 (228)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             9999999999998887413889886579999


No 93 
>MTH00169 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=83.18  E-value=3  Score=20.06  Aligned_cols=36  Identities=14%  Similarity=0.227  Sum_probs=27.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDD   43 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~   43 (173)
                      .|..++.+++|.+++...+|+ +..-|--|.....+.
T Consensus        14 ~w~li~l~~lf~llv~~ILP~-iq~ql~~R~~~~~g~   49 (71)
T MTH00169         14 IWTLIALFFLFSLLVNTILPW-LQQQLVIRSKIVSGL   49 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHH
T ss_conf             999999999999999998189-999999999998764


No 94 
>pfam02699 YajC Preprotein translocase subunit. See.
Probab=81.15  E-value=3.5  Score=19.68  Aligned_cols=30  Identities=7%  Similarity=0.212  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999962288999999999999
Q gi|254781085|r   11 MSLIIFLVIVVYLRIPSILLSFLDAHADKI   40 (173)
Q Consensus        11 i~f~il~~il~~~~~~~~i~~~l~~R~~~I   40 (173)
                      +.++++++.+.||+..+|=.+-..++++.+
T Consensus         6 ll~~v~i~~i~yf~~iRpq~Kr~k~~~~m~   35 (83)
T pfam02699         6 LLPLVLIFAIFYFLLIRPQQKRQKEHKEML   35 (83)
T ss_pred             HHHHHHHHHHHHHHEECHHHHHHHHHHHHH
T ss_conf             999999999998741506889999999999


No 95 
>TIGR00739 yajC preprotein translocase, YajC subunit; InterPro: IPR003849   This entry describes proteins of unknown function..
Probab=80.27  E-value=2.1  Score=20.99  Aligned_cols=32  Identities=19%  Similarity=0.340  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999622889999999999999
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIR   41 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~   41 (173)
                      .++-|++++ ++.||++++|=.+--.++++.++
T Consensus         5 ~l~~lv~~~-~~FYFl~~RPQ~K~~k~~~kl~~   36 (86)
T TIGR00739         5 TLLPLVLIF-LIFYFLIIRPQRKRRKAHKKLIE   36 (86)
T ss_pred             HHHHHHHHH-HHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             589999999-99999704977988898888885


No 96 
>PRK04654 sec-independent translocase; Provisional
Probab=79.94  E-value=3.9  Score=19.37  Aligned_cols=15  Identities=13%  Similarity=0.111  Sum_probs=10.1

Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             979899999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIF   16 (173)
Q Consensus         2 ~~d~tfw~~i~f~il   16 (173)
                      +||.-||=++.+.++
T Consensus         1 MFDIGF~ELlLI~VI   15 (214)
T PRK04654          1 MFDIGVGELTLIAVV   15 (214)
T ss_pred             CCCCCHHHHHHHHHH
T ss_conf             965119999999999


No 97 
>pfam02108 FliH Flagellar assembly protein FliH.
Probab=78.40  E-value=4.4  Score=19.09  Aligned_cols=55  Identities=15%  Similarity=0.370  Sum_probs=40.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999433--9999999999999999
Q gi|254781085|r  102 LKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM--NDDVNSSIFEKTISSI  156 (173)
Q Consensus       102 ~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l--~~~~~~~~I~~~i~~l  156 (173)
                      ....-..+........+++..++.++++.+++++++..+  +++.-..+|..++..+
T Consensus         7 l~~l~~~l~~~~~~~~~~~e~~l~~La~~ia~kvi~~el~~~p~~i~~~v~~al~~l   63 (128)
T pfam02108         7 LAALLEELENPLAELDQELEQQLVDLALDIARQVIRRELTVDPELILALVREALAAL   63 (128)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             999999999899999999999999999999999999997349899999999999971


No 98 
>KOG1772 consensus
Probab=77.21  E-value=4.8  Score=18.88  Aligned_cols=37  Identities=19%  Similarity=0.014  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999
Q gi|254781085|r   64 KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISAL  100 (173)
Q Consensus        64 ~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~  100 (173)
                      ++.+|+.....-+.+|+.+|+.++++....-+.+...
T Consensus        21 ~V~~ARk~K~~RLKQAKeEA~~Eie~yr~qrE~efk~   57 (108)
T KOG1772          21 KVEEARKRKLRRLKQAKEEAEKEIEEYRSQREKEFKE   57 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999989888887889999999999987899999


No 99 
>pfam05103 DivIVA DivIVA protein. The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate mini-cells. Inactivation of divIVA produces a mini-cell phenotype, whereas overproduction of DivIVA results in a filamentation phenotype. These proteins appear to contain coiled-coils.
Probab=74.88  E-value=5.5  Score=18.51  Aligned_cols=71  Identities=13%  Similarity=0.194  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   41 RDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE  115 (173)
Q Consensus        41 ~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~  115 (173)
                      ...+...+....+..........-|..++.-+..++..|+.+|+.+    +.+|+..++.++..|+.+......+
T Consensus        45 ~~~~~~l~~~l~~~~~~e~~l~~~L~~Aq~~a~~~~~~A~~eA~~i----i~eA~~~A~~iv~eA~~~~~~l~~e  115 (131)
T pfam05103        45 KEEIERLEEKLEEYKELEETLQKTLVVAQETAEEVKANAQKEAELI----IKEAEAKAERIVNDANEEAKKLATE  115 (131)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999888899999999999999999999999999999----9999999999999999999999999


No 100
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=74.72  E-value=5.6  Score=18.49  Aligned_cols=19  Identities=26%  Similarity=0.300  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999622
Q gi|254781085|r    8 LVFMSLIIFLVIVVYLRIP   26 (173)
Q Consensus         8 w~~i~f~il~~il~~~~~~   26 (173)
                      |+.+.+++++++|-|.+.+
T Consensus         3 ~l~~~L~~ll~~LQY~lwf   21 (105)
T PRK00888          3 LLTLVLLALLVWLQYPLWF   21 (105)
T ss_pred             HHHHHHHHHHHHHHHHHHC
T ss_conf             6999999999999999940


No 101
>PRK04098 sec-independent translocase; Provisional
Probab=74.62  E-value=5.6  Score=18.47  Aligned_cols=45  Identities=13%  Similarity=0.297  Sum_probs=19.5

Q ss_pred             CCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             979899999999999999-9999622889999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVI-VVYLRIPSILLSFLDAHADKIRDDIFEA   47 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~i-l~~~~~~~~i~~~l~~R~~~I~~~l~~A   47 (173)
                      +||.-||=++.++++-++ |.=-.+|. +...+-.-..+++..++++
T Consensus         1 MF~iGf~EllvI~vvaLiVlGPekLP~-~~r~~g~~~~~~rr~~~~~   46 (153)
T PRK04098          1 MFGMGFFEIIVILVVAIIFLGPDKLPQ-AMVDIAKFFKAVKKTINDA   46 (153)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCHHHHHH-HHHHHHHHHHHHHHHHHHH
T ss_conf             987558999999999997348066589-9999999999999999999


No 102
>COG4512 AgrB Membrane protein putatively involved in post-translational modification of the autoinducing quorum-sensing peptide [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Transcription]
Probab=73.87  E-value=3.7  Score=19.50  Aligned_cols=25  Identities=12%  Similarity=0.368  Sum_probs=21.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999999999999622
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIP   26 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~   26 (173)
                      |+|..+|.++..+++..++++++.|
T Consensus       101 ni~~Nn~~vLa~~iiglL~i~~yAP  125 (198)
T COG4512         101 NIDANNYAVLAYFIIGLLLIFKYAP  125 (198)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             1362039999999999989873375


No 103
>PRK10361 DNA recombination protein RmuC; Provisional
Probab=73.15  E-value=6.1  Score=18.26  Aligned_cols=51  Identities=14%  Similarity=0.130  Sum_probs=21.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9899999999999999999962288---99999999999999999999999999
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLRIPSI---LLSFLDAHADKIRDDIFEARRLREKS   54 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~~~~~---i~~~l~~R~~~I~~~l~~A~~~~~~a   54 (173)
                      |.|..+.+.++++.+++.|++.+..   ...-+..-+......+..++......
T Consensus         2 ~~~~~i~~i~al~G~~igwl~~~~~~~~~~a~l~~~~~e~~~el~~~~~~l~~~   55 (475)
T PRK10361          2 DFSIMVYAVIALVGVAIGWLFASYQHAQQKAEQLAEREEMVAELSAAKQQITQS   55 (475)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             277999999999999999999998734514468999999999999999999888


No 104
>COG4768 Uncharacterized protein containing a divergent version of the methyl-accepting chemotaxis-like domain [General function prediction only]
Probab=72.25  E-value=6.4  Score=18.14  Aligned_cols=104  Identities=8%  Similarity=0.130  Sum_probs=61.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999996228899999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    8 LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILA   87 (173)
Q Consensus         8 w~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~   87 (173)
                      .+.+.|++|+++|+.- + +.+...|++=...++.--.+......+.+.++...+....+.+.+...+=.-.-  +-...
T Consensus        10 iiAiAf~vL~I~li~t-l-kkv~~tldevakt~~~l~~qv~gi~~eT~~Ll~K~N~L~eDvq~Kv~tld~vf~--aV~dl   85 (139)
T COG4768          10 IIAIAFLVLVIYLIIT-L-KKVSKTLDEVAKTLKGLTSQVDGITHETEELLHKTNTLAEDVQGKVATLDPVFD--AVKDL   85 (139)
T ss_pred             HHHHHHHHHHHHHHHH-H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHH
T ss_conf             9999999999999999-9-987789999999999999987777887899999998999998622876748999--99878


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999
Q gi|254781085|r   88 EEGCQNIEQISALYLKDLEQKIHYMKLE  115 (173)
Q Consensus        88 e~~~~~a~~~~~~~~~~a~~~I~~~~~~  115 (173)
                      -....+....+...-..+.....+....
T Consensus        86 ~~SV~~ln~s~r~~~~~~t~~~~~~~~~  113 (139)
T COG4768          86 GQSVSDLNQSVRHLATRATNAVEKNEKK  113 (139)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7889999999999999985676552789


No 105
>PRK01770 sec-independent translocase; Provisional
Probab=69.96  E-value=7.2  Score=17.83  Aligned_cols=42  Identities=21%  Similarity=0.269  Sum_probs=18.5

Q ss_pred             CCCHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999-999999999622889999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLI-IFLVIVVYLRIPSILLSFLDAHADKIRDDI   44 (173)
Q Consensus         2 ~~d~tfw~~i~f~-il~~il~~~~~~~~i~~~l~~R~~~I~~~l   44 (173)
                      +||.-||=++.++ +-+++|.=.-+|. +.+.+-.-..+++.-.
T Consensus         1 MFdiG~~ElllI~vvaLvVlGPerLP~-a~Rtvg~~v~~~R~~a   43 (171)
T PRK01770          1 MFDIGFSELLLVFVIGLVVLGPQRLPV-AVKTVAGWIRALRSLA   43 (171)
T ss_pred             CCCCCHHHHHHHHHHHHHEECHHHHHH-HHHHHHHHHHHHHHHH
T ss_conf             977568999999999984058888799-9999999999999999


No 106
>TIGR03142 cytochro_ccmI cytochrome c-type biogenesis protein CcmI. This TPR repeat-containing protein is the CcmI protein (also called CycH) of c-type cytochrome biogenesis. CcmI is thought to act as an apo-cytochrome c chaperone. This model describes the N-terminal region of the protein, Members of this protein family
Probab=68.89  E-value=7.6  Score=17.70  Aligned_cols=53  Identities=17%  Similarity=0.338  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999999999999999999999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE   74 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~   74 (173)
                      ||+++..+.++..+  ++++ |+.+.   +..  ....+       ..+...+=|+.++.+.+.+..+
T Consensus         2 FWi~~~~l~~~a~~--~i~~-Pl~r~---~~~--~~~~~-------r~~~n~~iyrdqL~ELe~d~~~   54 (117)
T TIGR03142         2 FWIVAALLTLVALL--FLLL-PLLRR---KRA--AATVD-------RDELNLAVYRDRLAELERDLAE   54 (117)
T ss_pred             HHHHHHHHHHHHHH--HHHH-HHHCC---CCC--CCCCC-------HHHHHHHHHHHHHHHHHHHHHC
T ss_conf             58999999999999--9999-99557---445--67515-------5888899999999999999986


No 107
>KOG1962 consensus
Probab=68.83  E-value=7.6  Score=17.69  Aligned_cols=11  Identities=27%  Similarity=0.703  Sum_probs=3.9

Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999999
Q gi|254781085|r   13 LIIFLVIVVYL   23 (173)
Q Consensus        13 f~il~~il~~~   23 (173)
                      |.+|+++++..
T Consensus       105 f~LFL~lvI~R  115 (216)
T KOG1962         105 FVLFLSLVIRR  115 (216)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 108
>pfam11119 DUF2633 Protein of unknown function (DUF2633). This family is conserved largely in the Bacillaceae family. Several members are named as YfgG. The function is not known.
Probab=67.62  E-value=5.7  Score=18.43  Aligned_cols=21  Identities=33%  Similarity=0.526  Sum_probs=13.8

Q ss_pred             CHHHHH-HHHHHHHHHHHHHHH
Q ss_conf             989999-999999999999996
Q gi|254781085|r    4 DETFLV-FMSLIIFLVIVVYLR   24 (173)
Q Consensus         4 d~tfw~-~i~f~il~~il~~~~   24 (173)
                      -.|-|+ +|+|+|||+=|+|-.
T Consensus         8 ~mt~iVLLISFiilFgRl~Y~a   29 (59)
T pfam11119         8 RMTKIVLLISFIIFFGRLIYSA   29 (59)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHH
T ss_conf             1256899999999999999987


No 109
>PRK06771 hypothetical protein; Provisional
Probab=67.22  E-value=8  Score=17.57  Aligned_cols=40  Identities=18%  Similarity=0.292  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999962288999999999999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFE   46 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~   46 (173)
                      .||.+|.+++|.++.+--.+. .+.+--+.|-..|...++.
T Consensus         2 E~wiiipi~~Fg~iYi~ekL~-~~ekkTd~rLK~iE~rlq~   41 (93)
T PRK06771          2 EFWMIIPIAIFGFIYIVEKLN-KIEKKTDARLKRMEDRLQL   41 (93)
T ss_pred             CEEEEEHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
T ss_conf             335340999989999999999-9988788899989999999


No 110
>pfam07219 HemY_N HemY protein N-terminus. This family represents the N-terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins. This is a membrane protein involved in a late step of protoheme IX synthesis.
Probab=66.95  E-value=8.3  Score=17.47  Aligned_cols=22  Identities=14%  Similarity=0.397  Sum_probs=13.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~   23 (173)
                      +++.++|+.+..++++++++|+
T Consensus        37 ~ie~Sl~~~~~~l~~~~~~l~~   58 (134)
T pfam07219        37 RIETSLTFAAILLLAVLAVLFL   58 (134)
T ss_pred             EEEECHHHHHHHHHHHHHHHHH
T ss_conf             8894199999999999999999


No 111
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=66.16  E-value=6.4  Score=18.13  Aligned_cols=31  Identities=13%  Similarity=0.043  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999962288999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHA   37 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~   37 (173)
                      .+|.++.|++||+.++|+ +++|=.+.--++.
T Consensus        11 ~a~~t~~~~l~fiavi~~-ayr~~~K~~~d~a   41 (60)
T COG4736          11 DAWGTIAFTLFFIAVIYF-AYRPGKKGEFDEA   41 (60)
T ss_pred             HHHHHHHHHHHHHHHHHH-HHCCCCHHHHHHH
T ss_conf             999999999999999999-9661210467888


No 112
>TIGR02002 PTS-II-BC-glcB PTS system, glucose-specific IIBC component; InterPro: IPR011299   This entry represents the combined B and C domains of the PTS transport system enzyme II specific for glucose transport . Many of the genes in this family also include an A domain as part of the same polypeptide and thus should be given the name 'PTS system, glucose-specific IIABC component' while the Bacillus subtilus enzyme also contains an enzyme III domain which appears to act independently of the enzyme II domains . This group is most closely related to the N-acetylglucosamine-specific PTS enzymes (IPR010974 from INTERPRO).; GO: 0005355 glucose transmembrane transporter activity, 0015758 glucose transport, 0016021 integral to membrane.
Probab=65.25  E-value=5.1  Score=18.72  Aligned_cols=27  Identities=15%  Similarity=0.314  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLD   34 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~   34 (173)
                      .|++|...++|.+++|+ ++|.+.+-||
T Consensus       394 ~W~~IIvG~~~A~iYYf-lFRflIkKln  420 (518)
T TIGR02002       394 AWLVIIVGLVYAIIYYF-LFRFLIKKLN  420 (518)
T ss_pred             CEEHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             12020378999999998-9999998761


No 113
>PRK05183 hscA chaperone protein HscA; Provisional
Probab=65.11  E-value=9.1  Score=17.25  Aligned_cols=76  Identities=9%  Similarity=-0.026  Sum_probs=34.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   38 DKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK  117 (173)
Q Consensus        38 ~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~  117 (173)
                      +.|..-+.+|+...++     ....+.+.+++.++..++..............-.+-+..++..+...+..+...-..++
T Consensus       512 ~ei~~m~~~a~~~~~~-----D~~~r~~~e~~~~a~~~~~~~~~~l~~~~~~l~~~~~~~i~~~~~~l~~~~~~~d~~~i  586 (621)
T PRK05183        512 DEIARMLKDSMSNAEE-----DMKARALAEQQVEAERVLEALQAALAADGDLLSADERAAIDAAMAALRALAQGDDADAI  586 (621)
T ss_pred             HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             9999999999987998-----89869989989889999999999999554409999999999999999998726999999


Q ss_pred             H
Q ss_conf             9
Q gi|254781085|r  118 R  118 (173)
Q Consensus       118 ~  118 (173)
                      +
T Consensus       587 ~  587 (621)
T PRK05183        587 E  587 (621)
T ss_pred             H
T ss_conf             9


No 114
>TIGR02120 GspF general secretion pathway protein F; InterPro: IPR011850   This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the "Type II" secretion pathway. The GSP transports proteins (generally virulence-associated cell wall hydrolases) across the outer membrase of the bacterial cell. Transport across the inner membrane is often, but not exclusively handled by the Sec system. GspF nearly always clusters with other GSP subunits. However, some genes from Xylella and Xanthomonas strains are excluded from this entry due to excessive divergence.; GO: 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=64.61  E-value=4.7  Score=18.90  Aligned_cols=17  Identities=6%  Similarity=0.317  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVV   21 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~   21 (173)
                      |.+.++|++.++.+++.
T Consensus       184 Pa~l~vVa~~vv~~Ll~  200 (414)
T TIGR02120       184 PAVLTVVAIGVVIFLLA  200 (414)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             89999999999999994


No 115
>pfam07431 DUF1512 Protein of unknown function (DUF1512). This family consists of several archaeal proteins of around 370 residues in length. The function of this family is unknown.
Probab=64.60  E-value=9.3  Score=17.20  Aligned_cols=55  Identities=11%  Similarity=0.347  Sum_probs=34.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999622889999999999999999999999999999999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH   65 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l   65 (173)
                      ++|.++.+++||++++++  + .+.-..  =...|++.+..-+...+++.+.+.+|-++.
T Consensus         3 ~l~~II~~l~~~ifI~l~--Q-riQl~~--~~~~Ie~~l~~Le~~~~~s~k~~~~~lkk~   57 (356)
T pfam07431         3 SIYFILSMLLFFLLIILL--Q-RIQVYR--LFRDIEGALSELEKFLNDAKKKVVELLKKE   57 (356)
T ss_pred             HHHHHHHHHHHHHHHHHH--H-HHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             199999999999999999--9-999999--999999999999999888999999998515


No 116
>MTH00025 ATP8 ATP synthase F0 subunit 8; Validated
Probab=64.58  E-value=9.3  Score=17.19  Aligned_cols=34  Identities=12%  Similarity=0.298  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIR   41 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~   41 (173)
                      -|.++.+++++.++..+.+| .|..-+--|+.-+.
T Consensus        14 ~Wtl~~Lf~L~~ll~~~ilP-~ik~n~~IR~~l~~   47 (70)
T MTH00025         14 RWTLIVLFLLLFFLVFFVLP-TIKRNWLIRKSLMK   47 (70)
T ss_pred             HHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH
T ss_conf             99999999999999999989-99874999999980


No 117
>COG3105 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.74  E-value=10  Score=16.99  Aligned_cols=86  Identities=13%  Similarity=0.116  Sum_probs=46.7

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99798999999999999999999622889999999999999999999999999999999999999999999999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK   80 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~   80 (173)
                      |+--.+-|......+++++++-+.+-+ +..-=-..+.+.+.+|+       .++..+++|...+..-=.+..+++...-
T Consensus         1 ~nwt~~~W~~a~igLvvGi~IG~li~R-lt~~~~k~q~~~q~ELe-------~~K~~ld~~rqel~~HFa~sAeLlktl~   72 (138)
T COG3105           1 MNWTFMTWEYALIGLVVGIIIGALIAR-LTNRKLKQQQKLQYELE-------KVKAQLDEYRQELVKHFARSAELLKTLA   72 (138)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHH-HCCHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             950599999999999999999999999-82302225899999999-------9998999999999999998999999999


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999999
Q gi|254781085|r   81 HRAKILAEEGCQNI   94 (173)
Q Consensus        81 ~~a~~~~e~~~~~a   94 (173)
                      ...+...+..-+.+
T Consensus        73 ~dYqklyqHmA~ss   86 (138)
T COG3105          73 QDYQKLYQHMAKSS   86 (138)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999998627


No 118
>TIGR02794 tolA_full protein TolA; InterPro: IPR014161   TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cut-offs are based largely on conserved operon structure. The Tol-Pal complex is required for maintaining outer membrane integrity, and is also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins OmpC, PhoE and LamB..
Probab=62.56  E-value=7.7  Score=17.66  Aligned_cols=16  Identities=25%  Similarity=0.499  Sum_probs=6.7

Q ss_pred             HHHHHH-HHHHHHHHHH
Q ss_conf             899999-9999999999
Q gi|254781085|r    5 ETFLVF-MSLIIFLVIV   20 (173)
Q Consensus         5 ~tfw~~-i~f~il~~il   20 (173)
                      ++||+- +..+|||++|
T Consensus         2 ~a~~~s~~lH~~l~~~L   18 (452)
T TIGR02794         2 RAFLLSVLLHILLLGLL   18 (452)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             59999999999999999


No 119
>KOG2568 consensus
Probab=61.40  E-value=4.6  Score=18.97  Aligned_cols=15  Identities=20%  Similarity=0.543  Sum_probs=6.4

Q ss_pred             CCHHHHHHHHHHHHH
Q ss_conf             798999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFL   17 (173)
Q Consensus         3 ~d~tfw~~i~f~il~   17 (173)
                      +|..||.++.|++|+
T Consensus       420 v~~a~W~~l~~~iLv  434 (518)
T KOG2568         420 VDTAFWPLLFFLILV  434 (518)
T ss_pred             HHHCCHHHHHHHHHH
T ss_conf             030227999999999


No 120
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=60.04  E-value=11  Score=16.71  Aligned_cols=28  Identities=0%  Similarity=0.211  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999996228899999999999
Q gi|254781085|r   11 MSLIIFLVIVVYLRIPSILLSFLDAHADK   39 (173)
Q Consensus        11 i~f~il~~il~~~~~~~~i~~~l~~R~~~   39 (173)
                      +.++++++.++|| ..+|=.+--.+|++.
T Consensus         6 iim~vv~~~~~ff-miRpQkK~qke~q~m   33 (120)
T PRK06531          6 IIMFVVMLGLIFF-MQRQQKKQAQERQNQ   33 (120)
T ss_pred             HHHHHHHHHHHHH-EECHHHHHHHHHHHH
T ss_conf             9999999999986-037488999999999


No 121
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=59.81  E-value=11  Score=16.69  Aligned_cols=24  Identities=4%  Similarity=0.132  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLS   31 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~   31 (173)
                      +..++-|+++|+++ ||++.+|=.+
T Consensus         4 l~~flPlili~~vf-~f~~iRpQkK   27 (108)
T PRK05886          4 LVLFLPFLLIMGGF-MYFASRRQRK   27 (108)
T ss_pred             HHHHHHHHHHHHHH-HHHHCCHHHH
T ss_conf             89999999999999-9993168999


No 122
>TIGR01846 type_I_sec_HlyB type I secretion system ATPase; InterPro: IPR010132   Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This entry contains one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane.
Probab=59.64  E-value=11  Score=16.67  Aligned_cols=31  Identities=10%  Similarity=0.153  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999622889999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHAD   38 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~   38 (173)
                      +|++|.-+.+| +++|+++-|++.+=+|+..+
T Consensus       288 T~vV~~SL~~Y-~~~s~~v~p~LRkRVe~kfe  318 (703)
T TIGR01846       288 TGVVIGSLVCY-ALLSVFVSPILRKRVEDKFE  318 (703)
T ss_pred             HHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHC
T ss_conf             87899999999-99999850011023577641


No 123
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128   The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM) , .; GO: 0000746 conjugation.
Probab=58.45  E-value=10  Score=16.95  Aligned_cols=23  Identities=9%  Similarity=0.327  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999962288
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSI   28 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~   28 (173)
                      .||.++.|+||++++.|+..+.-
T Consensus        23 ~~~~~~~~~iL~gL~~~~~~s~~   45 (613)
T TIGR02759        23 FYAALILFVILTGLILWLVASAE   45 (613)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             99999999999999999855602


No 124
>pfam06295 DUF1043 Protein of unknown function (DUF1043). This family consists of several hypothetical bacterial proteins of unknown function.
Probab=57.26  E-value=13  Score=16.43  Aligned_cols=56  Identities=9%  Similarity=0.127  Sum_probs=38.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   35 AHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQI   97 (173)
Q Consensus        35 ~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~   97 (173)
                      .++...+.+|+       +++..+.+|+..+.+==.....++...........+..-..+..-
T Consensus        25 ~~q~~Le~eLe-------~~k~el~~Y~~ev~~HF~~tA~Ll~~l~~~Y~~ly~HlA~~a~~L   80 (128)
T pfam06295        25 KNQKKIKKELE-------EAKEELDEQRQELKDHFAQSAELLETLGKDYHKLYQHMAKSSKFL   80 (128)
T ss_pred             HHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             68999999999-------999999999999999999999999999999999999999899987


No 125
>KOG3054 consensus
Probab=56.94  E-value=13  Score=16.40  Aligned_cols=21  Identities=10%  Similarity=0.401  Sum_probs=14.1

Q ss_pred             CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             989999999999999999996
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLR   24 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~   24 (173)
                      +..||++|.-+++++++..|+
T Consensus         2 ~~~v~vlVaa~llV~~i~l~l   22 (299)
T KOG3054           2 EEIVAVLVAAALLVAVILLFL   22 (299)
T ss_pred             CHHHHHHHHHHHHHHHHHHHH
T ss_conf             137999999999999999999


No 126
>PTZ00233 variable surface protein Vir18; Provisional
Probab=56.09  E-value=5.1  Score=18.72  Aligned_cols=28  Identities=14%  Similarity=0.215  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999996228899999999999999
Q gi|254781085|r   12 SLIIFLVIVVYLRIPSILLSFLDAHADKIRD   42 (173)
Q Consensus        12 ~f~il~~il~~~~~~~~i~~~l~~R~~~I~~   42 (173)
                      ..++|++|| +  -|.||-++|..|..+=..
T Consensus       443 GIVLLLgLL-F--KyTPLWrvLTKknRKk~a  470 (509)
T PTZ00233        443 GIALLLGLL-F--KYTPLWRVLTKKNRKKGA  470 (509)
T ss_pred             HHHHHHHHH-H--CCCHHHHHHHHCCCCCCC
T ss_conf             999999988-6--226236655111435556


No 127
>TIGR00785 dass transporter, divalent anion:Na+ symporter (DASS) family; InterPro: IPR001898   Integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families. One of these families currently consists of the following proteins:  Mammalian sodium/sulphate cotransporter . Mammalian renal sodium/dicarboxylate cotransporter , which transports succinate and citrate. Mammalian intestinal sodium/dicarboxylate cotransporter. Chlamydomonas reinhardtii putative sulphur deprivation response regulator SAC1 . Caenorhabditis elegans hypothetical proteins B0285.6, F31F6.6, K08E5.2 and R107.1. Escherichia coli hypothetical protein yfbS. Haemophilus influenzae hypothetical protein HI0608. Synechocystis sp. (strain PCC 6803) hypothetical protein sll0640. Methanococcus jannaschii hypothetical protein MJ0672.    These transporters are proteins of from 430 to 620 amino acids which are highly hydrophobic and which probably contain about 12 transmembrane regions.; GO: 0005215 transporter activity, 0006814 sodium ion transport, 0016020 membrane.
Probab=55.41  E-value=11  Score=16.87  Aligned_cols=39  Identities=13%  Similarity=0.194  Sum_probs=29.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFE   46 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~   46 (173)
                      +.+.|..+++..+++|. +|||-.+.-|++..-++.++++
T Consensus       219 lP~~~~llll~~~llY~-~fpP~~~~~~~~~~~ak~el~~  257 (473)
T TIGR00785       219 LPLGIILLLLVPLLLYV-LFPPELKSKDEVDLWAKEELEE  257 (473)
T ss_pred             HHHHHHHHHHHHHHHHH-HCCCCCCCCCCHHHHHHHHHHH
T ss_conf             25999999999999865-2675104664388999886521


No 128
>PRK00056 mtgA monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
Probab=55.37  E-value=8.9  Score=17.31  Aligned_cols=22  Identities=14%  Similarity=0.238  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999622889999999999
Q gi|254781085|r   17 LVIVVYLRIPSILLSFLDAHAD   38 (173)
Q Consensus        17 ~~il~~~~~~~~i~~~l~~R~~   38 (173)
                      +++++|.++++|....+..|.-
T Consensus        25 ~~v~~~~~~~pp~t~~m~~r~~   46 (226)
T PRK00056         25 LQIALFRFVPPPFSAVMVERPV   46 (226)
T ss_pred             HHHHHHHCCCCCCCHHHHHCHH
T ss_conf             9877642018998888985435


No 129
>pfam03967 PRCH Photosynthetic reaction centre, H-chain N-terminal region. The family corresponds the N-terminal cytoplasmic domain.
Probab=54.27  E-value=14  Score=16.14  Aligned_cols=22  Identities=32%  Similarity=0.522  Sum_probs=14.8

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~   23 (173)
                      +||..=.++-.|.+||+.|+|+
T Consensus         8 ~~DvAql~ly~FwiFFagLv~Y   29 (135)
T pfam03967         8 YFDVAQLALYAFWIFFAGLVYY   29 (135)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH
T ss_conf             3409999999999999999998


No 130
>pfam01496 V_ATPase_I V-type ATPase 116kDa subunit family. This family consists of the 116kDa V-type ATPase (vacuolar (H+)-ATPases) subunits, as well as V-type ATP synthase subunit i. The V-type ATPases family are proton pumps that acidify intracellular compartments in eukaryotic cells for example yeast central vacuoles, clathrin-coated and synaptic vesicles. They have important roles in membrane trafficking processes. The 116kDa subunit (subunit a) in the V-type ATPase is part of the V0 functional domain responsible for proton transport. The a subunit is a transmembrane glycoprotein with multiple putative transmembrane helices it has a hydrophilic amino terminal and a hydrophobic carboxy terminal. It has roles in proton transport and assembly of the V-type ATPase complex. This subunit is encoded by two homologous gene in yeast VPH1 and STV1.
Probab=54.19  E-value=10  Score=16.90  Aligned_cols=35  Identities=17%  Similarity=0.096  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999
Q gi|254781085|r   32 FLDAHADKIRDDIFEARRLREKSENILMQYKEKHS   66 (173)
Q Consensus        32 ~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~   66 (173)
                      -++.+.+.+.+.+.+.+...+..+....+..+...
T Consensus        71 ~~e~~~~~~e~~l~~~~~~~~~l~~~~~~l~e~~~  105 (707)
T pfam01496        71 DLEEEILDLEAEIKEVEENLESLEKEINELEEWLN  105 (707)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999999999999


No 131
>pfam06129 Chordopox_G3 Chordopoxvirus G3 protein. This family consists of several Chordopoxvirus specific G3 proteins. The function of this family is unknown.
Probab=53.46  E-value=8  Score=17.56  Aligned_cols=23  Identities=9%  Similarity=0.248  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999962288999
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSILLS   31 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i~~   31 (173)
                      +-+.||++|++++|++-+.|-.+
T Consensus         4 l~l~fFi~Fl~l~Y~~n~~PTNK   26 (109)
T pfam06129         4 LYLLFFILFLLLCYFFNYYPTNK   26 (109)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHH
T ss_conf             28999999999999863046715


No 132
>PRK00269 zipA cell division protein ZipA; Reviewed
Probab=53.16  E-value=15  Score=16.04  Aligned_cols=27  Identities=11%  Similarity=0.064  Sum_probs=17.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989999999999999999996228
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPS   27 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~   27 (173)
                      |.+|..+|++|.=.|.++.|+..+.|+
T Consensus         1 M~~~LR~~LIIVGalaI~AlLlHGw~r   27 (295)
T PRK00269          1 MEIGLREWLIVIGIIVIAGILFDGWRR   27 (295)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHEE
T ss_conf             951245699999999999999865021


No 133
>COG3462 Predicted membrane protein [Function unknown]
Probab=52.72  E-value=15  Score=15.99  Aligned_cols=32  Identities=9%  Similarity=-0.004  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999
Q gi|254781085|r   38 DKIRDDIFEARRLREKSENILMQYKEKHSKVE   69 (173)
Q Consensus        38 ~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~   69 (173)
                      ++-+...+-+++.-..-+--.++|++.+.+.+
T Consensus        85 e~~sRA~eIlkER~AkGEItEEEY~r~~~~ir  116 (117)
T COG3462          85 ERGSRAEEILKERYAKGEITEEEYRRIIRTIR  116 (117)
T ss_pred             CCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHC
T ss_conf             25317999999997347888999999999850


No 134
>pfam05756 S-antigen S-antigen protein. S-antigens are heat stable proteins that are found in the blood of individuals infected with malaria.
Probab=52.41  E-value=5.9  Score=18.33  Aligned_cols=22  Identities=5%  Similarity=0.223  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999996228899
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSILL   30 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i~   30 (173)
                      +-|+|.+||++|+.+..|..|.
T Consensus         5 LSVsfyLFFiYLYIYkTYGKVK   26 (310)
T pfam05756         5 LSVTFYLFFIYLYIYKTYGKVK   26 (310)
T ss_pred             EEEHHHHHHHHHHHHHHHCCCC
T ss_conf             5315789999999987524323


No 135
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms]
Probab=52.10  E-value=15  Score=15.93  Aligned_cols=33  Identities=21%  Similarity=0.492  Sum_probs=19.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAH   36 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R   36 (173)
                      |||+||.+++.|.+..++++ | .-....+.-+.|
T Consensus       198 nId~tf~~Vv~iavv~vllV-~-~t~lalNl~ehR  230 (459)
T COG4564         198 NIDTTFLIVVLIAVVAVLLV-F-ATCLALNLREHR  230 (459)
T ss_pred             CCCHHHHHHHHHHHHHHHHH-H-HHHHHHHHHHHH
T ss_conf             74526799999999999999-9-999873119877


No 136
>PRK10930 FtsH protease regulator HflK; Provisional
Probab=51.06  E-value=16  Score=15.83  Aligned_cols=49  Identities=14%  Similarity=0.043  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999999999
Q gi|254781085|r   47 ARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIE   95 (173)
Q Consensus        47 A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~   95 (173)
                      ...+-.++....++-+..+.+|+..+.+++-.|+-+|.++++++..-..
T Consensus       247 V~~AF~DV~~ArqD~er~ineA~aYaN~iiP~ArG~A~rii~eAeaYk~  295 (419)
T PRK10930        247 VKAAFDDAIAARENEQQYIREAEAYTNEVQPRANGQAQRILEEARAYKA  295 (419)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998899999999999975351321389999999999999


No 137
>PRK11029 FtsH protease regulator HflC; Provisional
Probab=51.03  E-value=16  Score=15.83  Aligned_cols=88  Identities=10%  Similarity=0.094  Sum_probs=48.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999433999999
Q gi|254781085|r   67 KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNS  146 (173)
Q Consensus        67 ~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~  146 (173)
                      -.+.|.+.+-...+.+++.....+..+++.+...+..+|..+-..        ++.+...-+.    ++...-.+++.  
T Consensus       226 rM~aER~~~A~~~raeG~~~a~~Ira~ad~e~~~i~AeA~r~a~~--------irgegdAea~----~iya~Ay~kdp--  291 (334)
T PRK11029        226 RMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQGRI--------MRGEGDAEAA----KLFADAFSQDP--  291 (334)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHH----HHHHHHHCCCH--
T ss_conf             999999999999998789999998988888889998889989999--------9837889999----99999973398--


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999997400443
Q gi|254781085|r  147 SIFEKTISSIQSCHQMDKNTTET  169 (173)
Q Consensus       147 ~~I~~~i~~l~~~~k~~~n~~~~  169 (173)
                       =+-.+...|+..++++.+.+.+
T Consensus       292 -efy~f~rsLeay~~~l~~~~~~  313 (334)
T PRK11029        292 -DFYAFIRSLRAYENSFSGNQDV  313 (334)
T ss_pred             -HHHHHHHHHHHHHHHHCCCCCE
T ss_conf             -9999999999999995699958


No 138
>PRK05978 hypothetical protein; Provisional
Probab=50.45  E-value=16  Score=15.78  Aligned_cols=32  Identities=6%  Similarity=0.103  Sum_probs=17.5

Q ss_pred             CCCHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             979899999999-999999999962288999999
Q gi|254781085|r    2 HFDETFLVFMSL-IIFLVIVVYLRIPSILLSFLD   34 (173)
Q Consensus         2 ~~d~tfw~~i~f-~il~~il~~~~~~~~i~~~l~   34 (173)
                      ++++.+|+.+.. ..+.+++....+| |++..+-
T Consensus        94 ~~~pP~Wvh~~iw~pl~l~l~L~lLp-p~KG~~I  126 (149)
T PRK05978         94 TFALPVWLHLAIWLPITLIASLALLQ-PIKGAVI  126 (149)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHH-HHHHHHH
T ss_conf             71885999999999999999999988-8899999


No 139
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=50.44  E-value=16  Score=15.78  Aligned_cols=77  Identities=8%  Similarity=0.091  Sum_probs=54.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999962288999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    8 LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKI   85 (173)
Q Consensus         8 w~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~   85 (173)
                      |+. .+.....+.+-++...|-....++|.+.|+.++..-+.......+.....+..+.+.+.+...+-.+-...+..
T Consensus        12 ~l~-~~~~~~~l~~~~~~~s~s~~a~~~~l~q~q~ei~~~~~~i~~~~~~~~kL~~~lk~~e~~i~~~~~ql~~s~~~   88 (420)
T COG4942          12 MLG-TILLASLLSAAVLAAAFSAAADDKQLKQIQKEIAALEKKIREQQDQRAKLEKQLKSLETEIASLEAQLIETADD   88 (420)
T ss_pred             HHH-HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             777-77789998605113576678678889989999999999999999999999999999998899999999998868


No 140
>pfam06667 PspB Phage shock protein B. This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one.
Probab=48.80  E-value=17  Score=15.62  Aligned_cols=21  Identities=10%  Similarity=0.282  Sum_probs=13.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             997989999999999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVV   21 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~   21 (173)
                      |.++.-|..+|.|++|++-+|
T Consensus         1 M~~~fl~vPliiF~ifVaP~W   21 (75)
T pfam06667         1 MSMEFLAVPLIIFMLFVAPIW   21 (75)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
T ss_conf             963898997999999999999


No 141
>cd03404 Band_7_HflK Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfK (High frequency of lysogenization K). Although many members of the band 7 family are lipid raft associated, prokaryote plasma membranes lack cholesterol and are unlikely to have lipid raft domains.  Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Escherichia coli HflK is an integral membrane protein which may localize to the plasma membrane. HflK associates with another band 7 family member (HflC) to form an HflKC complex.  HflKC interacts with FtsH in a large complex termed the FtsH holo-enzyme. FtsH is an AAA ATP-dependent protease which exerts progressive proteolysis against membrane-embedded and soluble substrate proteins.  HflKC can modulate the activity of FtsH. HflKC plays a role in the decision between lysogenic and lytic cycle growth during la
Probab=48.58  E-value=17  Score=15.60  Aligned_cols=19  Identities=26%  Similarity=0.324  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999999999999
Q gi|254781085|r   28 ILLSFLDAHADKIRDDIFE   46 (173)
Q Consensus        28 ~i~~~l~~R~~~I~~~l~~   46 (173)
                      .+..+|...+..|...+..
T Consensus       131 ~lde~l~~~R~~i~~~i~~  149 (266)
T cd03404         131 TLDDVLTEGREEIAQDVRE  149 (266)
T ss_pred             CHHHHHHCCHHHHHHHHHH
T ss_conf             0688864379999999999


No 142
>cd00226 PRCH Photosynthetic reaction center (RC) complex, subunit H;  RC is an integral membrane protein-pigment complex which catalyzes light-induced reduction of ubiquinone to ubiquinol, generating a transmembrane electrochemical gradient of protons used to produce ATP by ATP synthase. Subunit H is positioned mainly in the cytoplasm with one transmembrane alpha helix. Provides proton transfer pathway (water channels) connecting the terminal quinone electron acceptor of RC, to the aqueous phase. Found in photosynthetic bacteria: alpha, beta, and gamma proteobacteria.
Probab=47.47  E-value=18  Score=15.50  Aligned_cols=22  Identities=32%  Similarity=0.538  Sum_probs=15.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~   23 (173)
                      +||..=.++-.|.|||+.|+|+
T Consensus         9 ~~DvAql~ly~FWiFFagLv~Y   30 (246)
T cd00226           9 YFDLAQLVIYAFWIFFAGLIYY   30 (246)
T ss_pred             EEEHHHHHHHHHHHHHHHHHHH
T ss_conf             3259999999999999999998


No 143
>PRK09702 arbutin specific enzyme IIB component of PTS; Provisional
Probab=47.03  E-value=18  Score=15.46  Aligned_cols=27  Identities=11%  Similarity=0.324  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962288999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLD   34 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~   34 (173)
                      .|+.|...++|+++ ||++|+.+..-++
T Consensus         9 ~~~~I~vGlv~~~i-YY~vF~flI~KfN   35 (161)
T PRK09702          9 MLTQIAIGLCFTLL-YFVVFRTLILQFN   35 (161)
T ss_pred             HHHHHHHHHHHHHH-HHHHHHHHHHHCC
T ss_conf             99999999999989-9999999999848


No 144
>PRK00404 tatB sec-independent translocase; Provisional
Probab=46.75  E-value=19  Score=15.43  Aligned_cols=40  Identities=13%  Similarity=0.225  Sum_probs=17.4

Q ss_pred             CCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             979899999999999-99999996228899999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIF-LVIVVYLRIPSILLSFLDAHADKIRD   42 (173)
Q Consensus         2 ~~d~tfw~~i~f~il-~~il~~~~~~~~i~~~l~~R~~~I~~   42 (173)
                      +||..||=++..+++ +++|.=.-+|. +.+.+-.-..+++.
T Consensus         1 MFdigf~ElllI~vvaLiVlGPerLP~-~~rt~g~~~g~~rr   41 (141)
T PRK00404          1 MFGISFSELLLVGLVALLVLGPERLPG-AARTAGLWIGRLKR   41 (141)
T ss_pred             CCCCCHHHHHHHHHHHHHEECHHHHHH-HHHHHHHHHHHHHH
T ss_conf             977458999999999985058288799-99999999999999


No 145
>pfam04791 LMBR1 LMBR1-like membrane protein. Members of this family are integral membrane proteins that are around 500 residues in length. LMBR1 is not involved in preaxial polydactyly, as originally thought. Vertebrate members of this family may play a role in limb development. A member of this family has been shown to be a lipocalin membrane receptor
Probab=46.26  E-value=19  Score=15.39  Aligned_cols=15  Identities=27%  Similarity=0.257  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             228899999999999
Q gi|254781085|r   25 IPSILLSFLDAHADK   39 (173)
Q Consensus        25 ~~~~i~~~l~~R~~~   39 (173)
                      +|+-+.+.+..|...
T Consensus       184 lP~~l~~~~~~~~~l  198 (419)
T pfam04791       184 LPSSLWKLLVRYFRA  198 (419)
T ss_pred             HHHHHHHHHCCCHHH
T ss_conf             329999873555468


No 146
>pfam05137 PilN Fimbrial assembly protein (PilN).
Probab=45.85  E-value=19  Score=15.35  Aligned_cols=20  Identities=10%  Similarity=0.024  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999
Q gi|254781085|r   31 SFLDAHADKIRDDIFEARRL   50 (173)
Q Consensus        31 ~~l~~R~~~I~~~l~~A~~~   50 (173)
                      ..-..|.......+......
T Consensus        45 ~~q~~~~~~L~~ei~~L~~~   64 (162)
T pfam05137        45 EAQQERNAFLRTQIQQLDGQ   64 (162)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999


No 147
>PRK00708 sec-independent translocase; Provisional
Probab=44.79  E-value=20  Score=15.25  Aligned_cols=40  Identities=20%  Similarity=0.402  Sum_probs=16.8

Q ss_pred             CCCHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999-999999996228899999999999999
Q gi|254781085|r    2 HFDETFLVFMSLII-FLVIVVYLRIPSILLSFLDAHADKIRD   42 (173)
Q Consensus         2 ~~d~tfw~~i~f~i-l~~il~~~~~~~~i~~~l~~R~~~I~~   42 (173)
                      +||.-||=++.+++ .++++.=.-||+ +.+.+-.-..+++.
T Consensus         1 MfDiG~~ElllI~vValiVvGPkdLP~-~~Rt~g~~~~k~R~   41 (197)
T PRK00708          1 MFDIGWSELLVIAIVLIVVVGPKDLPP-MLRAFGKMTARMRK   41 (197)
T ss_pred             CCCCCHHHHHHHHHHHHHEECHHHHHH-HHHHHHHHHHHHHH
T ss_conf             987428999999999850468477799-99999999999999


No 148
>PRK01433 hscA chaperone protein HscA; Provisional
Probab=44.06  E-value=21  Score=15.19  Aligned_cols=73  Identities=11%  Similarity=-0.019  Sum_probs=32.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   38 DKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE  115 (173)
Q Consensus        38 ~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~  115 (173)
                      +.|..-+.+|+...++     ....+.+.+++.+++.++-.............-..-...++..+...+..+......
T Consensus       485 ~ei~~m~~~a~~~~~~-----d~~~r~~~e~~~~~e~~~~~~~~~l~~~~~~l~~~~~~~i~~~~~~l~~~~~~~d~~  557 (595)
T PRK01433        485 TEIDIMLENAYKNAKI-----DYTTRLLQEAIIEAEALIFNIERAIAELTTLLSESEISIINSLLDNIKEAIKARDRI  557 (595)
T ss_pred             HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHH
T ss_conf             9999999999998999-----999999999999999999999999997455099999999999999999998667899


No 149
>pfam05545 FixQ Cbb3-type cytochrome oxidase component FixQ. This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon.
Probab=43.64  E-value=15  Score=15.98  Aligned_cols=22  Identities=18%  Similarity=0.440  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999996228
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPS   27 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~   27 (173)
                      +++.++.|++|+++++|-+-|+
T Consensus        12 ~~~~l~~~~~Figiv~wa~~p~   33 (49)
T pfam05545        12 SWGTLVLFVFFIGIVFWAYSPR   33 (49)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9999999999999999872877


No 150
>pfam04011 LemA LemA family. The members of this family are related to the LemA protein. LemA contains an amino terminal predicted transmembrane helix. It has been predicted that the small amino terminus is extracellular. The exact molecular function of this protein is uncertain.
Probab=43.28  E-value=21  Score=15.12  Aligned_cols=23  Identities=22%  Similarity=0.089  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             28899999999999999999999
Q gi|254781085|r   26 PSILLSFLDAHADKIRDDIFEAR   48 (173)
Q Consensus        26 ~~~i~~~l~~R~~~I~~~l~~A~   48 (173)
                      |..|...|..|.+-|.+-++.++
T Consensus        36 ~s~Idv~L~rR~dli~nLv~~vk   58 (186)
T pfam04011        36 WSQIQVQLQRRADLIPNLVETVK   58 (186)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999


No 151
>pfam06936 Selenoprotein_S Selenoprotein S (SelS). This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. The function of this family is unknown.
Probab=42.84  E-value=22  Score=15.08  Aligned_cols=21  Identities=14%  Similarity=0.244  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999622889999999
Q gi|254781085|r   14 IIFLVIVVYLRIPSILLSFLDA   35 (173)
Q Consensus        14 ~il~~il~~~~~~~~i~~~l~~   35 (173)
                      ++|+.+++|+ ++..|..-+..
T Consensus        40 iL~~~v~ly~-l~qkL~~~~~~   60 (190)
T pfam06936        40 LLLGCVGIYL-LIQKLRPRWRS   60 (190)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHH
T ss_conf             9999999999-99987199998


No 152
>PRK03427 cell division protein ZipA; Provisional
Probab=39.87  E-value=24  Score=14.80  Aligned_cols=27  Identities=11%  Similarity=0.124  Sum_probs=19.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             997989999999999999999996228
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPS   27 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~   27 (173)
                      |.=|..+|++|.=.|.++.|+..++|.
T Consensus         1 mMqdLRliLIIvGaIAIiALL~HGlWt   27 (331)
T PRK03427          1 MMQDLRLILIIVGAIAIIALLVHGFWT   27 (331)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCEE
T ss_conf             935889999999999999999852022


No 153
>pfam00558 Vpu Vpu protein. The Vpu protein contains an N-terminal transmembrane spanning region and a C-terminal cytoplasmic region. The HIV-1 Vpu protein stimulates virus production by enhancing the release of viral particles from infected cells. The VPU protein binds specifically to CD4.
Probab=39.54  E-value=24  Score=14.77  Aligned_cols=35  Identities=23%  Similarity=0.119  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999996228899999999999999999999999999
Q gi|254781085|r   18 VIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKS   54 (173)
Q Consensus        18 ~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a   54 (173)
                      .+++|-+++.-..+.  .|+.+|..-++.-.+..+++
T Consensus        19 aIvVW~iv~~ey~k~--~rqrkI~~l~~RIrEraEDS   53 (81)
T pfam00558        19 NIVVWTIVYREYRKI--KKQREILRLIKRIRERAEDS   53 (81)
T ss_pred             HHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHCCC
T ss_conf             999999999999999--99999999999999960367


No 154
>PRK10775 cell division protein FtsQ; Provisional
Probab=39.06  E-value=17  Score=15.74  Aligned_cols=30  Identities=13%  Similarity=0.161  Sum_probs=19.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9899999999999999999962288999999
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLRIPSILLSFLD   34 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~~~~~i~~~l~   34 (173)
                      +.+||.-++||+++++.+....|. +.+-|.
T Consensus        22 ~~~~~~g~~F~l~vi~~~~~~~~~-~~~wm~   51 (274)
T PRK10775         22 NGTRLAGILFLLTVLGTVLVSGWV-VLGWME   51 (274)
T ss_pred             CCCEEEHHHHHHHHHHHHHHHHHH-HHHHHC
T ss_conf             884675377889999999998999-998860


No 155
>pfam06170 DUF983 Protein of unknown function (DUF983). This family consists of several bacterial proteins of unknown function.
Probab=38.38  E-value=25  Score=14.66  Aligned_cols=32  Identities=13%  Similarity=0.212  Sum_probs=16.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFL   33 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l   33 (173)
                      ++++..|+.+.....+.++.-..+-+|++..+
T Consensus        49 ~~~pp~wvh~~i~~p~~~~l~l~lL~~~KG~~   80 (86)
T pfam06170        49 AYRPPLWVHLAIWLPLTLALSLLLLRPVKGAL   80 (86)
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             93885999999999999999999998888896


No 156
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms]
Probab=37.83  E-value=26  Score=14.61  Aligned_cols=39  Identities=13%  Similarity=0.264  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHCCH--HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999943399--999999999999999999997
Q gi|254781085|r  125 ADFSVEIVREIISQKMND--DVNSSIFEKTISSIQSCHQMD  163 (173)
Q Consensus       125 ~~la~~~~~kil~~~l~~--~~~~~~I~~~i~~l~~~~k~~  163 (173)
                      ..||.+-...-++.+++.  +.-++..|..+..++..+.+.
T Consensus       504 IQLSAERl~rk~gk~i~eDrevfd~~tdTIirQV~dI~rMV  544 (712)
T COG5000         504 IQLSAERLLRKLGKEIDEDREVFDRCTDTIIRQVEDIKRMV  544 (712)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             20028999988374123489999999999999999999999


No 157
>COG3242 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.80  E-value=26  Score=14.61  Aligned_cols=28  Identities=14%  Similarity=0.208  Sum_probs=19.2

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9899999999999999999962288999
Q gi|254781085|r    4 DETFLVFMSLIIFLVIVVYLRIPSILLS   31 (173)
Q Consensus         4 d~tfw~~i~f~il~~il~~~~~~~~i~~   31 (173)
                      +-|||+++++++++=.+.+++.|+--++
T Consensus         2 ~~~~~~Al~LVlVlEGL~p~l~P~~wkk   29 (62)
T COG3242           2 NDTLWLALGLVLVLEGLGPFLAPRAWKK   29 (62)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             1289999999999961010038599999


No 158
>PRK06835 DNA replication protein DnaC; Validated
Probab=36.36  E-value=27  Score=14.47  Aligned_cols=78  Identities=13%  Similarity=0.060  Sum_probs=45.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999433999999999999999999
Q gi|254781085|r   79 AKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS  158 (173)
Q Consensus        79 a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~  158 (173)
                      ...+.-++.+......+...+.+.++....|-.     .++|..++..+++..+..++.+.-+.+..-.-+..-+..|..
T Consensus         5 ~~~~i~r~ye~~r~~~~~~~~~R~~eiy~kiP~-----i~eid~ei~~~~~~~a~~~l~~~~~~~~~l~~lk~~i~~L~~   79 (330)
T PRK06835          5 YISEILKEYEKRRQKEELNLKNRKEEIYKKIPE-----IEEIDREIAKLGIKLSQLILKGPDNSEEELESLKEKITDLRV   79 (330)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-----HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999996944-----999999999999999999865998558999999999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254781085|r  159 CHQ  161 (173)
Q Consensus       159 ~~k  161 (173)
                      .+.
T Consensus        80 ~k~   82 (330)
T PRK06835         80 KKS   82 (330)
T ss_pred             HHH
T ss_conf             999


No 159
>PRK03554 tatA twin arginine translocase protein A; Provisional
Probab=36.26  E-value=11  Score=16.85  Aligned_cols=11  Identities=0%  Similarity=0.175  Sum_probs=4.7

Q ss_pred             HHHHHHHHHHH
Q ss_conf             89999999999
Q gi|254781085|r    5 ETFLVFMSLII   15 (173)
Q Consensus         5 ~tfw~~i~f~i   15 (173)
                      ...|-++..++
T Consensus         4 isiw~llIi~~   14 (89)
T PRK03554          4 ISIWQLLIIAV   14 (89)
T ss_pred             CCHHHHHHHHH
T ss_conf             55999999999


No 160
>pfam10961 DUF2763 Protein of unknown function (DUF2763). This eukaryotic family of proteins has no known function.
Probab=36.04  E-value=25  Score=14.68  Aligned_cols=15  Identities=13%  Similarity=0.288  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             899999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVI   19 (173)
Q Consensus         5 ~tfw~~i~f~il~~i   19 (173)
                      .-||-+++|+.+|+-
T Consensus        23 d~fwgi~~~I~~FF~   37 (91)
T pfam10961        23 DFFWGIVNFISLFFR   37 (91)
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999999


No 161
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.98  E-value=28  Score=14.44  Aligned_cols=37  Identities=8%  Similarity=0.091  Sum_probs=22.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9979899999999999999999962288999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHA   37 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~   37 (173)
                      ++++++.|+-+..-+-+.++.-+.+-+|++..+-.-|
T Consensus        80 ~~~~~p~W~hl~vw~P~~~~~sL~~lrpvKG~vI~lQ  116 (126)
T COG5349          80 VTLNPPLWVHLLVWLPLTLALSLLLLRPVKGAVIGLQ  116 (126)
T ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2017973003588888999999983204667899999


No 162
>KOG4403 consensus
Probab=35.89  E-value=28  Score=14.43  Aligned_cols=27  Identities=19%  Similarity=0.209  Sum_probs=13.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999
Q gi|254781085|r   43 DIFEARRLREKSENILMQYKEKHSKVE   69 (173)
Q Consensus        43 ~l~~A~~~~~~a~~~~~~~~~~l~~a~   69 (173)
                      .|+.|+...++.++.+...+.......
T Consensus       253 ~Lq~aEqsl~dlQk~Lekar~e~rnva  279 (575)
T KOG4403         253 GLQRAEQSLEDLQKRLEKAREEQRNVA  279 (575)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCHH
T ss_conf             888899899999999999987541203


No 163
>PRK00191 tatA twin arginine translocase protein A; Provisional
Probab=35.26  E-value=29  Score=14.37  Aligned_cols=33  Identities=12%  Similarity=0.201  Sum_probs=16.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99798999999999999999999622889999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDA   35 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~   35 (173)
                      |++.+.=|++|.+++++ ++..+.+|. +.+.|-.
T Consensus         1 MsLGpweiiiI~vvvll-LFGaKKLPd-lARslGk   33 (107)
T PRK00191          1 MSLGPWEIGIIVLLIIV-LFGAKKLPD-AARSIGR   33 (107)
T ss_pred             CCCCHHHHHHHHHHHHH-HHCCCCCHH-HHHHHHH
T ss_conf             98637999999999999-976530369-9998858


No 164
>pfam08269 Cache_2 Cache domain.
Probab=34.58  E-value=29  Score=14.30  Aligned_cols=48  Identities=6%  Similarity=0.131  Sum_probs=23.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999
Q gi|254781085|r   31 SFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus        31 ~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      ..+++|+..++...+.|...-+........-+--..+|+..+.+.+..
T Consensus         3 ~l~~~rk~~lk~~v~~a~s~i~~~~~~~~~G~ls~~eA~~~a~~~l~~   50 (95)
T pfam08269         3 NLIEERKAELKAVVESALSIIKEYYQQAQKGKLTREEAQAQAKALLRA   50 (95)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             899999999999999999999999999877999999999999999985


No 165
>pfam04156 IncA IncA protein. Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is non-fusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA, is functionally associated with the homotypic fusion of inclusions. This family probably includes members of the wider Inc family rather than just IncA.
Probab=34.34  E-value=30  Score=14.28  Aligned_cols=69  Identities=12%  Similarity=0.221  Sum_probs=30.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999996228899999999999999999999999999999999999999999999999999
Q gi|254781085|r   10 FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus        10 ~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      ++..++|.+.+.++..+.|....-......=..++.++.....+....+.+.+....+...+.......
T Consensus        47 a~g~vLl~~g~~~l~~~~~~~~~~~~~~~~~~~e~~~~~~~l~~l~~el~~~~~~~~~~~~~l~~~~~~  115 (186)
T pfam04156        47 ALGLVLLALGLLCLLLKAPVQSVRPQKLEELQGELSELKQQLSELQEELEDLEERIAELESELEDLKED  115 (186)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             999999999999997166010416999898679999899999999998998987688874475978878


No 166
>PRK12704 phosphodiesterase; Provisional
Probab=34.08  E-value=30  Score=14.26  Aligned_cols=18  Identities=17%  Similarity=0.374  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999
Q gi|254781085|r   90 GCQNIEQISALYLKDLEQ  107 (173)
Q Consensus        90 ~~~~a~~~~~~~~~~a~~  107 (173)
                      ...+++.++...+...+.
T Consensus        98 le~e~~~e~a~~ir~~e~  115 (455)
T PRK12704         98 VEEELRHEAAVLIKEIEE  115 (455)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999


No 167
>TIGR01069 mutS2 MutS2 family protein; InterPro: IPR005747   Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication . MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base . MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch . MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level . Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.    MutS is a modular protein with a complex structure , and is composed of:    N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.    Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions . Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts .    This entry represents a family of MutS proteins.; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0045005 maintenance of fidelity during DNA-dependent DNA replication.
Probab=33.97  E-value=30  Score=14.25  Aligned_cols=92  Identities=15%  Similarity=0.124  Sum_probs=45.7

Q ss_pred             HHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999622889----9999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   21 VYLRIPSIL----LSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ   96 (173)
Q Consensus        21 ~~~~~~~~i----~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~   96 (173)
                      .++++|..|    ...+.+..+.|..-|...+....+.++.....++.+.+.+..-.+....+. +.+........++.+
T Consensus       528 ~r~G~P~~iie~AK~~~g~~~e~~n~~ie~L~~~~k~~~~~~~~~e~~lkE~E~~~~e~~~~~~-~l~~~~~~~~~~~~~  606 (834)
T TIGR01069       528 QRLGIPSEIIEQAKEKYGEFKEEINELIEKLSEKEKELEEKKEELEKLLKELEKLKKELEQEIE-ELKERERNLKKELEK  606 (834)
T ss_pred             HHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHH
T ss_conf             9847988899998674264056899999847999999999999899999998999999999999-999998777899999


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999
Q gi|254781085|r   97 ISALYLKDLEQKIHYMK  113 (173)
Q Consensus        97 ~~~~~~~~a~~~I~~~~  113 (173)
                      +....+..+.++++.--
T Consensus       607 e~~e~l~~~~~E~e~~~  623 (834)
T TIGR01069       607 EAQEALKALKKEVEEII  623 (834)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 168
>PRK01371 sec-independent translocase; Provisional
Probab=33.55  E-value=30  Score=14.21  Aligned_cols=16  Identities=19%  Similarity=0.166  Sum_probs=10.6

Q ss_pred             CCCCHHHHHHHHHHHH
Q ss_conf             9979899999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIF   16 (173)
Q Consensus         1 m~~d~tfw~~i~f~il   16 (173)
                      |.+|.-||=++..+++
T Consensus         1 Mf~dIG~~Ellvi~vv   16 (135)
T PRK01371          1 MFNDIGAGELVVLLVL   16 (135)
T ss_pred             CCCCCCHHHHHHHHHH
T ss_conf             9543358999999999


No 169
>pfam07850 Renin_r Renin receptor-like protein. The sequences featured in this family are similar to a region of the human renin receptor that bears a putative transmembrane spanning segment. The renin receptor is involved in intracellular signal transduction by the activation of the ERK1/ERK2 pathway, and it also serves to increase the efficiency of angiotensinogen cleavage by receptor-bound renin, therefore facilitating angiotensin II generation and action on a cell surface.
Probab=33.03  E-value=31  Score=14.15  Aligned_cols=21  Identities=14%  Similarity=0.461  Sum_probs=13.7

Q ss_pred             CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             798999999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~   23 (173)
                      |+..+|+.+.|++-++.++|-
T Consensus        55 FnIiLW~~v~l~l~v~~i~~~   75 (98)
T pfam07850        55 FNIILWLMVILVLAVIAISYN   75 (98)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999998761


No 170
>PRK13700 conjugal transfer protein TraD; Provisional
Probab=32.18  E-value=32  Score=14.07  Aligned_cols=19  Identities=21%  Similarity=0.656  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999962
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRI   25 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~   25 (173)
                      ||+++.|.++++++.|+++
T Consensus        31 ~~~~i~f~i~~~l~~~~~l   49 (732)
T PRK13700         31 YCLFIFFWILVGLVLWVKI   49 (732)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999999983


No 171
>pfam03245 Phage_lysis Bacteriophage lysis protein. This protein is involved in host lysis. This family is not considered to be a peptidase according to the MEROPs database.
Probab=31.90  E-value=32  Score=14.04  Aligned_cols=30  Identities=3%  Similarity=0.020  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999
Q gi|254781085|r   49 RLREKSENILMQYKEKHSKVEEETREIILA   78 (173)
Q Consensus        49 ~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~   78 (173)
                      .......++-..|.+.|.+++.+...+...
T Consensus        54 ~r~r~la~LD~k~tkEL~~Ak~e~d~Lr~d   83 (151)
T pfam03245        54 TRQRDLAALDAKHTKELADAKAENDRLRAD   83 (151)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999789999999889779999999


No 172
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional
Probab=31.86  E-value=32  Score=14.04  Aligned_cols=72  Identities=17%  Similarity=0.309  Sum_probs=43.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999622889999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   20 VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQIS   98 (173)
Q Consensus        20 l~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~   98 (173)
                      ++||  +..+..-|+.-+.+..+-.+.-+..+++-..+..+.+.-+.....|..+..     .|+..+.....+.++++
T Consensus        69 ~~yf--~~~~v~~le~sr~~l~~~v~~l~~~r~~d~~ln~~l~~ni~~ln~ei~~r~-----~a~~~~~~~~~~l~~e~  140 (779)
T PRK11091         69 AVYF--LSVVVEQLEESRQRLSRLVQKLEEMRERDLELNVQLKDNIAQLNQEIAERE-----KAEEARQEAFEDLKNEI  140 (779)
T ss_pred             HHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHH
T ss_conf             9999--999999999999999999999999888788888888877888667888888-----88999999999999999


No 173
>PRK01100 putative accessory gene regulator protein; Provisional
Probab=31.65  E-value=33  Score=14.02  Aligned_cols=25  Identities=12%  Similarity=0.467  Sum_probs=13.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999999999999622
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIP   26 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~   26 (173)
                      +++..+|+.+..+++..++++++.|
T Consensus       105 ~i~~n~~i~~i~f~i~~~~l~~YAP  129 (207)
T PRK01100        105 NIPSNNYMVLGTFAFILLLLFLYAP  129 (207)
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8256799999999999999986287


No 174
>PRK09470 cpxA two-component sensor protein; Provisional
Probab=30.87  E-value=34  Score=13.94  Aligned_cols=19  Identities=5%  Similarity=0.083  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999962288999999999
Q gi|254781085|r   18 VIVVYLRIPSILLSFLDAHA   37 (173)
Q Consensus        18 ~il~~~~~~~~i~~~l~~R~   37 (173)
                      +++.|. +-+||.+.-..-+
T Consensus       184 ~~la~~-l~rPl~~L~~aa~  202 (461)
T PRK09470        184 LWLAWS-LAKPARKLKNAAD  202 (461)
T ss_pred             HHHHHH-HHHHHHHHHHHHH
T ss_conf             999999-9899999999999


No 175
>pfam05529 Bap31 B-cell receptor-associated protein 31-like. Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8. Bap31 is cleaved within its cytosolic domain, generating pro-apoptotic p20 Bap31.
Probab=30.49  E-value=34  Score=13.90  Aligned_cols=19  Identities=11%  Similarity=0.218  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999974004
Q gi|254781085|r  149 FEKTISSIQSCHQMDKNTT  167 (173)
Q Consensus       149 I~~~i~~l~~~~k~~~n~~  167 (173)
                      +.+.-++++..++.-+|..
T Consensus       170 l~~~~~d~ealKkQ~e~l~  188 (192)
T pfam05529       170 LEEKDKDLEALKKQAENLQ  188 (192)
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             9988877999999986316


No 176
>pfam02936 COX4 Cytochrome c oxidase subunit IV. Cytochrome c oxidase, a 13 sub-unit complex, EC:1.9.3.1 is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit IV. The Dictyostelium member of this family is called COX VI. The uncharacterized yeast protein YGL226W appears to be the yeast COX IV subunit.
Probab=30.40  E-value=29  Score=14.34  Aligned_cols=27  Identities=11%  Similarity=-0.016  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999996228899999999
Q gi|254781085|r   10 FMSLIIFLVIVVYLRIPSILLSFLDAH   36 (173)
Q Consensus        10 ~i~f~il~~il~~~~~~~~i~~~l~~R   36 (173)
                      .++|.++++++.+.++++|+-..|++-
T Consensus        84 ~i~~s~~~~~~~r~~~~pp~P~T~~~E  110 (143)
T pfam02936        84 GLGISFGLFILMRTFAYPPLPKTMNKE  110 (143)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHH
T ss_conf             999999999999996479999886999


No 177
>KOG4075 consensus
Probab=30.15  E-value=35  Score=13.87  Aligned_cols=30  Identities=17%  Similarity=0.254  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999622889999999999
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSILLSFLDAHAD   38 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i~~~l~~R~~   38 (173)
                      +++.|.++++++...++++|+-..|++-..
T Consensus       108 ~f~Gl~~~v~l~~~v~vy~~~P~Tf~~Ewq  137 (167)
T KOG4075         108 FFLGLTISVILFGKVRVYGPLPKTFNKEWQ  137 (167)
T ss_pred             HHHHHHHHHHHHHHHEECCCCCCCHHHHHH
T ss_conf             999999999998764046889932418999


No 178
>KOG2911 consensus
Probab=29.79  E-value=35  Score=13.83  Aligned_cols=129  Identities=12%  Similarity=0.129  Sum_probs=59.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   39 KIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR  118 (173)
Q Consensus        39 ~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~  118 (173)
                      .+...+...........+.....++++.....++..-+.+.++.......+...-+.+..++.... ..+++....+.-.
T Consensus       230 ~~D~~V~~L~~~~~~L~kqie~L~qeie~~~~~~r~~~k~g~K~iA~~ylr~rk~~eK~~er~~~~-l~~l~~vl~~Id~  308 (439)
T KOG2911         230 EIDGSVADLIQARAKLAKQIEFLEQEIEKSKEKLRQALKEGKKQIAITYLRARKLLEKDLERKVSS-LNNLETVLSQIDN  308 (439)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHH
T ss_conf             001459999999999999999999999997999999997062688999999998877659999999-9999999998876


Q ss_pred             HHHH----HHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999----99999999999999943399999999999999999999997400443127
Q gi|254781085|r  119 LLYA----KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGS  172 (173)
Q Consensus       119 ~l~~----~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~~~~k~~~n~~~~~~~  172 (173)
                      .-.+    ++......+...+++.-...+.    ++..++++.++...-+-.+++|+|
T Consensus       309 s~~nkvvl~AyksGs~alK~il~~~~s~ek----Ved~Ldev~et~d~~~EV~~~la~  362 (439)
T KOG2911         309 SQTNKVVLQAYKSGSEALKAILAQGGSTEK----VEDVLDEVNETLDRQEEVEDALAS  362 (439)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHCCCCHHH----HHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             211089999999769999999852687045----999999999988659999999845


No 179
>KOG4686 consensus
Probab=29.40  E-value=36  Score=13.79  Aligned_cols=34  Identities=12%  Similarity=0.333  Sum_probs=18.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97989999999999999999996228899999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAH   36 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R   36 (173)
                      +|-|+||+++.....|.+ .++++..-=..++.+|
T Consensus       261 ~f~ppfw~~~iicv~yyv-a~fPFi~lg~~fF~~r  294 (459)
T KOG4686         261 TFYPPFWVLVIICVLYYV-AWFPFITLGPMFFQKR  294 (459)
T ss_pred             CCCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHH
T ss_conf             567639999999999999-9877764237777876


No 180
>TIGR01932 hflC HflC protein; InterPro: IPR010200   HflK and HflC are paralogs encoded by tandem genes in proteobacteria, spirochetes, and some other bacterial lineages. The HflKC complex is anchored in the membrane and exposed to the periplasm. The complex is not active as a protease, but rather binds to and appears to modulate the ATP-dependent protease FtsH. ; GO: 0005515 protein binding, 0008233 peptidase activity, 0016021 integral to membrane.
Probab=28.98  E-value=36  Score=13.75  Aligned_cols=45  Identities=13%  Similarity=0.104  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999
Q gi|254781085|r   68 VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYM  112 (173)
Q Consensus        68 a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~  112 (173)
                      ..+|.+.+-..-+..++...++++..++.|+-+++.+|..+....
T Consensus       243 m~~ER~~iA~~~RS~G~~~aee~~~~~~~Ev~~iLseA~~~A~~i  287 (345)
T TIGR01932       243 MRSEREQIARKHRSQGEEKAEELRGKADYEVLKILSEAKRTARII  287 (345)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999984436668899998525277887889988735343


No 181
>PRK10747 putative protoheme IX biogenesis protein; Provisional
Probab=28.75  E-value=37  Score=13.73  Aligned_cols=22  Identities=9%  Similarity=0.388  Sum_probs=13.1

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9798999999999999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         2 ~~d~tfw~~i~f~il~~il~~~   23 (173)
                      +|+.++|+++.+++++++++|.
T Consensus        36 ~iEtSl~~~~i~~v~~~~~l~~   57 (398)
T PRK10747         36 NIETSVTGLAIILILAMVVLFA   57 (398)
T ss_pred             EEEEHHHHHHHHHHHHHHHHHH
T ss_conf             6781199999999999999999


No 182
>COG4023 SBH1 Preprotein translocase subunit Sec61beta [Intracellular trafficking and secretion]
Probab=28.59  E-value=37  Score=13.71  Aligned_cols=25  Identities=24%  Similarity=0.483  Sum_probs=16.1

Q ss_pred             CCCHHHHHHHHHHHH-HHHHHHHHHH
Q ss_conf             979899999999999-9999999622
Q gi|254781085|r    2 HFDETFLVFMSLIIF-LVIVVYLRIP   26 (173)
Q Consensus         2 ~~d~tfw~~i~f~il-~~il~~~~~~   26 (173)
                      -+||+..|.+++++- ++++..+|+|
T Consensus        31 kidP~~vV~~~~av~~lvi~a~~f~p   56 (57)
T COG4023          31 KIDPRLVVYAGIAVAILVIAAHIFAP   56 (57)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             42841367899999999999986269


No 183
>CHL00094 dnaK heat shock protein 70
Probab=28.49  E-value=37  Score=13.70  Aligned_cols=92  Identities=11%  Similarity=0.136  Sum_probs=40.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   39 KIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR  118 (173)
Q Consensus        39 ~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~  118 (173)
                      .|..-+.+|+...+     .....+...+++.+++.++-+++..........-.+-+..++..+..++.-+.....+..+
T Consensus       506 ei~~~~~ea~~~~~-----~D~~~~~~~e~kn~~e~~i~~~~~~l~~~~~~~~~~ek~~i~~~l~~~~~~l~~~~~~~~~  580 (622)
T CHL00094        506 EVERMVKEAEKNAA-----EDKEKRENIDLKNQAESLCYQSEKQLKEFEDKIDEEKKQKIENLIEKLREALSKDNYEEIK  580 (622)
T ss_pred             HHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHH
T ss_conf             99999999998899-----8999999899888999999999999997355099999999999999999987548999999


Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999
Q gi|254781085|r  119 LLYAKIADFSVEIVREI  135 (173)
Q Consensus       119 ~l~~~~~~la~~~~~ki  135 (173)
                      .-.....+.+..+.+++
T Consensus       581 ~~~~~l~~~~~~~~~~~  597 (622)
T CHL00094        581 ELSEELQTALMEIGKQV  597 (622)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999


No 184
>PRK04778 septation ring formation regulator EzrA; Provisional
Probab=28.20  E-value=38  Score=13.67  Aligned_cols=85  Identities=12%  Similarity=0.172  Sum_probs=40.6

Q ss_pred             HHHHHHHHHHHHH-----HHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999-----9999999999------9999999999999999999999999999999999999999999999
Q gi|254781085|r   29 LLSFLDAHADKIR-----DDIFEARRLR------EKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQI   97 (173)
Q Consensus        29 i~~~l~~R~~~I~-----~~l~~A~~~~------~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~   97 (173)
                      -..-|+.|...|.     .+|..+..+.      ..-+.....|.......-......+.+|...+..-.-..-...-..
T Consensus        30 ~I~~Le~rK~~l~~~pv~~el~kvk~L~l~Get~~~fe~w~~~w~ei~~~~l~~iee~l~~ae~~~~~~rf~kak~~l~~  109 (569)
T PRK04778         30 RIDELEERKQELEDLPVNEELEKVKKLNLTGQSETKFEEWRQDWDEIVTNSFPDIEELLFEAEDLNDKFRFFKAKHEINE  109 (569)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             99999999999876987999998880867706599999999899999884235699999999999872528999999999


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999
Q gi|254781085|r   98 SALYLKDLEQKIHYMK  113 (173)
Q Consensus        98 ~~~~~~~a~~~I~~~~  113 (173)
                      ++..+..++.++....
T Consensus       110 ~~~~l~~~e~~i~~i~  125 (569)
T PRK04778        110 IESLLDEIEEDIEQIL  125 (569)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 185
>pfam05297 Herpes_LMP1 Herpesvirus latent membrane protein 1 (LMP1). This family consists of several latent membrane protein 1 or LMP1s mostly from Epstein-Barr virus. LMP1 of EBV is a 62-65 kDa plasma membrane protein possessing six membrane spanning regions, a short cytoplasmic N-terminus and a long cytoplasmic carboxy tail of 200 amino acids. EBV latent membrane protein 1 (LMP1) is essential for EBV-mediated transformation and has been associated with several cases of malignancies. EBV-like viruses in Cynomolgus monkeys (Macaca fascicularis) have been associated with high lymphoma rates in immunosuppressed monkeys.
Probab=27.84  E-value=38  Score=13.63  Aligned_cols=14  Identities=7%  Similarity=0.306  Sum_probs=7.5

Q ss_pred             CHHHHHHHHHHHHH
Q ss_conf             98999999999999
Q gi|254781085|r    4 DETFLVFMSLIIFL   17 (173)
Q Consensus         4 d~tfw~~i~f~il~   17 (173)
                      .++||.++.|++-|
T Consensus       134 GAs~WtlLAF~LAF  147 (382)
T pfam05297       134 GATIWQLLAFFLAF  147 (382)
T ss_pred             CHHHHHHHHHHHHH
T ss_conf             63899999999999


No 186
>pfam01920 Prefoldin_2 Prefoldin subunit. This family includes prefoldin subunits that are not detected by pfam02996.
Probab=27.12  E-value=39  Score=13.55  Aligned_cols=13  Identities=15%  Similarity=0.432  Sum_probs=4.0

Q ss_pred             HHHHHHHHHHHHH
Q ss_conf             9999999999999
Q gi|254781085|r   33 LDAHADKIRDDIF   45 (173)
Q Consensus        33 l~~R~~~I~~~l~   45 (173)
                      ++.|.+.|...+.
T Consensus        67 L~~~~e~i~~~i~   79 (104)
T pfam01920        67 LEERKETLEKEIK   79 (104)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 187
>pfam05439 JTB Jumping translocation breakpoint protein (JTB). This family contains several jumping translocation breakpoint proteins or JTBs. Jumping translocation (JT) is an unbalanced translocation that comprises amplified chromosomal segments jumping to various telomeres. JTB, located at 1q21, has been found to fuse with the telomeric repeats of acceptor telomeres in a case of JT. hJTB (human JTB) encodes a trans-membrane protein that is highly conserved among divergent eukaryotic species. JT results in a hJTB truncation, which potentially produces an hJTB product devoid of the trans-membrane domain. hJTB is located in a gene-rich region at 1q21, called EDC (Epidermal Differentiation Complex). JTB has also been implicated in prostatic carcinomas.
Probab=27.09  E-value=39  Score=13.55  Aligned_cols=31  Identities=26%  Similarity=0.321  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999962288999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHA   37 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~   37 (173)
                      .||.+-++.++++++.+..++ .=.+.||.|.
T Consensus        76 ~FW~Feg~~~~i~~~s~~~v~-~Rqr~Ldrra  106 (114)
T pfam05439        76 LFWKFEVVVVAIALVSALLVI-IRQRQLDRKA  106 (114)
T ss_pred             HEEEEEHHHHHHHHHHHHHHH-HHHHHHHHHH
T ss_conf             001232999999999999999-9999987999


No 188
>COG3149 PulM Type II secretory pathway, component PulM [Intracellular trafficking and secretion]
Probab=26.92  E-value=40  Score=13.53  Aligned_cols=36  Identities=19%  Similarity=0.209  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999962288999999999999999999999999999999
Q gi|254781085|r   19 IVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL   58 (173)
Q Consensus        19 il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~   58 (173)
                      .++|..+|.|..    +|.+.++..|.+-.......++..
T Consensus        49 vi~Y~~~WqP~~----erie~~q~~L~~lra~~a~v~~~a   84 (181)
T COG3149          49 VILYLLIWQPLS----ERIEQAQAYLQELRALLAYVQQQA   84 (181)
T ss_pred             HHHHHHHHCCHH----HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999836388----889999999999999999998655


No 189
>pfam09911 DUF2140 Uncharacterized protein conserved in bacteria (DUF2140). This domain, found in various hypothetical prokaryotic proteins, has no known function.
Probab=26.86  E-value=17  Score=15.61  Aligned_cols=25  Identities=24%  Similarity=0.460  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999999999999622889
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYLRIPSIL   29 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~~~~~~i   29 (173)
                      |.||+++++.+.+++++...++.|.
T Consensus         5 waF~~Llal~l~~~~~i~~~~~~p~   29 (187)
T pfam09911         5 WAFFVLLALNLASIAVVFFRLFAPV   29 (187)
T ss_pred             HHHHHHHHHHHHHHHEEEEEEECCC
T ss_conf             9999999999999712678997477


No 190
>PRK13386 fliH flagellar assembly protein H; Provisional
Probab=26.43  E-value=41  Score=13.48  Aligned_cols=55  Identities=15%  Similarity=0.264  Sum_probs=37.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999433--99999999999999999
Q gi|254781085|r  103 KDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM--NDDVNSSIFEKTISSIQ  157 (173)
Q Consensus       103 ~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l--~~~~~~~~I~~~i~~l~  157 (173)
                      .........--......+++.+.+|+..+++.++...+  ++...-.+|..+|..+.
T Consensus       103 ~~L~~~l~~~l~~~~~~~~~~Ll~La~~vArqVir~El~~~P~~IL~~vreaL~~LP  159 (236)
T PRK13386        103 GALRQQLERYLAEYEQQQRDELLDLVEKVARQVIRCELTLQPQQILALVEETLAALP  159 (236)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCC
T ss_conf             999999999999999999999999999999999746502598999999999998476


No 191
>pfam05933 Fun_ATP-synt_8 Fungal ATP synthase protein 8 (A6L). This family consists of fungus specific ATP synthase protein 8 (EC:3.6.3.14). The family may be related to the ATP synthase protein 8 found in other eukaryotes pfam00895.
Probab=26.36  E-value=41  Score=13.47  Aligned_cols=34  Identities=12%  Similarity=0.319  Sum_probs=21.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79899999999999999999962288999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHA   37 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~   37 (173)
                      +|...|..+.+.+++.++.++++|. +.+..-.|.
T Consensus        10 ~N~i~~~f~~~~il~y~~SkyiLP~-~~rl~vsR~   43 (47)
T pfam05933        10 INQIVFTFAIISILLYLFSKYILPR-IVRLYVSRL   43 (47)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH
T ss_conf             3058899999999999999987899-999999998


No 192
>pfam06160 EzrA Septation ring formation regulator, EzrA. During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation.
Probab=26.31  E-value=41  Score=13.47  Aligned_cols=85  Identities=11%  Similarity=0.183  Sum_probs=38.8

Q ss_pred             HHHHHHHHHHHHHH-----HHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999-----999999999------9999999999999999999999999999999999999999999999
Q gi|254781085|r   28 ILLSFLDAHADKIR-----DDIFEARRL------REKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ   96 (173)
Q Consensus        28 ~i~~~l~~R~~~I~-----~~l~~A~~~------~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~   96 (173)
                      .-..-|+.|...|.     .+|..+...      ...-+.....|.......-......+.+|...+..-.-..-...-.
T Consensus        25 k~I~~Le~rk~~l~~~pv~~el~kvk~L~l~Ges~~~f~~w~~~w~ei~~~~l~~ie~~l~~ae~~~~~~rf~ka~~~i~  104 (559)
T pfam06160        25 KQIDELEERKEELMNLPVNEELSKVKKLNLTGESEETFEEWRQKWDDIVTNSLPDIEELLFEAEELNDKFRFLKAKKAIK  104 (559)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH
T ss_conf             99999999999987498899999988298970569999999999999988622569999999999986062899999999


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999
Q gi|254781085|r   97 ISALYLKDLEQKIHYM  112 (173)
Q Consensus        97 ~~~~~~~~a~~~I~~~  112 (173)
                      .++..+..++.++...
T Consensus       105 ~~~~~i~~~e~~i~~i  120 (559)
T pfam06160       105 EIEELLDTIEEDIEQI  120 (559)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999999


No 193
>COG0233 Frr Ribosome recycling factor [Translation, ribosomal structure and biogenesis]
Probab=25.85  E-value=42  Score=13.42  Aligned_cols=74  Identities=16%  Similarity=0.112  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   34 DAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQK  108 (173)
Q Consensus        34 ~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~  108 (173)
                      +.|++-+..--..++..+-..-.+..+....+....+... |-.+....++...+...++.-..++......+++
T Consensus       110 ErRkelvK~~k~~~EeakvaiRniRrda~d~iKK~~K~~~-isEDe~k~~e~~iQKlTd~yi~~iD~~~~~KEkE  183 (187)
T COG0233         110 ERRKELVKVAKKYAEEAKVAVRNIRRDANDKIKKLEKDKE-ISEDEVKKAEEEIQKLTDEYIKKIDELLKDKEKE  183 (187)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999998899999999999999999998752587-6567888899999999999999999999999988


No 194
>TIGR00890 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741   Oxalate/formate antiporters and many, as yet, uncharacterised proteins belong to this group.; GO: 0005215 transporter activity, 0006810 transport, 0016021 integral to membrane.
Probab=25.61  E-value=42  Score=13.39  Aligned_cols=33  Identities=21%  Similarity=0.145  Sum_probs=16.7

Q ss_pred             CCCCHHHHHH-HHHHHHHHHHHHH-HHHHHHHHHH
Q ss_conf             9979899999-9999999999999-6228899999
Q gi|254781085|r    1 MHFDETFLVF-MSLIIFLVIVVYL-RIPSILLSFL   33 (173)
Q Consensus         1 m~~d~tfw~~-i~f~il~~il~~~-~~~~~i~~~l   33 (173)
                      |--+|+||++ +.|+..-+...+. ....|..+.|
T Consensus       238 ~lr~~~fWvL~~~f~~~a~~~L~~~g~~~~yg~~L  272 (429)
T TIGR00890       238 MLRTPQFWVLYVSFFLAAVSGLLLIGLLKPYGRSL  272 (429)
T ss_pred             HHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             64233699999999998889999999999988888


No 195
>PTZ00227 variable surface protein Vir14; Provisional
Probab=25.48  E-value=42  Score=13.38  Aligned_cols=38  Identities=18%  Similarity=0.232  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999996228899999999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIF   45 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~   45 (173)
                      |+...++.-+++++-| |+  +.|+++.+-.-+.+++..+.
T Consensus       329 pp~l~i~g~~li~~a~-yk--ftp~gk~~~~trakvrkrir  366 (418)
T PTZ00227        329 PPLLGIVGVLLILWAL-YK--FTPLGKSFKHTRAKVRKRIR  366 (418)
T ss_pred             CHHHHHHHHHHHHHHH-HH--CCCCHHHHHHHHHHHHHHHC
T ss_conf             1388898999999998-70--58401577877999998737


No 196
>pfam10183 ESSS ESSS subunit of NADH:ubiquinone oxidoreductase (complex I). This subunit is part of the mitochondrial NADH:ubiquinone oxidoreductase (complex I). It carries mitochondrial import sequences.
Probab=25.36  E-value=30  Score=14.22  Aligned_cols=36  Identities=8%  Similarity=0.183  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999999999962288999999999999
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKI   40 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I   40 (173)
                      .+|+..++++++++.+++.++|.+-..--..|...+
T Consensus        87 ~~fF~~iTi~lv~g~~~~~YlPD~~~r~Wa~REA~l  122 (151)
T pfam10183        87 AAFFFLFTLCLVWGTTFIAYLPDYGMREWARREAEL  122 (151)
T ss_pred             HHHHHHHHHHHHHHHHEEEECCCCCHHHHHHHHHHH
T ss_conf             056435678873244158876895354799999999


No 197
>TIGR01495 ETRAMP early transcribed membrane protein (ETRAMP) family; InterPro: IPR006389   These sequences represent a family of proteins from the malaria parasite Plasmodium falciparum, several of which have been shown to be expressed specifically in the ring stage as well as the rodent parasite Plasmodium yoelii . A homolog from Plasmodium chabaudi was localized to the parasitophorous vacuole membrane . Members have an initial hydrophobic, Phe/Tyr-rich stretch long enough to span the membrane, a highly charged region rich in Lys, a second putative transmembrane region, and a second highly charged, low complexity sequence region. Some members have up to 100 residues of additional C-terminal sequence. These genes have been shown to be found in the sub-telomeric regions of both Plasmodium falciparum and P. yoelii chromosomes..
Probab=25.00  E-value=39  Score=13.60  Aligned_cols=41  Identities=10%  Similarity=0.098  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH---HHHHHHHHH--------HHHHHHHHHHH
Q ss_conf             999999999999962288999---999999999--------99999999999
Q gi|254781085|r   11 MSLIIFLVIVVYLRIPSILLS---FLDAHADKI--------RDDIFEARRLR   51 (173)
Q Consensus        11 i~f~il~~il~~~~~~~~i~~---~l~~R~~~I--------~~~l~~A~~~~   51 (173)
                      |.||+++++.+.++.|.....   ...+|...+        -..|+.++..+
T Consensus         6 ilyf~~~l~~~n~i~P~~~~~nv~G~~~~~~~~aeekkrkn~kkl~~~~~~K   57 (99)
T TIGR01495         6 ILYFFAALLAINFIAPGYCNNNVAGKVEKKGKIAEEKKRKNLKKLTKAEKKK   57 (99)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHCCHHCCCCCCHHHHHHHHHCCCCHHHHHH
T ss_conf             9999999999998703001211012001478602455541002421899987


No 198
>PRK01919 tatB sec-independent translocase; Provisional
Probab=24.55  E-value=44  Score=13.27  Aligned_cols=15  Identities=7%  Similarity=-0.020  Sum_probs=9.1

Q ss_pred             CCCHHHHHHHHHHHH
Q ss_conf             979899999999999
Q gi|254781085|r    2 HFDETFLVFMSLIIF   16 (173)
Q Consensus         2 ~~d~tfw~~i~f~il   16 (173)
                      +||.-||=++.++++
T Consensus         1 MfDiGf~El~lI~vV   15 (169)
T PRK01919          1 MIDLGLSKMALIGVV   15 (169)
T ss_pred             CCCCCHHHHHHHHHH
T ss_conf             987339999999999


No 199
>KOG2262 consensus
Probab=24.53  E-value=44  Score=13.27  Aligned_cols=17  Identities=18%  Similarity=0.641  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         7 fw~~i~f~il~~il~~~   23 (173)
                      ||...|.++-++++.|.
T Consensus       314 ~~a~~n~~~gfvl~~~I  330 (761)
T KOG2262         314 FFAIANVFLGFVLFIYI  330 (761)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             99999886554200343


No 200
>pfam10831 DUF2556 Protein of unknown function (DUF2556). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae.
Probab=23.93  E-value=45  Score=13.20  Aligned_cols=18  Identities=6%  Similarity=0.181  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999
Q gi|254781085|r    6 TFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         6 tfw~~i~f~il~~il~~~   23 (173)
                      -.|+++.|.++++++--+
T Consensus         4 kywwlvvfav~vflfdal   21 (53)
T pfam10831         4 KYWWLVVFAVSVFLFDAL   21 (53)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             333589999999999999


No 201
>COG1766 fliF Flagellar basal body M-ring protein [Cell motility and secretion]
Probab=23.79  E-value=46  Score=13.19  Aligned_cols=27  Identities=11%  Similarity=0.303  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999622889999999999
Q gi|254781085|r   11 MSLIIFLVIVVYLRIPSILLSFLDAHAD   38 (173)
Q Consensus        11 i~f~il~~il~~~~~~~~i~~~l~~R~~   38 (173)
                      +.+.++.++++|+ +++|+..-+..|..
T Consensus       448 ~~~~l~~~lv~~~-~~r~~i~~~~~~~~  474 (545)
T COG1766         448 VALYLVVFLVLFI-IVRPVIRPRRRRGA  474 (545)
T ss_pred             HHHHHHHHHHHHH-HHHHHHHHHHCCCC
T ss_conf             9999999999999-99999998751552


No 202
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=23.79  E-value=46  Score=13.19  Aligned_cols=40  Identities=8%  Similarity=0.131  Sum_probs=19.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH------------------HHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999622889------------------9999999999999999999
Q gi|254781085|r    9 VFMSLIIFLVIVVYLRIPSIL------------------LSFLDAHADKIRDDIFEAR   48 (173)
Q Consensus         9 ~~i~f~il~~il~~~~~~~~i------------------~~~l~~R~~~I~~~l~~A~   48 (173)
                      .++..+|||++|+|-.++..+                  .+...+.+++|+..-..+.
T Consensus        18 Sv~LHiiLi~lLIwgS~~~~~e~~ggG~gG~~I~AVmVDpgaV~qqy~r~qqQk~~ak   75 (402)
T PRK09510         18 SAVLHIILFALLIWSSFDENVEASGGGGGGSVIDAVMVDPGAVVEQYNRQQQQQKSAK   75 (402)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999999800111321468999877323788780899999999998776664


No 203
>pfam10857 DUF2701 Protein of unknown function (DUF2701). This viral family of proteins has no known function.
Probab=23.60  E-value=46  Score=13.16  Aligned_cols=27  Identities=19%  Similarity=0.183  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999962288999999999999999
Q gi|254781085|r   17 LVIVVYLRIPSILLSFLDAHADKIRDD   43 (173)
Q Consensus        17 ~~il~~~~~~~~i~~~l~~R~~~I~~~   43 (173)
                      +++|+|+.-|..+.++++.-+-+|-+-
T Consensus        12 ~flLlyLvkws~v~d~~n~iK~kiin~   38 (63)
T pfam10857        12 VFLLLYLVKWSYVKDAFNDIKTKIINL   38 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999899999999999999878


No 204
>PRK13411 molecular chaperone DnaK; Provisional
Probab=23.56  E-value=46  Score=13.16  Aligned_cols=21  Identities=0%  Similarity=0.180  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999
Q gi|254781085|r   63 EKHSKVEEETREIILAAKHRA   83 (173)
Q Consensus        63 ~~l~~a~~ea~~i~~~a~~~a   83 (173)
                      +.+.+++.++..++-.++...
T Consensus       525 ~e~~e~~n~~e~~i~~~~~~l  545 (655)
T PRK13411        525 KQLVELKNQADSLLYSYESTL  545 (655)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
T ss_conf             999998989999999999998


No 205
>TIGR02978 phageshock_pspC phage shock protein C; InterPro: IPR014320   All members of this protein are the phage shock protein PspC. The phage shock regulon is restricted to the Proteobacteria and somewhat sparsely distributed there. It is expressed, under positive control of a sigma-54-dependent transcription factor; PspF, which binds and is modulated by PspA. Stresses that induce the psp regulon include phage secretin over expression, ethanol, heat shock and protein export defects..
Probab=23.23  E-value=47  Score=13.12  Aligned_cols=45  Identities=9%  Similarity=0.074  Sum_probs=31.7

Q ss_pred             HHHHHHHHHHH-------HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             28899999999-------9999999999-999999999999999999999999
Q gi|254781085|r   26 PSILLSFLDAH-------ADKIRDDIFE-ARRLREKSENILMQYKEKHSKVEE   70 (173)
Q Consensus        26 ~~~i~~~l~~R-------~~~I~~~l~~-A~~~~~~a~~~~~~~~~~l~~a~~   70 (173)
                      |+|....-+..       ..+-=+.-.. +..+..+.+..+...+.+|.+.+.
T Consensus        60 k~P~~~~~~~~~~~~~~vk~k~Wq~g~~~p~~~L~~~~~~~~~~e~RLr~mE~  112 (128)
T TIGR02978        60 KKPVNLYEDDDTSKEHEVKSKFWQAGQTSPKQALREVKRELRRLERRLRNMER  112 (128)
T ss_pred             CCCCCCCCCCHHHHCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             44633234530111011454100220578889999999999998889897685


No 206
>pfam09578 Spore_YabQ Spore cortex protein YabQ (Spore_YabQ). This protein is predicted to span the membrane several times. It is only found in genomes of species that perform sporulation, such as Bacillus subtilis, Clostridium tetani, and other members of the Firmicutes (low-GC Gram-positive bacteria). Mutation of this sigmaE-dependent gene blocks development of the spore cortex. The length of the C-terminal region, which includes some hydrophobic regions, is variable.
Probab=23.16  E-value=47  Score=13.11  Aligned_cols=18  Identities=28%  Similarity=0.558  Sum_probs=13.6

Q ss_pred             CCHHHHHHHHHHHHHHHH
Q ss_conf             798999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIV   20 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il   20 (173)
                      -|.-||+..+.++|+.++
T Consensus        35 eDilfWi~~~~~vF~~L~   52 (80)
T pfam09578        35 EDILFWLLAALIVFYFLL   52 (80)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999


No 207
>PRK09040 hypothetical protein; Provisional
Probab=22.84  E-value=48  Score=13.08  Aligned_cols=18  Identities=0%  Similarity=-0.125  Sum_probs=7.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999999999996
Q gi|254781085|r    5 ETFLVFMSLIIFLVIVVYLR   24 (173)
Q Consensus         5 ~tfw~~i~f~il~~il~~~~   24 (173)
                      ++.|+.  |.-+..+|+-||
T Consensus        13 ~P~W~t--faDLMTlLl~fF   30 (215)
T PRK09040         13 APVWAA--FGDLMSVLLGAF   30 (215)
T ss_pred             CCCHHH--HHHHHHHHHHHH
T ss_conf             970484--999999999999


No 208
>KOG0206 consensus
Probab=22.67  E-value=48  Score=13.06  Aligned_cols=10  Identities=20%  Similarity=0.368  Sum_probs=3.5

Q ss_pred             HHHHHHHHHH
Q ss_conf             8999999999
Q gi|254781085|r    5 ETFLVFMSLI   14 (173)
Q Consensus         5 ~tfw~~i~f~   14 (173)
                      ++||+.+.+.
T Consensus      1050 p~fWl~~ll~ 1059 (1151)
T KOG0206        1050 PSFWLTLLLT 1059 (1151)
T ss_pred             CHHHHHHHHH
T ss_conf             2577888999


No 209
>pfam09838 DUF2065 Uncharacterized protein conserved in bacteria (DUF2065). This domain, found in various prokaryotic proteins, has no known function.
Probab=22.61  E-value=48  Score=13.05  Aligned_cols=30  Identities=17%  Similarity=0.224  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999996228899999999
Q gi|254781085|r    7 FLVFMSLIIFLVIVVYLRIPSILLSFLDAH   36 (173)
Q Consensus         7 fw~~i~f~il~~il~~~~~~~~i~~~l~~R   36 (173)
                      ||..++.++++=.+.|+..|....+++.+=
T Consensus         1 ll~AlgLvLviEGl~~~l~P~~~r~~l~~l   30 (57)
T pfam09838         1 LLLALGLVLVIEGLLPFLAPSAWRRMLLQL   30 (57)
T ss_pred             CHHHHHHHHHHHHHHHHHCHHHHHHHHHHH
T ss_conf             999999999998668886999999999999


No 210
>PRK09458 pspB phage shock protein B; Provisional
Probab=22.28  E-value=49  Score=13.01  Aligned_cols=20  Identities=10%  Similarity=0.190  Sum_probs=10.1

Q ss_pred             CCCCHHHHHHHHHHHHHHHH
Q ss_conf             99798999999999999999
Q gi|254781085|r    1 MHFDETFLVFMSLIIFLVIV   20 (173)
Q Consensus         1 m~~d~tfw~~i~f~il~~il   20 (173)
                      |....-|..++.|++|++-+
T Consensus         1 m~~~fl~vP~iiF~~fVaPi   20 (75)
T PRK09458          1 MSALFLAIPLIIFVLFVAPI   20 (75)
T ss_pred             CCCEEEHHHHHHHHHHHHHH
T ss_conf             96054328199999999999


No 211
>pfam10112 Halogen_Hydrol 5-bromo-4-chloroindolyl phosphate hydrolysis protein. Members of this family of prokaryotic proteins mediate the hydrolysis of 5-bromo-4-chloroindolyl phosphate bonds.
Probab=22.24  E-value=49  Score=13.00  Aligned_cols=21  Identities=29%  Similarity=0.319  Sum_probs=9.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHH
Q ss_conf             798999999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYL   23 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~   23 (173)
                      +|.+||+.+..++..+++.|+
T Consensus        29 ~~~~f~~~~lig~~~~~~~~~   49 (199)
T pfam10112        29 LDQSFLLSLLIGAGAGWVVYA   49 (199)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
T ss_conf             274899999999999999999


No 212
>PRK11466 hybrid sensory histidine kinase TorS; Provisional
Probab=22.02  E-value=50  Score=12.98  Aligned_cols=36  Identities=11%  Similarity=0.317  Sum_probs=20.3

Q ss_pred             HHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999--99999999999996228899999999999999
Q gi|254781085|r    6 TFLVF--MSLIIFLVIVVYLRIPSILLSFLDAHADKIRD   42 (173)
Q Consensus         6 tfw~~--i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~   42 (173)
                      ++|++  +.+++++ +++|+++|+-|..=|++....+..
T Consensus       332 ~l~~~~~l~l~~~~-~v~w~vvy~~i~~rL~~~t~al~~  369 (912)
T PRK11466        332 SLLLLGIVSLCALI-LILWRVVYRSVTRPLAEQTQALQR  369 (912)
T ss_pred             HHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999-999999999999999999999999


No 213
>KOG4304 consensus
Probab=21.89  E-value=50  Score=12.96  Aligned_cols=57  Identities=14%  Similarity=0.132  Sum_probs=33.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9962288999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   22 YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKI   85 (173)
Q Consensus        22 ~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~~   85 (173)
                      |+.+.+||..  -.|+++|...|++-+.+--++.+...     ....+-|..+|+.-+..-.+.
T Consensus        31 ~rk~~Kpl~E--KkRRaRIN~~L~eLK~Li~e~~~~~~-----~~~sklEKAdILEltV~hL~~   87 (250)
T KOG4304          31 YRKVRKPLLE--KKRRARINRCLDELKDLIPEALKKDG-----QRHSKLEKADILELTVNHLRQ   87 (250)
T ss_pred             HHHHCCHHHH--HHHHHHHHHHHHHHHHHHHHHHHHCC-----HHHHHHHHHHHHHHHHHHHHH
T ss_conf             7663121688--89999999999999999999985320-----011013789999999999999


No 214
>TIGR02302 aProt_lowcomp conserved hypothetical protein TIGR02302; InterPro: IPR012683    Members of this family are bacterial proteins from the alphaproteobacteria. Each has 2-3 predicted transmembrane helices near the N-terminus and a long C-terminal region that includes stretches of Gln/Gly-rich low complexity sequence, predicted to be outside the membrane. Bradyrhizobium japonicum contains two tandem copies that are, together, homologous to the single members found in other species. .
Probab=21.79  E-value=48  Score=13.04  Aligned_cols=117  Identities=11%  Similarity=0.072  Sum_probs=58.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------------HHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999999999999999999999999-----------------------99999999999999
Q gi|254781085|r   42 DDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAK-----------------------ILAEEGCQNIEQIS   98 (173)
Q Consensus        42 ~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~a~-----------------------~~~e~~~~~a~~~~   98 (173)
                      +++..|+...-.|++.+...=++ ..+..|+..+..+.+.-.+                       +.+--...+.++.+
T Consensus       526 GdlS~AerrLR~AQ~AL~dALer-gASdeEI~~Ltd~LR~Amq~ymr~lAqq~~~NP~~~a~p~dpN~~vlrqqDL~~M~  604 (899)
T TIGR02302       526 GDLSAAERRLRDAQDALKDALER-GASDEEIKKLTDELRKAMQEYMRELAQQLRKNPAALARPEDPNAKVLRQQDLQKMM  604 (899)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             76417999999999999999743-88888999999999999999999999998605597718888735664688899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH---HHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999943399---9999999999999999999
Q gi|254781085|r   99 ALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMND---DVNSSIFEKTISSIQSCHQ  161 (173)
Q Consensus        99 ~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~---~~~~~~I~~~i~~l~~~~k  161 (173)
                      +.+..-++.=-...-.+.+.+|.....+|-+.=+  -.+...+.   .-+..-+...+++|++.-.
T Consensus       605 dqiEnLaRsG~rdqA~QlLsqLq~mmnNLQmgQ~--~~gQ~~G~GkGqGQ~g~~~qqmnkLGel~r  668 (899)
T TIGR02302       605 DQIENLARSGDRDQAKQLLSQLQRMMNNLQMGQA--RQGQQNGDGKGQGQSGDMEQQMNKLGELMR  668 (899)
T ss_pred             HHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH--HHCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9999750678878999999999999998864100--101336776677743589999988889999


No 215
>TIGR00895 2A0115 MFS transporter, aromatic acid:H+ symporter (AAHS) family; InterPro: IPR004746 Benzoate transport proteins belong to this group. Benzyl alcohol, benzaldehyde, benzoate, and anthranilate are metabolized via catechol, cis,cis-muconate, and the beta-ketoadipate pathway in some bacteria.; GO: 0005215 transporter activity, 0006810 transport, 0016021 integral to membrane.
Probab=20.89  E-value=52  Score=12.84  Aligned_cols=55  Identities=15%  Similarity=0.276  Sum_probs=34.1

Q ss_pred             CCCHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHH-HHHHHHHH
Q ss_conf             97989--99999999999999999622889999999--9999999999999-99999999
Q gi|254781085|r    2 HFDET--FLVFMSLIIFLVIVVYLRIPSILLSFLDA--HADKIRDDIFEAR-RLREKSEN   56 (173)
Q Consensus         2 ~~d~t--fw~~i~f~il~~il~~~~~~~~i~~~l~~--R~~~I~~~l~~A~-~~~~~a~~   56 (173)
                      +|+|.  ||+--.+-+++..++.+++|-|+.=...+  |.++|...+++-. +.+.+++.
T Consensus       172 ~~GWr~~F~vGG~~Pl~ll~~l~~~LPES~~fl~~kg~~~~~~~~~~n~I~p~~~~~~~~  231 (413)
T TIGR00895       172 AFGWRSLFYVGGIIPLLLLLLLMRFLPESIDFLVEKGKRPEKVRRIVNAIAPQLQAEAQS  231 (413)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCC
T ss_conf             440799999999999999999997768768989770887579999987754542257654


No 216
>cd00922 Cyt_c_Oxidase_IV Cytochrome c oxidase subunit IV. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit IV is the largest of the nuclear-encoded subunits. It binds ATP at the matrix side, leading to an allosteric inhibition of enzyme activity at high intramitochondrial ATP/ADP ratios. In mammals, subunit IV has a lung-specific isoform and a ubiquitously expressed isoform.
Probab=20.37  E-value=54  Score=12.77  Aligned_cols=25  Identities=0%  Similarity=-0.181  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999622889999999
Q gi|254781085|r   11 MSLIIFLVIVVYLRIPSILLSFLDA   35 (173)
Q Consensus        11 i~f~il~~il~~~~~~~~i~~~l~~   35 (173)
                      ++|.++++++.+.++++|.-..|++
T Consensus        85 i~~s~~~~~~~r~~~~~~~P~T~~~  109 (136)
T cd00922          85 IGITGVIFGLQRAFVYGPKPHTFTE  109 (136)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCH
T ss_conf             9999999999999727989988599


No 217
>pfam11694 DUF3290 Protein of unknown function (DUF3290). This family of proteins with unknown function appears to be restricted to Firmicutes.
Probab=20.36  E-value=54  Score=12.77  Aligned_cols=35  Identities=14%  Similarity=0.263  Sum_probs=15.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7989999999999999999996228899999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADK   39 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~   39 (173)
                      ++.+++.++.+++++++++..  +.-+..-++.|...
T Consensus        14 ~~~~~~~~i~~~~l~~li~~~--~~Y~r~r~~tKYRD   48 (149)
T pfam11694        14 TQNWLRYILIIILLVVIIIFA--FKYLRHKFDTKYRD   48 (149)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH--HHHHHHCCCCHHHH
T ss_conf             888999999999999999999--99998525532787


Done!