HHsearch alignment for GI: 254781085 and conserved domain: pfam05405

>pfam05405 Mt_ATP-synt_B Mitochondrial ATP synthase B chain precursor (ATP-synt_B). The Fo sector of the ATP synthase is a membrane bound complex which mediates proton transport. It is composed of nine different polypeptide subunits (a, b, c, d, e, f, g F6, A6L).
Probab=99.18  E-value=6.1e-08  Score=64.68  Aligned_cols=151  Identities=18%  Similarity=0.271  Sum_probs=104.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79899999999999999999962288999999999999999999999999999999999999999999999999999999
Q gi|254781085|r    3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR   82 (173)
Q Consensus         3 ~d~tfw~~i~f~il~~il~~~~~~~~i~~~l~~R~~~I~~~l~~A~~~~~~a~~~~~~~~~~l~~a~~ea~~i~~~a~~~   82 (173)
T Consensus        13 ~neE~~val~fi~f~~~~~K~-~G~~i~~~lD~~~e~i~~~l~~~r~~~~~a~~~~ie~~k~~~~~~~~~~~l~~~~ke~   91 (163)
T pfam05405        13 VNEETIVALCFIGFLIFVYKS-LGPSIKEWLDKRIEKIQDELNQSRNLHEKALKERIEYVKKLQSVVEETKVLFEVSKET   91 (163)
T ss_pred             ECCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             754499999999999999998-1088999999989999999998888789999999999999999999899999982467


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999999999999999999999999999999999999943399999999999999999
Q gi|254781085|r   83 AKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ  157 (173)
Q Consensus        83 a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~~~~~~la~~~~~kil~~~l~~~~~~~~I~~~i~~l~  157 (173)
T Consensus        92 ~al~~e~~~~~~~~~v~~evk~~Ld~~v~~e~~~r~~~Q~~~v~---~v~~~V~~~i~~~~~~k~~l~~~I~~l~  163 (163)
T pfam05405        92 VALEAEAFERELQAALAREIKSKLDTLVRKESSVRQREQDHLVN---WVISSVLKELSPPKFQKKSLQESIADLE  163 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHCCCCHHHHHHHHHHHHHHC
T ss_conf             99777999999999999999999999999998999999999999---9999999870791679999999988609