HHsearch alignment of GI: 254781085 and MMDB domain: 1l2p_A_

>1l2p_A (A:) ATP synthase B chain; alpha helix, hydrolase; 1.55A {Escherichia coli}
Probab=97.90  E-value=0.00014  Score=44.79  Aligned_cols=59  Identities=20%  Similarity=0.219  Sum_probs=56.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999999999999999999999999999999999999999
Q gi|254781085|r   63 EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY  121 (173)
Q Consensus        63 ~~l~~a~~ea~~i~~~a~~~a~~~~e~~~~~a~~~~~~~~~~a~~~I~~~~~~a~~~l~  121 (173)
                      +.|.+++.++..|+.+|+..+..+++++...+..+.++++..++.+|+.+...++.+||
T Consensus         2 e~L~eAk~eAa~Ii~~A~kra~qIveeak~~A~~Ea~rIi~~A~aeIe~Er~~a~~eLR   60 (61)
T 1l2p_A            2 DQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELR   60 (61)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             77799999999999999988999999999999999999999899999999999999750