BLAST/PSIBLAST alignment of GI: 254781085 and GI: 153007848 at iteration 1
>gi|153007848|ref|YP_001369063.1| F0F1 ATP synthase subunit B [Ochrobactrum anthropi ATCC 49188] Length = 159
>gi|226694417|sp|A6WW80|ATPF2_OCHA4 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase F(0) sector subunit b 2; AltName: Full=ATPase subunit I 2; AltName: Full=F-type ATPase subunit b 2; Short=F-ATPase subunit b 2 Length = 159
>gi|151559736|gb|ABS13234.1| ATP synthase F0, B subunit [Ochrobactrum anthropi ATCC 49188] Length = 159
 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V    +I++ K++  V  ++F+  +S ++S
Sbjct: 121 SAVDLAVAAAGKIVADKVDTKVAGNLFKDALSQVKS 156