BLAST/PSIBLAST alignment of GI: 254781085 and GI: 161511127 at iteration 1
>gi|161511127|ref|NP_540460.2| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M] Length = 159
>gi|163842669|ref|YP_001627073.1| F0F1 ATP synthase subunit B [Brucella suis ATCC 23445] Length = 159
>gi|225626900|ref|ZP_03784939.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo] Length = 159
>gi|225851925|ref|YP_002732158.1| F0F1 ATP synthase subunit B [Brucella melitensis ATCC 23457] Length = 159
>gi|254701197|ref|ZP_05163025.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513] Length = 159
>gi|254707878|ref|ZP_05169706.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10] Length = 159
>gi|254709538|ref|ZP_05171349.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94] Length = 159
>gi|254713045|ref|ZP_05174856.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1] Length = 159
>gi|254716602|ref|ZP_05178413.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1] Length = 159
>gi|254718569|ref|ZP_05180380.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13] Length = 159
>gi|256031032|ref|ZP_05444646.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1] Length = 159
>gi|256044107|ref|ZP_05447018.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1] Length = 159
>gi|256060524|ref|ZP_05450693.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33] Length = 159
>gi|256112905|ref|ZP_05453821.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether] Length = 159
>gi|256159090|ref|ZP_05456916.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1] Length = 159
>gi|256254435|ref|ZP_05459971.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94] Length = 159
>gi|256264563|ref|ZP_05467095.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str. 63/9] Length = 159
>gi|256368841|ref|YP_003106347.1| ATP synthase subunit B [Brucella microti CCM 4915] Length = 159
>gi|260168164|ref|ZP_05754975.1| F0F1 ATP synthase subunit B [Brucella sp. F5/99] Length = 159
>gi|260563466|ref|ZP_05833952.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str. 16M] Length = 159
>gi|261218401|ref|ZP_05932682.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1] Length = 159
>gi|261221603|ref|ZP_05935884.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94] Length = 159
>gi|261315369|ref|ZP_05954566.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10] Length = 159
>gi|261317064|ref|ZP_05956261.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94] Length = 159
>gi|261320750|ref|ZP_05959947.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1] Length = 159
>gi|261324518|ref|ZP_05963715.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33] Length = 159
>gi|261751734|ref|ZP_05995443.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513] Length = 159
>gi|261757622|ref|ZP_06001331.1| H+-transporting two-sector ATPase [Brucella sp. F5/99] Length = 159
>gi|265983544|ref|ZP_06096279.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13] Length = 159
>gi|265988102|ref|ZP_06100659.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1] Length = 159
>gi|265990519|ref|ZP_06103076.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1] Length = 159
>gi|265994347|ref|ZP_06106904.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether] Length = 159
>gi|265997567|ref|ZP_06110124.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1] Length = 159
>gi|294851768|ref|ZP_06792441.1| ATP synthase F0 [Brucella sp. NVSL 07-0026] Length = 159
>gi|306837306|ref|ZP_07470189.1| ATP synthase F0, B subunit [Brucella sp. NF 2653] Length = 159
>gi|226694369|sp|B0CK73|ATPF2_BRUSI RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase F(0) sector subunit b 2; AltName: Full=ATPase subunit I 2; AltName: Full=F-type ATPase subunit b 2; Short=F-ATPase subunit b 2 Length = 159
>gi|163673392|gb|ABY37503.1| ATP synthase F0, B subunit [Brucella suis ATCC 23445] Length = 159
>gi|225618557|gb|EEH15600.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo] Length = 159
>gi|225640290|gb|ACO00204.1| ATP synthase F0, B subunit [Brucella melitensis ATCC 23457] Length = 159
>gi|255998999|gb|ACU47398.1| ATP synthase subunit B [Brucella microti CCM 4915] Length = 159
>gi|260153482|gb|EEW88574.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str. 16M] Length = 159
>gi|260920187|gb|EEX86840.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94] Length = 159
>gi|260923490|gb|EEX90058.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1] Length = 159
>gi|261293440|gb|EEX96936.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1] Length = 159
>gi|261296287|gb|EEX99783.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94] Length = 159
>gi|261300498|gb|EEY03995.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33] Length = 159
>gi|261304395|gb|EEY07892.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10] Length = 159
>gi|261737606|gb|EEY25602.1| H+-transporting two-sector ATPase [Brucella sp. F5/99] Length = 159
>gi|261741487|gb|EEY29413.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513] Length = 159
>gi|262552035|gb|EEZ08025.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1] Length = 159
>gi|262765460|gb|EEZ11249.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether] Length = 159
>gi|263001303|gb|EEZ13878.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1] Length = 159
>gi|263094928|gb|EEZ18636.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str. 63/9] Length = 159
>gi|264660299|gb|EEZ30560.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1] Length = 159
>gi|264662136|gb|EEZ32397.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13] Length = 159
>gi|294820357|gb|EFG37356.1| ATP synthase F0 [Brucella sp. NVSL 07-0026] Length = 159
>gi|306407619|gb|EFM63815.1| ATP synthase F0, B subunit [Brucella sp. NF 2653] Length = 159
>gi|326408424|gb|ADZ65489.1| F0F1 ATP synthase subunit B [Brucella melitensis M28] Length = 159
>gi|326538138|gb|ADZ86353.1| ATP synthase F0, B subunit [Brucella melitensis M5-90] Length = 159
 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156