BLAST/PSIBLAST alignment of GI: 254781085 and GI: 62289375 at iteration 1
>gi|62289375|ref|YP_221168.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 1 str. 9-941] Length = 159
>gi|82699300|ref|YP_413874.1| F0F1 ATP synthase subunit B [Brucella melitensis biovar Abortus 2308] Length = 159
>gi|189023628|ref|YP_001934396.1| F0F1 ATP synthase subunit B [Brucella abortus S19] Length = 159
>gi|237814862|ref|ZP_04593860.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A] Length = 159
>gi|254688690|ref|ZP_05151944.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870] Length = 159
>gi|254693173|ref|ZP_05155001.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya] Length = 159
>gi|254696817|ref|ZP_05158645.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59] Length = 159
>gi|254729724|ref|ZP_05188302.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292] Length = 159
>gi|256256937|ref|ZP_05462473.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68] Length = 159
>gi|260545872|ref|ZP_05821613.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038] Length = 159
>gi|260754166|ref|ZP_05866514.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870] Length = 159
>gi|260757386|ref|ZP_05869734.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292] Length = 159
>gi|260761210|ref|ZP_05873553.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59] Length = 159
>gi|260883191|ref|ZP_05894805.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68] Length = 159
>gi|261213413|ref|ZP_05927694.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya] Length = 159
>gi|297247788|ref|ZP_06931506.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196] Length = 159
>gi|123546349|sp|Q2YMC4|ATPF2_BRUA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase F(0) sector subunit b 2; AltName: Full=ATPase subunit I 2; AltName: Full=F-type ATPase subunit b 2; Short=F-ATPase subunit b 2 Length = 159
>gi|226694382|sp|B2S9N1|ATPF2_BRUA1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase F(0) sector subunit b 2; AltName: Full=ATPase subunit I 2; AltName: Full=F-type ATPase subunit b 2; Short=F-ATPase subunit b 2 Length = 159
>gi|62195507|gb|AAX73807.1| AtpF, ATP synthase F0, B subunit [Brucella abortus bv. 1 str. 9-941] Length = 159
>gi|82615401|emb|CAJ10370.1| H+-transporting two-sector ATPase, B/B' subunit:ATP synthase F0, subunit B [Brucella melitensis biovar Abortus 2308] Length = 159
>gi|189019200|gb|ACD71922.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus S19] Length = 159
>gi|237789699|gb|EEP63909.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A] Length = 159
>gi|260097279|gb|EEW81154.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038] Length = 159
>gi|260667704|gb|EEX54644.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292] Length = 159
>gi|260671642|gb|EEX58463.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59] Length = 159
>gi|260674274|gb|EEX61095.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870] Length = 159
>gi|260872719|gb|EEX79788.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68] Length = 159
>gi|260915020|gb|EEX81881.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya] Length = 159
>gi|297174957|gb|EFH34304.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196] Length = 159
 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++   + ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKADGNLFNDALAQVKS 156