BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B
[Candidatus Liberibacter asiaticus str. psy62]
         (173 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040762|gb|ACT57558.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 173

 Score =  348 bits (892), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ
Sbjct: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL
Sbjct: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ 173
           YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
Sbjct: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ 173


>gi|315122435|ref|YP_004062924.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495837|gb|ADR52436.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 161

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/157 (54%), Positives = 131/157 (83%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVF SL+ F+++++YLR+P+ +L FLDA AD+IRD++FEARRLRE++EN+L+Q
Sbjct: 1   MHFDETFLVFTSLVAFILLLIYLRVPAKVLYFLDARADRIRDELFEARRLREEAENVLVQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEK+SK+  + REII+ A+ +AK++ ++ C+NIE++S L+L+++++ IH M+LEAKRL 
Sbjct: 61  YKEKYSKIGTDVREIIVVAEQKAKLIKDDNCKNIEKLSDLHLENVKRTIHCMELEAKRLF 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           Y K+A FS+E  +EIISQK++DD++  IF+  I  I+
Sbjct: 121 YIKLAYFSIEYAKEIISQKIDDDISCHIFQDAIREIE 157


>gi|222147704|ref|YP_002548661.1| F0F1 ATP synthase subunit B [Agrobacterium vitis S4]
 gi|221734692|gb|ACM35655.1| ATP synthase F0 B subunit [Agrobacterium vitis S4]
          Length = 161

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 91/158 (57%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M +D TF  F+ L++FL ++ YL++P ++   LDA AD IRD++ EA+RLRE+++ +L +
Sbjct: 1   MQYDATFFAFVGLVLFLALIAYLKVPGMMAKSLDARADNIRDELAEAKRLREEAQQLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  + E E + I+ AA+  A  L EE  Q  E+         EQKI   + +A   +
Sbjct: 61  YRAKRKQAEAEAQAIVTAAEREAAALTEEARQKTEEFVQRRNALSEQKIKQAETDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +   D ++     ++ QK++  + S +F  ++S +++
Sbjct: 121 RSAAVDLAISAAETLLKQKVDAQLQSGLFNSSVSEVKN 158


>gi|304391258|ref|ZP_07373202.1| ATP synthase B chain [Ahrensia sp. R2A130]
 gi|303296614|gb|EFL90970.1| ATP synthase B chain [Ahrensia sp. R2A130]
          Length = 161

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 90/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD +F   ++LI+F  ++VYL++P ++   LD  ADKI+ D+ EAR+LRE+++ +L +
Sbjct: 1   MSFDASFWALVALILFFALLVYLKVPGVVSKALDGRADKIKSDLEEARKLREEAQQLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E  EI+ AAK  A  L EE                EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEASEIVAAAKREADALREEAELKTADYVTRRTAQAEQKIAQAESQAMAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +   D +++  R+IIS K+    ++ +F+++++ +++
Sbjct: 121 KSTAVDLAMDAARDIISSKVTGKASTDMFKQSLAEVKA 158


>gi|23501289|ref|NP_697416.1| F0F1 ATP synthase subunit B [Brucella suis 1330]
 gi|161618361|ref|YP_001592248.1| F0F1 ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|254703742|ref|ZP_05165570.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|260567003|ref|ZP_05837473.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|261754387|ref|ZP_05998096.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|81753122|sp|Q8G2D8|ATPF2_BRUSU RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|226694383|sp|A9M8G1|ATPF2_BRUC2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|23347177|gb|AAN29331.1| ATP synthase F0, B subunit [Brucella suis 1330]
 gi|161335172|gb|ABX61477.1| ATP synthase F0, B subunit [Brucella canis ATCC 23365]
 gi|260156521|gb|EEW91601.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|261744140|gb|EEY32066.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
          Length = 159

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+VIVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVVIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|62289375|ref|YP_221168.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 1 str. 9-941]
 gi|82699300|ref|YP_413874.1| F0F1 ATP synthase subunit B [Brucella melitensis biovar Abortus
           2308]
 gi|189023628|ref|YP_001934396.1| F0F1 ATP synthase subunit B [Brucella abortus S19]
 gi|237814862|ref|ZP_04593860.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A]
 gi|254688690|ref|ZP_05151944.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|254693173|ref|ZP_05155001.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|254696817|ref|ZP_05158645.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|254729724|ref|ZP_05188302.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|256256937|ref|ZP_05462473.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260545872|ref|ZP_05821613.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260754166|ref|ZP_05866514.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757386|ref|ZP_05869734.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761210|ref|ZP_05873553.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883191|ref|ZP_05894805.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213413|ref|ZP_05927694.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|297247788|ref|ZP_06931506.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196]
 gi|123546349|sp|Q2YMC4|ATPF2_BRUA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|226694382|sp|B2S9N1|ATPF2_BRUA1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|62195507|gb|AAX73807.1| AtpF, ATP synthase F0, B subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615401|emb|CAJ10370.1| H+-transporting two-sector ATPase, B/B' subunit:ATP synthase F0,
           subunit B [Brucella melitensis biovar Abortus 2308]
 gi|189019200|gb|ACD71922.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|237789699|gb|EEP63909.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A]
 gi|260097279|gb|EEW81154.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260667704|gb|EEX54644.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671642|gb|EEX58463.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674274|gb|EEX61095.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872719|gb|EEX79788.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915020|gb|EEX81881.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|297174957|gb|EFH34304.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196]
          Length = 159

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++   + ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKADGNLFNDALAQVKS 156


>gi|153007848|ref|YP_001369063.1| F0F1 ATP synthase subunit B [Ochrobactrum anthropi ATCC 49188]
 gi|226694417|sp|A6WW80|ATPF2_OCHA4 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|151559736|gb|ABS13234.1| ATP synthase F0, B subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 159

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V    +I++ K++  V  ++F+  +S ++S
Sbjct: 121 SAVDLAVAAAGKIVADKVDTKVAGNLFKDALSQVKS 156


>gi|161511127|ref|NP_540460.2| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|163842669|ref|YP_001627073.1| F0F1 ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|225626900|ref|ZP_03784939.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo]
 gi|225851925|ref|YP_002732158.1| F0F1 ATP synthase subunit B [Brucella melitensis ATCC 23457]
 gi|254701197|ref|ZP_05163025.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|254707878|ref|ZP_05169706.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|254709538|ref|ZP_05171349.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|254713045|ref|ZP_05174856.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|254716602|ref|ZP_05178413.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|254718569|ref|ZP_05180380.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|256031032|ref|ZP_05444646.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|256044107|ref|ZP_05447018.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060524|ref|ZP_05450693.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|256112905|ref|ZP_05453821.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|256159090|ref|ZP_05456916.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|256254435|ref|ZP_05459971.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|256264563|ref|ZP_05467095.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368841|ref|YP_003106347.1| ATP synthase subunit B [Brucella microti CCM 4915]
 gi|260168164|ref|ZP_05754975.1| F0F1 ATP synthase subunit B [Brucella sp. F5/99]
 gi|260563466|ref|ZP_05833952.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|261218401|ref|ZP_05932682.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261221603|ref|ZP_05935884.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315369|ref|ZP_05954566.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317064|ref|ZP_05956261.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261320750|ref|ZP_05959947.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|261324518|ref|ZP_05963715.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751734|ref|ZP_05995443.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261757622|ref|ZP_06001331.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265983544|ref|ZP_06096279.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|265988102|ref|ZP_06100659.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265990519|ref|ZP_06103076.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994347|ref|ZP_06106904.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|265997567|ref|ZP_06110124.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851768|ref|ZP_06792441.1| ATP synthase F0 [Brucella sp. NVSL 07-0026]
 gi|306837306|ref|ZP_07470189.1| ATP synthase F0, B subunit [Brucella sp. NF 2653]
 gi|226694369|sp|B0CK73|ATPF2_BRUSI RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|163673392|gb|ABY37503.1| ATP synthase F0, B subunit [Brucella suis ATCC 23445]
 gi|225618557|gb|EEH15600.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo]
 gi|225640290|gb|ACO00204.1| ATP synthase F0, B subunit [Brucella melitensis ATCC 23457]
 gi|255998999|gb|ACU47398.1| ATP synthase subunit B [Brucella microti CCM 4915]
 gi|260153482|gb|EEW88574.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|260920187|gb|EEX86840.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|260923490|gb|EEX90058.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293440|gb|EEX96936.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|261296287|gb|EEX99783.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300498|gb|EEY03995.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304395|gb|EEY07892.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737606|gb|EEY25602.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741487|gb|EEY29413.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|262552035|gb|EEZ08025.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|262765460|gb|EEZ11249.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001303|gb|EEZ13878.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094928|gb|EEZ18636.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660299|gb|EEZ30560.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|264662136|gb|EEZ32397.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|294820357|gb|EFG37356.1| ATP synthase F0 [Brucella sp. NVSL 07-0026]
 gi|306407619|gb|EFM63815.1| ATP synthase F0, B subunit [Brucella sp. NF 2653]
 gi|326408424|gb|ADZ65489.1| F0F1 ATP synthase subunit B [Brucella melitensis M28]
 gi|326538138|gb|ADZ86353.1| ATP synthase F0, B subunit [Brucella melitensis M5-90]
          Length = 159

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|306842324|ref|ZP_07474983.1| ATP synthase F0, B subunit [Brucella sp. BO2]
 gi|306287540|gb|EFM58999.1| ATP synthase F0, B subunit [Brucella sp. BO2]
          Length = 159

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMVGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|239831261|ref|ZP_04679590.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301]
 gi|239823528|gb|EEQ95096.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301]
          Length = 159

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 93/156 (59%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEASDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V    +I+++K++  V  ++F+  +S +++
Sbjct: 121 SAVDLAVAAAGKIVAEKVDAKVAGNLFKDALSQVKT 156


>gi|148559545|ref|YP_001258412.1| F0F1 ATP synthase subunit B [Brucella ovis ATCC 25840]
 gi|226694384|sp|A5VNW5|ATPF2_BRUO2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|148370802|gb|ABQ60781.1| ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
          Length = 159

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKCKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|306845019|ref|ZP_07477600.1| ATP synthase F0, B subunit [Brucella sp. BO1]
 gi|306274651|gb|EFM56440.1| ATP synthase F0, B subunit [Brucella sp. BO1]
          Length = 159

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMVGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              + +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVELAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|49473962|ref|YP_032004.1| F0F1 ATP synthase subunit B [Bartonella quintana str. Toulouse]
 gi|81696061|sp|Q6G0H0|ATPF2_BARQU RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|49239465|emb|CAF25816.1| ATP synthase B chain [Bartonella quintana str. Toulouse]
          Length = 164

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 96/159 (60%), Gaps = 5/159 (3%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++ Y ++P +++  LDA A +I+D++ EA RLRE+++ +L +Y+ K
Sbjct: 3   DTFWAFVGLVLFLALLAYFKVPEMIVHRLDARAKRIKDELDEALRLREEAQEVLAEYQRK 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
           H++ E++ +EII AAK   + +  E     E+      K  EQKI   + +A R++ +  
Sbjct: 63  HAEAEKDAQEIIAAAKREVEAVVSEARTKAEEYVKNRNKLAEQKIAQAEADAIRVVSSSA 122

Query: 125 ADFSVEIVREIISQ-----KMNDDVNSSIFEKTISSIQS 158
            D +V   R +I Q     K N+ +  S+FE++++ +++
Sbjct: 123 VDLAVSAARVLIEQELDSNKANELIKESLFEESLTKMKA 161


>gi|319784762|ref|YP_004144238.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170650|gb|ADV14188.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 163

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 89/153 (58%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++LIIFL + VY+++P ++   LDA A +I +++ EARRLRE+++ +L QY+ K 
Sbjct: 8   TLWATIALIIFLGVAVYIKVPGMIAKALDARAARISNELDEARRLREEAQQLLGQYQRKR 67

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + E+E  +I+ AAK  A +LA +  +  E          EQKI   + +A   + A   
Sbjct: 68  KEAEQEAADIVAAAKREADMLAADAHKKTEDYVVRRTALAEQKIGQAERDAISEVRASAV 127

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +VE  R +++ K++    + +F+ +++ ++S
Sbjct: 128 DIAVEAARALLAGKIDAKAGADLFKASLADVKS 160


>gi|163867854|ref|YP_001609058.1| F0F1 ATP synthase subunit B [Bartonella tribocorum CIP 105476]
 gi|226694380|sp|A9IQI8|ATPF2_BART1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|161017505|emb|CAK01063.1| ATP synthase, B chain [Bartonella tribocorum CIP 105476]
          Length = 164

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 96/157 (61%), Gaps = 14/157 (8%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++VY +IP  ++  LDA A +I+D++ EA RLRE+++ IL +Y+ K
Sbjct: 3   DTFWAFVGLVLFLALLVYFQIPQKIIHHLDARAKRIKDELDEALRLREEAQEILAEYQRK 62

Query: 65  HSKVEEETREIILAAKH-------RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
           H++ E++ +EII AAKH        A+  AEE  +N  +++       EQKI   + +A 
Sbjct: 63  HAEAEKDAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLA-------EQKIAQAEADAI 115

Query: 118 RLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
           R++ +   D ++   R +I+++++ +    + ++ +S
Sbjct: 116 RMVSSSAIDLAISTARVLIAKELDSNRADELVKEALS 152


>gi|260460366|ref|ZP_05808618.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259034011|gb|EEW35270.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 163

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 88/153 (57%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++L+IFL I VY+++P ++   LDA A +I  ++ EAR+LRE+++ +L QY+ K 
Sbjct: 8   TLWATIALVIFLAIAVYIKVPGLIAKALDARAMRISSELDEARKLREEAQQLLGQYQRKR 67

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + E+E  +I+ AAK  A +LA E  +  E          EQKI   + +A   + A   
Sbjct: 68  KEAEQEAADIVAAAKREADLLAAEAHKKTEDYVTRRTALAEQKIGQAERDAISEVRASAV 127

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +VE  R +++ K++    + +F+ +++ +++
Sbjct: 128 DIAVEAARALLAAKVDVKAGADLFKASLADVKA 160


>gi|49475212|ref|YP_033253.1| F0F1 ATP synthase subunit B [Bartonella henselae str. Houston-1]
 gi|81696226|sp|Q6G5K9|ATPF2_BARHE RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|49238017|emb|CAF27223.1| ATP synthase B chain [Bartonella henselae str. Houston-1]
          Length = 164

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 99/166 (59%), Gaps = 19/166 (11%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++VY  +P ++L  LD  A +I+D++ EA RLRE+++ +L +Y+ K
Sbjct: 3   DTFWAFVGLVLFLALLVYFEVPEMVLRHLDTRAKRIKDELDEALRLREEAQEVLAEYQRK 62

Query: 65  HSKVEEETREIILAAKH-------RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
           H++ E++ +EII AAK         A+I AEE  +N  +++       EQKI   + +A 
Sbjct: 63  HAEAEKDAQEIIAAAKREVEAVISEARIKAEEYVKNRNKLA-------EQKIAQAEADAI 115

Query: 118 RLLYAKIADFSVEIVR-----EIISQKMNDDVNSSIFEKTISSIQS 158
           R++ +   D +V   R     E+ S K N+ +  S+ +++++ +++
Sbjct: 116 RMVSSSAIDLAVSAARVLIEKELDSHKANELIKESLVQESLTKMKT 161


>gi|307941609|ref|ZP_07656964.1| ATP synthase B chain [Roseibium sp. TrichSKD4]
 gi|307775217|gb|EFO34423.1| ATP synthase B chain [Roseibium sp. TrichSKD4]
          Length = 159

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 88/156 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + L++F  +++YL++P  + S LD  AD I+D++ +ARRLRE+++ +L  Y+
Sbjct: 1   MDASFWALVGLVLFFALIIYLKVPGKITSGLDKRADDIKDELEKARRLREEAQALLSDYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + EEE   I+  A   A+ L  E  + +E++ +   K  E KI   + +A   + +
Sbjct: 61  RKRHEAEEEATAIVAEANAEAERLTAETNRALEEVISRRSKAAEDKIAQAETQAIAEVRS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           K AD +V+    +++ K+ D V   I   +IS +++
Sbjct: 121 KAADIAVQAAEGMLTAKVKDKVADDILSDSISQVKA 156


>gi|13476166|ref|NP_107736.1| F0F1 ATP synthase subunit B [Mesorhizobium loti MAFF303099]
 gi|81776791|sp|Q986D1|ATPF2_RHILO RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|14026926|dbj|BAB53522.1| Fo ATP synthase B chain [Mesorhizobium loti MAFF303099]
          Length = 163

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 90/153 (58%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++LIIFL + +Y+++P ++   LDA A +I  ++ EAR+LR++++ +L QYK+K 
Sbjct: 8   TLWATIALIIFLGVAIYIKVPGLIAKALDARAARISSELDEARKLRDEAQQLLGQYKKKR 67

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + E+E  +I+ AAK  A++LA E  +  E          EQKI   + +A   + A   
Sbjct: 68  KEAEQEAADIVAAAKREAEMLATEAHKKTEDYVIRRTALAEQKIGQAERDAVAEVRASAV 127

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +VE  R +++ K++    + +F+ +++ +++
Sbjct: 128 DIAVEAARALLAAKVDVKAGADLFKASLADVKA 160


>gi|240850062|ref|YP_002971455.1| ATP synthase subunit B [Bartonella grahamii as4aup]
 gi|240267185|gb|ACS50773.1| ATP synthase subunit B [Bartonella grahamii as4aup]
          Length = 164

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 91/146 (62%), Gaps = 14/146 (9%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++VY +IP  ++  LDA A +I+D++ EA RLRE+++ IL +Y+ K
Sbjct: 3   DTFWAFVGLVLFLALLVYFQIPQRVIHHLDARAKRIKDELDEALRLREEAQEILAEYQRK 62

Query: 65  HSKVEEETREIILAAKH-------RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
           H++ E++ +EII AAKH        A+  AEE  +N  +++       EQKI   + +A 
Sbjct: 63  HAEAEKDAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLA-------EQKIAQAEADAI 115

Query: 118 RLLYAKIADFSVEIVREIISQKMNDD 143
           R++ +   D ++   R +I+++++ +
Sbjct: 116 RMVSSSAIDLAISTARILIAKELDSN 141


>gi|110633056|ref|YP_673264.1| F0F1 ATP synthase subunit B [Mesorhizobium sp. BNC1]
 gi|123058179|sp|Q11KH6|ATPF2_MESSB RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|110284040|gb|ABG62099.1| ATP synthase F0, B subunit [Chelativorans sp. BNC1]
          Length = 159

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 96/156 (61%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   ++LIIF+ I++Y+++P +L   LDA A++I++++ EARRLRE+++ +L +Y+
Sbjct: 1   MDATFWALVALIIFVGILLYMKVPGMLAGSLDARAERIKNELEEARRLREEAQQLLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E +E++ AAK  AK++  +     E+  +      EQKI   + +A   + +
Sbjct: 61  RKRREAEQEAKELVDAAKREAKLIVSDAKVKTEEYVSRRTALAEQKIAQAERDAVNEVRS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  D +V    +++++K++    S +F+ ++  +++
Sbjct: 121 RAVDVAVAAAGKLLAEKIDTKTGSELFKASLQDVKT 156


>gi|150395675|ref|YP_001326142.1| F0F1 ATP synthase subunit B [Sinorhizobium medicae WSM419]
 gi|226695843|sp|A6U6M7|ATPF_SINMW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150027190|gb|ABR59307.1| ATP synthase F0, B subunit [Sinorhizobium medicae WSM419]
          Length = 161

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 89/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+F V++ YL++P ++   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAASIVAAAQREAEMLTAEAKQKTEEFVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A   D ++    ++I+ K +     ++F+K +  ++S
Sbjct: 121 RAAAVDLAISAAEKVIASKADASAQETLFQKALGEVKS 158


>gi|86356513|ref|YP_468405.1| F0F1 ATP synthase subunit B [Rhizobium etli CFN 42]
 gi|123512871|sp|Q2KBV8|ATPF_RHIEC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86280615|gb|ABC89678.1| ATP synthase protein, subunit B [Rhizobium etli CFN 42]
          Length = 163

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD TF  F+ LI+FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HFDATFFAFVGLILFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   + +A + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEADAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     ++++K +  V S +F   +  +++
Sbjct: 124 SAAVDLAIAAAETVLAKKADGKVQSELFGNAVGQVKT 160


>gi|209548121|ref|YP_002280038.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226694453|sp|B5ZS19|ATPF_RHILW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209533877|gb|ACI53812.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 163

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     ++ ++ +  V S +F   +  +++
Sbjct: 124 SAAVDLAIAAAETVLGKQADAKVQSELFGNAVGQVKT 160


>gi|319407570|emb|CBI81220.1| ATP synthase subunit b 2 [Bartonella sp. 1-1C]
          Length = 164

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 90/150 (60%), Gaps = 1/150 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++VY  +P+ ++  LD  A  I+D++ EA RLRE+++ +L +Y+ K
Sbjct: 3   DTFWAFIGLVLFLALLVYFEVPNAIIRKLDTRAKHIKDELDEALRLREEAQKVLAEYQRK 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
           H ++E+ET+EII  AK + + +  E     E+    + +  EQKI   +  A R+L +  
Sbjct: 63  HLEIEKETQEIIADAKDKVEAMLSETRIKTEEYIKNHSRLAEQKIAQAEENAIRMLSSTA 122

Query: 125 ADFSVEIVREIISQKMN-DDVNSSIFEKTI 153
            D ++  V  ++++++N +  NS I E  I
Sbjct: 123 VDLAISAVNRLLTKELNAEQANSLIKEPLI 152


>gi|15964591|ref|NP_384944.1| F0F1 ATP synthase subunit B [Sinorhizobium meliloti 1021]
 gi|307309337|ref|ZP_07589000.1| ATP synthase F0, B subunit [Sinorhizobium meliloti BL225C]
 gi|307320073|ref|ZP_07599494.1| ATP synthase F0, B subunit [Sinorhizobium meliloti AK83]
 gi|81635005|sp|Q92RM5|ATPF_RHIME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15073769|emb|CAC45410.1| Probable ATP synthase B chain transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306894288|gb|EFN25053.1| ATP synthase F0, B subunit [Sinorhizobium meliloti AK83]
 gi|306900206|gb|EFN30824.1| ATP synthase F0, B subunit [Sinorhizobium meliloti BL225C]
          Length = 161

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 89/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+F V++ YL++P ++   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAASIVAAAQREAEMLTAEAKQKTEEYVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A   D ++    ++++ K +     ++F+K I  +++
Sbjct: 121 RAAAVDLAISAAEKVLASKADAGAQETLFKKAIGEVKA 158


>gi|222085045|ref|YP_002543574.1| ATP synthase F0, B subunit [Agrobacterium radiobacter K84]
 gi|221722493|gb|ACM25649.1| ATP synthase F0, B subunit [Agrobacterium radiobacter K84]
          Length = 163

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 93/156 (59%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            DETF  F++L++F+ +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y+
Sbjct: 5   LDETFFAFVALLLFIGLVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLAEYQ 64

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E +   I+ AA+  A++L  E  +  E+  A      EQKI   + +A + + +
Sbjct: 65  RKRKEAEADAANIVAAAEREAEMLTTEARKKTEEFVANRTALSEQKIKQAEADAMKAVRS 124

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D ++     ++++K    V S +F   +S +++
Sbjct: 125 AAVDLAIAAAESVLAKKAGGKVQSELFSNAVSEVKT 160


>gi|319899221|ref|YP_004159314.1| ATP synthase, B chain [Bartonella clarridgeiae 73]
 gi|319403185|emb|CBI76744.1| ATP synthase, B chain [Bartonella clarridgeiae 73]
          Length = 164

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 94/150 (62%), Gaps = 2/150 (1%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL +++Y  +P++L   LDA A +I+D++ EA RLRE+++ IL +Y+ K
Sbjct: 3   DTFWAFIGLVLFLALLIYFEVPAMLTRKLDARAKRIKDELDEALRLREEAQEILAEYQRK 62

Query: 65  HSKVEEETREIILAAKHRAK-ILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           H ++E+ET+EII  A+   + +L E   +  E I +   K  EQKI   +  A R++ + 
Sbjct: 63  HLEIEKETQEIIAEAQREIEAVLIETRVKTDEYIKSRN-KLAEQKIAQAEANAVRMVASS 121

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             D +V     +I+++++ +  +S+ ++++
Sbjct: 122 AIDLAVSAANTLITKELDAEQANSLIKESL 151


>gi|121602072|ref|YP_988698.1| F0F1 ATP synthase subunit B [Bartonella bacilliformis KC583]
 gi|226741307|sp|A1URU5|ATPF_BARBK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120614249|gb|ABM44850.1| ATP synthase F0, B subunit family protein [Bartonella bacilliformis
           KC583]
          Length = 159

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 88/149 (59%), Gaps = 5/149 (3%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ LI+FL ++ Y ++P++ L  LD  A +I  ++ EA RLRE+++ IL +Y++K
Sbjct: 3   DTFWAFIGLILFLALLFYFKVPAMALRSLDERAKRIAGELDEALRLREEAQGILAEYQQK 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            + +E++ +EII AAKH A+I+  E     E+      K +EQKI   + +A + + +  
Sbjct: 63  CAGIEQDVQEIITAAKHEAEIIVAEARVKTEEYVKNRNKLVEQKIAQAESDAIQEISSSA 122

Query: 125 ADFSVEIVREII-----SQKMNDDVNSSI 148
            + ++    +II     ++K ND +  SI
Sbjct: 123 VNLAISSASKIINNELGAKKANDLIKESI 151


>gi|90420159|ref|ZP_01228067.1| possible ATP synthase chain B [Aurantimonas manganoxydans
          SI85-9A1]
 gi|90335493|gb|EAS49243.1| possible ATP synthase chain B [Aurantimonas manganoxydans
          SI85-9A1]
          Length = 159

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%)

Query: 3  FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           D +F  F +LIIFL IV YL+ P+ + S LD  AD+IR++I EAR L+E+++  L +Y+
Sbjct: 1  MDNSFWAFAALIIFLAIVWYLKAPAKVGSTLDQRADRIRNEIEEARELKEEAKQQLAEYQ 60

Query: 63 EKHSKVEEETREIILAAKHRAKIL 86
           +  + EEE +EI+ AAK  A+++
Sbjct: 61 RRRQEAEEEAKEIVAAAKREAELM 84


>gi|116250702|ref|YP_766540.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226694452|sp|Q1MKS9|ATPF_RHIL3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|115255350|emb|CAK06425.1| putative ATP synthase sub unit b [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 162

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 95/159 (59%), Gaps = 1/159 (0%)

Query: 1   MHF-DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M F D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L+
Sbjct: 1   MEFLDATFFAFVGLVLFLALVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLV 60

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           +Y+ K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + 
Sbjct: 61  EYQRKRKEAEAEAAHIVAAAEREAEMLTAEAMKKTEEFVANRTALSEQKIKQAEVEAMKA 120

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + +   D ++     +++++ +  V S +F   +  +++
Sbjct: 121 VRSAAVDLAIAAAETVLAKRADAKVQSELFGNAVGQVKT 159


>gi|218679067|ref|ZP_03526964.1| F0F1 ATP synthase subunit B [Rhizobium etli CIAT 894]
          Length = 157

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 89/153 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 5   HLDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 64

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   + EA + + 
Sbjct: 65  QRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRTALSEQKIKQAEAEAMKAVR 124

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
           +   D ++     +++++ +  V S +F   I 
Sbjct: 125 SAAVDLAIAAAETVLAKQADGKVQSELFGNAIG 157


>gi|319404579|emb|CBI78185.1| ATP synthase subunit b 2 [Bartonella rochalimae ATCC BAA-1498]
          Length = 164

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 90/149 (60%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++VY  +P+ ++  LD  A  I+D++ EA RLRE+++ +L +Y+ K
Sbjct: 3   DTFWAFIGLVLFLALLVYFEVPNAIIRKLDTRAKHIKDELDEALRLREEAQKVLAEYQRK 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
           H ++E+ET+EII  AK + + +  E     E+    + + +EQKI   +  A R L +  
Sbjct: 63  HLEIEKETQEIIADAKDKVEAMLSETRIKTEEYIKNHSRLVEQKIAQAEANAIRTLSSTA 122

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            D ++  +  ++ ++++ +  +S+ ++ +
Sbjct: 123 VDLAISAINRLLMKELDAEQANSLIKEPL 151


>gi|190890578|ref|YP_001977120.1| ATP synthase, subunit B [Rhizobium etli CIAT 652]
 gi|218509939|ref|ZP_03507817.1| F0F1 ATP synthase subunit B [Rhizobium etli Brasil 5]
 gi|226694451|sp|B3PRF9|ATPF_RHIE6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190695857|gb|ACE89942.1| ATP synthase protein, subunit B [Rhizobium etli CIAT 652]
 gi|327190881|gb|EGE57940.1| ATP synthase protein, subunit B [Rhizobium etli CNPAF512]
          Length = 163

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HLDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  +  +  E+  A      EQKI   + EA + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAEMLTADAKKKTEEFVANRTALSEQKILQAEAEAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     +++++ +  V S +F   +S +++
Sbjct: 124 SAAVDLAIAAAETVLAKQADAKVQSELFGNAVSQVKT 160


>gi|319406086|emb|CBI79716.1| ATP synthase subunit b 2 [Bartonella sp. AR 15-3]
          Length = 164

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 98/164 (59%), Gaps = 15/164 (9%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL +++Y  +P++++  LD  A  I+D++ EA  LRE+++ +L +Y+ K
Sbjct: 3   DTFWAFIGLVLFLALLIYFEVPNVIIRKLDTRAKHIKDELNEALHLREEAQKVLAEYQRK 62

Query: 65  HSKVEEETREIILAAKHRAK-ILAEEGCQNIEQISALYLKD----LEQKIHYMKLEAKRL 119
           H ++E+ET+EII  AK + + I+AE   +  E     Y+KD     EQKI   +    R+
Sbjct: 63  HLEIEKETQEIIADAKCKVEAIIAETRIKTEE-----YIKDRSRLAEQKIAQAEANVVRM 117

Query: 120 LYAKIADFSVE-----IVREIISQKMNDDVNSSIFEKTISSIQS 158
           + +   D ++      + +E+ +++ N  +  S+ ++T+ ++++
Sbjct: 118 VSSSAIDLAISAANRLLTKELGAEQANSLIKKSLVQETLKNVET 161


>gi|254503348|ref|ZP_05115499.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
 gi|222439419|gb|EEE46098.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
          Length = 159

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 88/155 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + L++F V++ YL++P ++   LD  AD I+ ++ EAR++RE+++ +L +Y+
Sbjct: 1   MDASFWALVGLVLFFVLIAYLKVPGMIGGALDKRADDIKKELEEARKMREEAQELLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+  A   A+ L  E  Q +E++ A   K  E+KI   + +A   + A
Sbjct: 61  RKRHEAESEAEAIVAEANAEAERLTVETNQALEEMIARRSKAAEEKIAQAETQAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K AD +V    EI+S K+ D V   I  K+I+ ++
Sbjct: 121 KAADIAVAAAEEILSAKVKDKVADDILAKSITQVK 155


>gi|163761010|ref|ZP_02168088.1| F0F1 ATP synthase subunit B [Hoeflea phototrophica DFL-43]
 gi|162281791|gb|EDQ32084.1| F0F1 ATP synthase subunit B [Hoeflea phototrophica DFL-43]
          Length = 159

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 90/156 (57%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + LIIFL I+ Y+++P+++ S LD  AD+IR+++ +A++LRE+++ +L +Y+
Sbjct: 1   MDASFWALVGLIIFLGIMAYIKVPAMMGSALDKRADQIRNELEQAKKLREEAQQLLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+ AA+  A IL +E     E+  +      EQKI   + +A   + A
Sbjct: 61  RKRKEAEAEAAGILSAAEKEAAILRDEAKAKTEEYVSRRTAMAEQKIQQAEADAINEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     +I +K++   + ++F+ ++  +++
Sbjct: 121 AAVDLAVVAAENLIGKKVDSKASDALFKASLGDLKT 156


>gi|227821029|ref|YP_002824999.1| F0F1 ATP synthase subunit B [Sinorhizobium fredii NGR234]
 gi|227340028|gb|ACP24246.1| Fo ATP synthase B chain [Sinorhizobium fredii NGR234]
          Length = 161

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 85/158 (53%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+FL ++ YL++P  +   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFLALIAYLKVPGKIAEALDARADKIGNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E   A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAANIVAAAQREAEMLTAEAKQKTEDYVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
                D ++    ++++ K +     ++F++ +  ++ 
Sbjct: 121 RTAAVDLAISAAEKVLATKADATAQETLFKQALGEVKG 158


>gi|300024395|ref|YP_003757006.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526216|gb|ADJ24685.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 163

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 83/152 (54%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F V ++ + F+ +V+Y R+P+++   LD  AD IR ++ EAR+LRE ++ +L  Y+ K  
Sbjct: 9   FWVLLAFLTFIALVLYYRVPALIGKMLDDRADAIRKELDEARKLREDAQALLADYQRKAR 68

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + E E R II  AK  A+ LA +  +++ +      K  E+KI   + +A   + A   D
Sbjct: 69  EAENEARSIIDQAKREAEALAVDARKSLAESLERRSKIAEEKIARAETQALSEVRATAVD 128

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++    E++  + +  V  S+  ++IS ++ 
Sbjct: 129 TAISAAHELLKTRASGSVGDSLITQSISDLRG 160


>gi|254471717|ref|ZP_05085118.1| ATP synthase protein, subunit B [Pseudovibrio sp. JE062]
 gi|211958919|gb|EEA94118.1| ATP synthase protein, subunit B [Pseudovibrio sp. JE062]
          Length = 161

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 84/155 (54%), Gaps = 1/155 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD +    + LI+F V++ YL++P  + + LD  AD I+ ++  AR+LRE+++ ++ +Y+
Sbjct: 2   FDASLWALVGLILFFVLLWYLKVPGKIGAMLDQQADNIKQELEGARKLREEAQALMAEYQ 61

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E  +I+  AK  A  LA+E    +E++ A   K  E KI   +  A   + +
Sbjct: 62  RKRKEAEAEAEQIVADAKVEADRLADEAKAALEEMIARRTKAAEAKIAQAEANAIAEVRS 121

Query: 123 KIADFSVEIVREII-SQKMNDDVNSSIFEKTISSI 156
           + AD +V+    I+ S     +V   + +++I  +
Sbjct: 122 RAADVAVQAAETIVASSAAKAEVQDKVLKQSIKQV 156


>gi|163733901|ref|ZP_02141343.1| ATP synthase F0, B subunit [Roseobacter litoralis Och 149]
 gi|161393012|gb|EDQ17339.1| ATP synthase F0, B subunit [Roseobacter litoralis Och 149]
          Length = 191

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 59/89 (66%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+VF+ L++F+ I+VY ++P ++   LD  A+ I  ++ EAR LRE+++ +L  Y+ KH 
Sbjct: 37  FVVFLGLVVFIGILVYFKVPGMIGKMLDGRAEGIEGELNEARALREEAQTLLASYERKHR 96

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIE 95
           +V+E+   I+ AAK  A I AE+   ++E
Sbjct: 97  EVQEQADRIVEAAKEEATIAAEQARADLE 125


>gi|163744747|ref|ZP_02152107.1| ATP synthase F0, B subunit [Oceanibulbus indolifex HEL-45]
 gi|161381565|gb|EDQ05974.1| ATP synthase F0, B subunit [Oceanibulbus indolifex HEL-45]
          Length = 190

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 89/152 (58%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++Y ++P++L+  LD  AD I+ ++ EAR LRE+++ +L  Y+ KH 
Sbjct: 36  FIVLLAFLLFIGILIYFKVPTLLIGMLDKRADGIKTELEEARALREEAQTLLASYERKHK 95

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+++   I+ +AK  A++ AE+   ++ +     +   + +I   +  A + +  +   
Sbjct: 96  EVQDQADRIVSSAKEDARLAAEQARADMAKSLDRRMAAAKDQISSAEAAAVKEVRDQAVT 155

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V   R++I+++M     + + +  I+ +++
Sbjct: 156 IAVAAARDVIAKQMTAAQGNKLIDDGIAQVEA 187


>gi|319408195|emb|CBI81848.1| ATP synthase, B chain [Bartonella schoenbuchensis R1]
          Length = 164

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 87/150 (58%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +TF  F+ L++FL ++VY ++P+++   LD    +I D++ EA RLRE+++ IL + + K
Sbjct: 3   DTFWAFIGLVLFLALLVYFKVPTMVARSLDMRTKRITDELDEALRLREEAQEILAECQRK 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+  +EII +AK+   ++  E     E+      K +EQKI   + +A R++    
Sbjct: 63  CVEAEKNAQEIIASAKNEVSVIVAEARTKTEEYVKNRKKMVEQKIAQAEADAIRVVSLSA 122

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
            D ++   R +I+++++   +  + EK+++
Sbjct: 123 IDLAISSSRTLINKELDFKESKDLIEKSLT 152


>gi|323136717|ref|ZP_08071798.1| H+transporting two-sector ATPase B/B' subunit [Methylocystis sp.
           ATCC 49242]
 gi|322398034|gb|EFY00555.1| H+transporting two-sector ATPase B/B' subunit [Methylocystis sp.
           ATCC 49242]
          Length = 158

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 68/109 (62%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFD  F V +   IF+++++++   S   + +DA  ++I+ ++ EA RLR ++E +L  
Sbjct: 1   MHFDAEFYVAVGFTIFVLVLLWVGAHSKFAALIDARINRIKSELAEAERLRSEAETLLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           +++K +  E E + I+  AK  A+++A EG + +++  A  +K +EQKI
Sbjct: 61  FEKKRADAEAEAKAIVAQAKEEAELIAAEGRRRLDEFMARSVKQVEQKI 109


>gi|328544975|ref|YP_004305084.1| ATP synthase B/B' CF(0) superfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326414717|gb|ADZ71780.1| ATP synthase B/B' CF(0) superfamily [Polymorphum gilvum
           SL003B-26A1]
          Length = 159

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 87/157 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F+ L++F V++ ++++P  + + LD  AD IR+++ EAR+LRE+++ +L +Y+
Sbjct: 1   MDATFWAFVGLVLFFVVMFWVKVPGKIGAALDKRADTIRNELDEARKLREEAQALLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+  A+  A+ L  E  + +E + A   +  E KI   +  A   + A
Sbjct: 61  RKRHEAESEAEAIVAEARAEAERLTVETNKALEDMIARRTRAAEDKIAQAETAAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           + AD +V    +I+  K+ D V   I  ++I  +++ 
Sbjct: 121 RAADIAVAAAEQILKAKVQDKVADDIMARSIDQVKAS 157


>gi|17983554|gb|AAL52724.1| ATP synthase b chain [Brucella melitensis bv. 1 str. 16M]
          Length = 142

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 79/139 (56%)

Query: 20  VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA 79
           +VY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y  K  + E+E  +I+ +A
Sbjct: 1   MVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYHRKRKEAEKEAGDIVASA 60

Query: 80  KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQK 139
           +  AK L EE  +  E+  A   K  EQKI   + +A   + A   D +V     I+++K
Sbjct: 61  EREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRASAVDLAVAAAGSILAEK 120

Query: 140 MNDDVNSSIFEKTISSIQS 158
           ++     ++F   ++ ++S
Sbjct: 121 VDAKAAGNLFNDALAQVKS 139


>gi|118590788|ref|ZP_01548189.1| F0F1 ATP synthase subunit B [Stappia aggregata IAM 12614]
 gi|118436764|gb|EAV43404.1| F0F1 ATP synthase subunit B [Stappia aggregata IAM 12614]
          Length = 159

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 87/155 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LI+F V++ Y+++P+ +   LD  A+ IR ++ +AR++RE+++ +L +Y+
Sbjct: 1   MDATFWALIGLILFFVVIFYVKVPAKINGSLDDRAETIRKELEDARKMREEAQALLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   II  A   A+ L  E  Q ++++ A   K  E KI   + +A   + A
Sbjct: 61  RKRHEAEGEAEAIIAEANSEAERLTLETSQALDEMIARRTKAAEDKIAQAESQAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K AD +V    EI++ K+ D V   I  K+I+ ++
Sbjct: 121 KAADIAVAAAEEILAAKVKDKVADDILTKSIAQVK 155


>gi|119385601|ref|YP_916656.1| F0F1 ATP synthase subunit B [Paracoccus denitrificans PD1222]
 gi|226694341|sp|A1B616|ATPF_PARDP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119376196|gb|ABL70960.1| H+-transporting two-sector ATPase, B/B' subunit [Paracoccus
           denitrificans PD1222]
          Length = 184

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 83/150 (55%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I+VY R+P I+   LD  A+ IR+D+ EARRLRE+++ I   Y+ +  
Sbjct: 30  FIVTLAFLLFVGILVYFRVPQIVGGLLDKRAEGIRNDLAEARRLREEAQEIYASYERRQR 89

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+ +  +I+  AK  A   AE+  + ++      LK  E++I   + EA R +  +   
Sbjct: 90  EVKSQADDIVANAKREAVAEAEKAKKALQLSIERRLKAAEEQIAGAEAEAVRAVRDRAIQ 149

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++    EI+ ++ +    S+  +K I  +
Sbjct: 150 TAIAAATEILGKQASPAERSAGIDKAIDEV 179


>gi|294676301|ref|YP_003576916.1| ATP synthase F0 subunit B [Rhodobacter capsulatus SB 1003]
 gi|75498234|sp|O05333|ATPF_RHOCA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|1934978|emb|CAA72984.1| FoF1 ATP synthase, subunit B [Rhodobacter capsulatus]
 gi|294475121|gb|ADE84509.1| ATP synthase F0, B subunit [Rhodobacter capsulatus SB 1003]
          Length = 185

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 67/103 (65%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++ ++ +IF+ +++  ++PS+LL  LD  A+ I+ D+ EA+ LR++++ IL  Y+ K  
Sbjct: 31  FVILVAFLIFVGVLIKFKVPSMLLGMLDKRAEGIKADLDEAKALRDEAQKILASYERKAR 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           +V+ +  EI+ AAK  A++ AE+   ++++  A  LK  E +I
Sbjct: 91  EVQGQADEIVAAAKRDAQLAAEQAKADLKEAIARRLKGAEDRI 133


>gi|110678647|ref|YP_681654.1| F0F1 ATP synthase subunit B [Roseobacter denitrificans OCh 114]
 gi|123172761|sp|Q16AM5|ATPF_ROSDO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|109454763|gb|ABG30968.1| ATP synthase F0, B subunit [Roseobacter denitrificans OCh 114]
          Length = 188

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 59/89 (66%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V + L++F+ I+VY ++P ++   LD+ A+ I  ++ EAR LRE+++++L  Y+ K  
Sbjct: 34  FVVLLGLLVFIGILVYFKVPGMIGKMLDSRAEGIEAELNEARALREEAQSLLASYERKQR 93

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIE 95
           +V+E+   I+ AAK  A I AE+   ++E
Sbjct: 94  EVQEQADRIVEAAKEEATIAAEQARADLE 122


>gi|83855051|ref|ZP_00948581.1| ATP synthase F0, B subunit [Sulfitobacter sp. NAS-14.1]
 gi|83842894|gb|EAP82061.1| ATP synthase F0, B subunit [Sulfitobacter sp. NAS-14.1]
          Length = 186

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 89/152 (58%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ +++Y ++P ++ S LD+ A+ I+ ++ EAR LRE+++ +L  Y+ K  
Sbjct: 32  FIVLLAFLLFVGVLIYFKVPKMMGSMLDSRAEGIKSELDEARALREEAQTLLASYERKQQ 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+E+   I+ +AK  A   A++   ++E+  A  +   E++I   +  A + +  +   
Sbjct: 92  EVKEQADRIVTSAKAEANEAADQARADLEKSIARRMAAAEEQIDSAQAAAVKEVRDQAVV 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++   +++I++KM     +++ +  I+ + +
Sbjct: 152 VAIAAAKDVIAKKMTAAEGNALIDSAIAEVDT 183


>gi|83941574|ref|ZP_00954036.1| ATP synthase F0, B subunit [Sulfitobacter sp. EE-36]
 gi|83847394|gb|EAP85269.1| ATP synthase F0, B subunit [Sulfitobacter sp. EE-36]
          Length = 186

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 89/152 (58%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ +++Y ++P ++ S LD+ A+ I+ ++ EAR LRE+++ +L  Y+ K  
Sbjct: 32  FIVLLAFLLFVGVLIYFKVPKMMGSMLDSRAEGIKSELDEARALREEAQTLLASYERKQQ 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+E+   I+ +AK  A   A++   ++E+  A  +   E++I   +  A + +  +   
Sbjct: 92  EVKEQADRIVTSAKAEANEAADQARADLEKSIARRMAAAEEQIDSAQAAAVKEVRDQAVV 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++   +++I++KM     +++ +  I+ + +
Sbjct: 152 VAIAAAKDVIAKKMTAAEGNALIDSAIAEVDA 183


>gi|241203304|ref|YP_002974400.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857194|gb|ACS54861.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 163

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 88/148 (59%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           + L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y+ K  + E 
Sbjct: 13  VGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEA 72

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + +   D ++ 
Sbjct: 73  EAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIA 132

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQS 158
               +++++ +  + S +F   +  +++
Sbjct: 133 AAETVLAKRADTKIQSELFGNAVGQVKT 160


>gi|83945330|ref|ZP_00957678.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
 gi|83851164|gb|EAP89021.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
          Length = 164

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 88/158 (55%), Gaps = 8/158 (5%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D +F  F+ LI+F V+++++  P ++   LD  AD IR ++ EARRLRE+++ ++  Y+ 
Sbjct: 7   DTSFWAFVGLILFFVVIIFVGAPKMIGKALDDRADLIRKELDEARRLREEAQELMATYER 66

Query: 64  KHSKVEEETREIILAAKHRAKILAEEG----CQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           K ++   E   II  AK  A  L +       Q IE+ +A+     EQ+I   + +A + 
Sbjct: 67  KQTEAAAEAEAIIKQAKAEADYLRDNAKTEISQRIERRTAMA----EQRIAQAEAQAAKE 122

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + +  AD +VE   +++S+K+     +++ +   ++++
Sbjct: 123 VKSLAADLAVEAAEQLLSKKLTKTQRNALLKADTAALK 160


>gi|254461067|ref|ZP_05074483.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2083]
 gi|206677656|gb|EDZ42143.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium HTCC2083]
          Length = 186

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 86/152 (56%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V +  ++F+ +++Y +IP++L   LD  A+ IRD++ EA+ LRE+++ +L  Y+ K  
Sbjct: 32  FVVLLGFLLFIGVLLYFKIPALLGGLLDKRAEGIRDELDEAKALREEAQTLLASYERKQK 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+E+   I+ AA+  A + A++  ++++   A  L   + ++   +  A + +      
Sbjct: 92  EVQEQADRIVEAARKDAVLAADQAKEDLKASIARRLAAAQDQLASAEAGAVKEVRDTAVT 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++    ++I+++M     +++ +  IS + S
Sbjct: 152 VAIAAANDVIAKQMTAKNGAALIDDAISEVSS 183


>gi|154251150|ref|YP_001411974.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|226694373|sp|A7HQY4|ATPF1_PARL1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|154155100|gb|ABS62317.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 161

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 79/152 (51%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +   L+ F  I+ Y ++   L + LD  A  I  ++ EARRLRE+++ +L  Y+ K  
Sbjct: 7   FWILACLVAFFAILGYFKVHRTLAATLDKRAADIAAELDEARRLREEAQQLLASYQRKQR 66

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +E  +I+  AK  A+ LA+E   N+E       K  E KI   + +A   + A  A+
Sbjct: 67  EAMKEAEDIVAQAKVEAEQLAKETRANMEIQVERRTKLAEDKIAQAETQALNDVRATAAE 126

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V   R +I+ K++   ++   EK+IS + S
Sbjct: 127 VAVGAARRVIAAKVDAGKDAEFVEKSISELTS 158


>gi|126734941|ref|ZP_01750687.1| ATP synthase F0, B subunit [Roseobacter sp. CCS2]
 gi|126715496|gb|EBA12361.1| ATP synthase F0, B subunit [Roseobacter sp. CCS2]
          Length = 170

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 86/150 (57%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ +IF+ I++Y ++P ++   LD  AD I+ ++ EA+ LRE+++++L  Y+ K  
Sbjct: 16  FVVLIAFVIFIGILLYFKVPGLVGGMLDKRADSIKAELDEAKALREEAQSLLASYERKQK 75

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+E++  I+ AAK  A   A     +I +     L   E++I   +  A + +  +   
Sbjct: 76  EVQEQSARIVAAAKEEATNAATAAKDDIAKSITRRLAAAEEQIASAEASAVKEVRDQAIA 135

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +V   +++I+++M+     ++ + +I+++
Sbjct: 136 VAVGAAKDVIAKQMDAKSAGALIDDSIATV 165


>gi|126724950|ref|ZP_01740793.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2150]
 gi|126706114|gb|EBA05204.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2150]
          Length = 185

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 51/75 (68%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F+  F+V+++ I F+ ++VYL++P  L   LDA A+ IR ++ EA+ LRE+++ +L  Y+
Sbjct: 27  FNTNFVVWLAFIAFIAVLVYLKVPGKLGGALDARANDIRSELDEAKALREEAQTLLASYE 86

Query: 63  EKHSKVEEETREIIL 77
            K  +V E++  II+
Sbjct: 87  RKQREVAEQSERIIV 101


>gi|240139922|ref|YP_002964399.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens AM1]
 gi|254562346|ref|YP_003069441.1| F0F1 ATP synthase subunit b [Methylobacterium extorquens DM4]
 gi|240009896|gb|ACS41122.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens AM1]
 gi|254269624|emb|CAX25595.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens DM4]
          Length = 162

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 59/103 (57%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F V ++ + FLVIV  +   S++ + LD+ A ++R+++ EARRLRE++  +L  YK + +
Sbjct: 7   FWVAVAFVAFLVIVWRVGGFSMMTNGLDSRAKRVRNELDEARRLREEAAAVLADYKRRRT 66

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           + E E   II  A+  A+ +A EG   +    A   K  E KI
Sbjct: 67  EAEREAEAIIAGAREDAERIAAEGHARLNDFVARRTKSAEAKI 109


>gi|218531428|ref|YP_002422244.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           chloromethanicum CM4]
 gi|218523731|gb|ACK84316.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 162

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 59/103 (57%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F V ++ + FLVIV  +   S++ + LD+ A ++R+++ EARRLRE++  +L  YK + +
Sbjct: 7   FWVAVAFVAFLVIVWRVGGFSMMTNGLDSRAKRVRNELDEARRLREEAAAVLADYKRRRT 66

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           + E E   II  A+  A+ +A EG   +    A   K  E KI
Sbjct: 67  EAEREAEAIIAGAREDAERIAAEGHARLNDFVARRTKSAEAKI 109


>gi|163852587|ref|YP_001640630.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           extorquens PA1]
 gi|226741515|sp|A9VYW7|ATPF_METEP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|163664192|gb|ABY31559.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           extorquens PA1]
          Length = 162

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 59/103 (57%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F V ++ + FLVIV  +   S++ + LD+ A ++R+++ EARRLRE++  +L  YK + +
Sbjct: 7   FWVAVAFVAFLVIVWRVGGFSMMTNGLDSRAKRVRNELDEARRLREEAAAVLADYKRRRT 66

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           + E E   II  A+  A+ +A EG   +    A   K  E KI
Sbjct: 67  EAEREAEAIISGAREDAERIAAEGHARLNDFVARRTKSAEAKI 109


>gi|254454347|ref|ZP_05067784.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
 gi|198268753|gb|EDY93023.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
          Length = 190

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 1   MHFDET-FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
            H D T  +V ++ IIF+ +++  ++P +L   LD  A+ I+ DI EA+ LRE+++ +L 
Sbjct: 29  WHLDNTDLIVLIAFIIFIGVLLKYKVPGMLTGLLDKRAEGIKSDIDEAKALREEAQTLLA 88

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            Y+ K  +V+ +   I+  AK  A +  E+  ++I+      L   E +I   K  A R
Sbjct: 89  SYERKQREVQAQADRIVANAKEEATLAGEQAKEDIKSSIVRRLAAAEDQIASAKASAIR 147


>gi|15888061|ref|NP_353742.1| F0F1 ATP synthase subunit B [Agrobacterium tumefaciens str. C58]
 gi|226694431|sp|A9CK01|ATPF_AGRT5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|15155685|gb|AAK86527.1| ATP synthase B chain [Agrobacterium tumefaciens str. C58]
          Length = 161

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 45/65 (69%)

Query: 1  MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
          M FD +F   + L++F V++ YL++P +L   LD  A  I+D++ EA+RLRE+++++L +
Sbjct: 1  MAFDASFFALVGLVLFFVLIAYLKVPGMLSKSLDERAQNIQDELAEAKRLREEAQHLLAE 60

Query: 61 YKEKH 65
          Y+ K 
Sbjct: 61 YQRKR 65


>gi|312114303|ref|YP_004011899.1| H+transporting two-sector ATPase B/B' subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219432|gb|ADP70800.1| H+transporting two-sector ATPase B/B' subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 161

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 82/155 (52%), Gaps = 4/155 (2%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D    V ++ ++F+ +++Y  IP + L  LD  +D I  ++ EAR+LR ++E +L  
Sbjct: 1   MLMDPEVWVAIAFVLFICLILYYNIPGMALKALDQRSDAIGRELEEARKLRAEAETLLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK++ +  E E  EII  A+  A   A E   + +++    L   EQKI   + +A++ +
Sbjct: 61  YKQRAANAEIEAGEIIAQAEREAAAYATEARASFDELITRRLSVAEQKIKLEEEKARKQI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
            AK A+ +V    +++  K    V   I E TI++
Sbjct: 121 RAKAAELAVSAAEQLLQHK----VTGKIAENTITA 151


>gi|188582608|ref|YP_001926053.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           populi BJ001]
 gi|226741513|sp|B1ZJN2|ATPF_METPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|179346106|gb|ACB81518.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           populi BJ001]
          Length = 162

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 58/103 (56%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F V ++ + FLVIV  +   S++ S LD+ A ++R ++ EARRLRE++  +L  YK + +
Sbjct: 7   FWVAVAFVAFLVIVWRVGGFSMMTSGLDSRAKRVRHELDEARRLREEAAAVLADYKRRRT 66

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           + E E   I+  A+  A+ +A EG   +    A   K  E KI
Sbjct: 67  EAEREAEAIVAGAREDAERIAAEGHARLNDFVARRTKAAEAKI 109


>gi|325292103|ref|YP_004277967.1| ATP synthase B chain [Agrobacterium sp. H13-3]
 gi|325059956|gb|ADY63647.1| ATP synthase B chain [Agrobacterium sp. H13-3]
          Length = 161

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 45/65 (69%)

Query: 1  MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
          M FD +F   + L++F V++ YL++P +L   LD  A  I+D++ EA+RLRE+++++L +
Sbjct: 1  MAFDASFFALVGLVLFFVLIAYLKVPGMLSKSLDERAQNIQDELAEAKRLREEAQHLLAE 60

Query: 61 YKEKH 65
          Y+ K 
Sbjct: 61 YQRKR 65


>gi|146343460|ref|YP_001208508.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. ORS278]
 gi|226741313|sp|A4Z2B7|ATPF_BRASO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146196266|emb|CAL80293.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. ORS278]
          Length = 164

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 61/111 (54%), Gaps = 2/111 (1%)

Query: 1   MHF--DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           MH   D    V ++ +I + +  YL +  ++L  LD  AD+IRD++ EA+RL++++  +L
Sbjct: 2   MHLLADPETWVAIAFVILMGLFAYLGVHRMVLKALDHRADRIRDELAEAKRLKDEAAKVL 61

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
             YK + +  E E  EI+ +AK  A+ +A +    +E   A   K  E KI
Sbjct: 62  ADYKTRRASAEREAEEIVTSAKAEAERIAADAKAKMEDFVARRTKAAESKI 112


>gi|304320006|ref|YP_003853649.1| ATP synthase F0 subunit B [Parvularcula bermudensis HTCC2503]
 gi|303298909|gb|ADM08508.1| ATP synthase F0, B subunit [Parvularcula bermudensis HTCC2503]
          Length = 194

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D  F V ++ +I + I ++  +P ++ SFL A A+ ++  + EAR LRE+++  L  +++
Sbjct: 37  DTNFWVLLAFLIVVGIFLWQGVPKMIGSFLSARAEGVQRQLDEARTLREEAQRTLADFQK 96

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  + E E   II  AK  AK +A E    +++  A   K  E +I   + +A   +  +
Sbjct: 97  RQREAETEAEAIIEQAKADAKSVATEARAKLDEQIARRRKAAEDRIARAEAQAIAEIRGR 156

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            AD ++   REII+ +M+D     + ++ I+ + +
Sbjct: 157 TADMAIAAAREIIANRMDDRSQGQLIDRAINEVGT 191


>gi|299134065|ref|ZP_07027258.1| H+transporting two-sector ATPase B/B' subunit [Afipia sp. 1NLS2]
 gi|298590812|gb|EFI51014.1| H+transporting two-sector ATPase B/B' subunit [Afipia sp. 1NLS2]
          Length = 161

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 81/152 (53%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F V ++ ++ L I  Y  +   + + LD  + +IR ++ +ARRL+E++++++ +Y+ +  
Sbjct: 7   FWVAVAFVLMLAIFGYFGVHRTIAAALDNRSARIRKELDDARRLKEEAQSLVAEYRARRQ 66

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             E E +EI+ AAK  A+ +A E    +E   A   K  E KI   + +A   + A  A+
Sbjct: 67  SAEREAQEIVAAAKADAERIAVEAKAKMEDFVARRTKSAENKIAQAETQAVADVRAAAAE 126

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +      ++SQ +  DV + + EK+I  + S
Sbjct: 127 AAATAAASVLSQTVKGDVANGLIEKSIKELGS 158


>gi|146276249|ref|YP_001166408.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides ATCC 17025]
 gi|226694456|sp|A4WNY9|ATPF_RHOS5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145554490|gb|ABP69103.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 184

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I+VY ++P  +L  LD  A +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILVYAKVPGRILGMLDRRAVQIRSELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   +++   A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLKASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++++++M     S+  +++I  +++
Sbjct: 147 AISVAVAAASDVLARQMTPAATSASIDESIKEVEA 181


>gi|56698065|ref|YP_168436.1| F0F1 ATP synthase subunit B [Ruegeria pomeroyi DSS-3]
 gi|81349060|sp|Q5LNH2|ATPF_SILPO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56679802|gb|AAV96468.1| ATP synthase F0, B subunit [Ruegeria pomeroyi DSS-3]
          Length = 190

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 59/89 (66%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ ++ Y ++PS++   LD  A+ I+ D+ EAR+LRE+++++L  ++ K  
Sbjct: 36  FVVTIAFLVFIAVLFYFKVPSMIGGALDKRAEGIQSDLDEARKLREEAQSLLASFERKQK 95

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIE 95
           +++ +   I+ AAK  A+  AE+   ++E
Sbjct: 96  EMQGQADAIVAAAKEEAQRSAEQAKVDLE 124


>gi|84684306|ref|ZP_01012208.1| ATP synthase F0, B subunit [Maritimibacter alkaliphilus HTCC2654]
 gi|84668059|gb|EAQ14527.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2654]
          Length = 185

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 49/70 (70%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ I+F++++VY ++P ++   LD  AD I+ ++ EAR LRE+++ IL  Y+ K  
Sbjct: 31  FIVLLAFILFVLVLVYFKVPGMIGGMLDKRADTIKAELEEARALREEAQTILASYERKQQ 90

Query: 67  KVEEETREII 76
           +V+++  +I+
Sbjct: 91  EVKDQAAQIV 100


>gi|298294370|ref|YP_003696309.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
 gi|296930881|gb|ADH91690.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
          Length = 160

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 64/112 (57%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +T  V ++ +IF+ IV      S + + LDA  ++IR ++ EAR+L+E+++ ++ +YK +
Sbjct: 4   DTLWVAVAFVIFMAIVARAGAFSGIAAKLDARGERIRHELEEARKLKEEAQKLVAEYKRR 63

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
             + E+E   II  AK  A+ LA E    +E + A   K  EQKI   + +A
Sbjct: 64  QREAEDEAEAIITTAKAEAERLAAETKAKLEDMIARRTKMAEQKIAQAEAQA 115


>gi|84500334|ref|ZP_00998600.1| ATP synthase F0, B subunit [Oceanicola batsensis HTCC2597]
 gi|84392268|gb|EAQ04536.1| ATP synthase F0, B subunit [Oceanicola batsensis HTCC2597]
          Length = 185

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 49/77 (63%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V +  ++F+ +++Y  +P +L+  LD  AD+IR ++ EA+ LRE+++ +L  Y+ K  
Sbjct: 31  FIVLLGFLLFIAVLIYFGVPGMLMGMLDKRADQIRSELDEAKSLREEAQALLASYERKQK 90

Query: 67  KVEEETREIILAAKHRA 83
           +V+ +   I+  A+  A
Sbjct: 91  EVQAQADRIVETARKEA 107


>gi|163743800|ref|ZP_02151173.1| ATP synthase F0, B subunit [Phaeobacter gallaeciensis 2.10]
 gi|161382949|gb|EDQ07345.1| ATP synthase F0, B subunit [Phaeobacter gallaeciensis 2.10]
          Length = 186

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 50/75 (66%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++Y ++P +L   LDA A+ I+ D+ EAR LRE+++ IL  Y+ K  
Sbjct: 32  FVVTLAFLLFVGILLYAKVPGLLGGQLDARAEGIKKDLEEARALREEAQTILASYERKQQ 91

Query: 67  KVEEETREIILAAKH 81
           +V+ +   I+ +A+ 
Sbjct: 92  EVQAQADRIVASARE 106


>gi|163738206|ref|ZP_02145622.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
 gi|161388822|gb|EDQ13175.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 186

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 50/75 (66%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++Y ++P +L   LDA A+ I+ D+ EAR LRE+++ IL  Y+ K  
Sbjct: 32  FVVTLAFLLFVGILLYAKVPGLLGGQLDARAEGIKKDLEEARALREEAQTILASYERKQQ 91

Query: 67  KVEEETREIILAAKH 81
           +V+ +   I+ +A+ 
Sbjct: 92  EVQAQADRIVASARE 106


>gi|254475959|ref|ZP_05089345.1| ATP synthase B chain [Ruegeria sp. R11]
 gi|214030202|gb|EEB71037.1| ATP synthase B chain [Ruegeria sp. R11]
          Length = 185

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 51/74 (68%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++Y ++PS+L   LD+ A+ I+ D+ EAR LRE+++ IL  Y+ K  
Sbjct: 31  FVVTLAFLLFIGILLYAKVPSLLGGQLDSRAEGIKKDLEEARALREEAQTILASYERKQQ 90

Query: 67  KVEEETREIILAAK 80
           +V+ +   I+ +A+
Sbjct: 91  EVQAQADRIVASAR 104


>gi|90426284|ref|YP_534654.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
 gi|122474863|sp|Q20X01|ATPF_RHOPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|90108298|gb|ABD90335.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
          Length = 164

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 79/154 (51%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V ++ +I + +  Y  +   +L  LD   D+I+ ++ EA RL+E++  +L +YK +
Sbjct: 9   ETW-VAVAFVILMGVFAYFGVHRTVLKSLDNRRDRIKAELDEAARLKEEAAALLAEYKAR 67

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  E E +EII  AK  A+ +A E    +E   A   K  E KI   + +A   + +  
Sbjct: 68  RASAEREAQEIIAGAKDEAERIAAEAKAKLEDFVARRTKTAEGKIALAEAQAVADVRSAA 127

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A+ +V     I+SQ +   V   + ++ I  ++S
Sbjct: 128 ANAAVAAASTILSQSVKGQVAEGLLQRGIEEVRS 161


>gi|260574859|ref|ZP_05842861.1| H+transporting two-sector ATPase B/B' subunit [Rhodobacter sp. SW2]
 gi|259022864|gb|EEW26158.1| H+transporting two-sector ATPase B/B' subunit [Rhodobacter sp. SW2]
          Length = 184

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 49/77 (63%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  +IFL  +VY ++P IL   LD  A +I+ D+ EAR LR++++ IL  Y+ 
Sbjct: 27  NTNFVVLVGFLIFLAALVYFKVPGILGGLLDKRAVQIKSDLEEARALRDEAKEILASYER 86

Query: 64  KHSKVEEETREIILAAK 80
           K  +V+ ++  I+ +A+
Sbjct: 87  KQREVQAQSDRIVASAR 103


>gi|126732371|ref|ZP_01748171.1| ATP synthase F0, B subunit [Sagittula stellata E-37]
 gi|126707240|gb|EBA06306.1| ATP synthase F0, B subunit [Sagittula stellata E-37]
          Length = 185

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 51/78 (65%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++FLV++VY  +P++L   LD  A+ I+ ++ EARR+RE+++ +L  Y+ 
Sbjct: 28  NTNFIVLIAFLLFLVVLVYFNVPAMLGKLLDKRAEDIQSELDEARRIREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKH 81
           K   V+++   I+  A+ 
Sbjct: 88  KQRDVQDQADRIVAHARQ 105


>gi|148252426|ref|YP_001237011.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
 gi|226741346|sp|A5EAB1|ATPF_BRASB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146404599|gb|ABQ33105.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
          Length = 163

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 81/158 (51%), Gaps = 2/158 (1%)

Query: 1   MHF--DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           MH   D    V ++ +I + +  YL +   +L  LD  A++IR+++ EA+RL++++  +L
Sbjct: 1   MHLLADPETWVAIAFVILMGLFAYLGVHRTVLKALDHRAERIRNELEEAKRLKQEAAKVL 60

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             YK + +  E E  EI+ +AK  A+ +A +    +E   A   K  E KI   + +A  
Sbjct: 61  ADYKARRASAEREAEEIVTSAKAEAERIAADAKAKMEDFVARRTKAAESKIALAEAQALA 120

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            + +  AD +V+    ++SQ +   +   +  K I+ +
Sbjct: 121 DVRSAAADAAVQAAATVLSQSVKGSLGEDLVAKGIAEV 158


>gi|114769967|ref|ZP_01447577.1| ATP synthase F0, B subunit [alpha proteobacterium HTCC2255]
 gi|114549672|gb|EAU52554.1| ATP synthase F0, B subunit [alpha proteobacterium HTCC2255]
          Length = 185

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 51/74 (68%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++YL++P  L   LD  A+ I+ ++ EAR LRE++++IL +Y+ 
Sbjct: 28  NTNFVVLIAFLLFVGLLIYLKVPGKLSGMLDERANGIQSELDEARSLREEAQSILAEYER 87

Query: 64  KHSKVEEETREIIL 77
           K  +V+ +  +IIL
Sbjct: 88  KQKEVQNQADQIIL 101


>gi|149915445|ref|ZP_01903972.1| ATP synthase F0, B subunit [Roseobacter sp. AzwK-3b]
 gi|149810734|gb|EDM70575.1| ATP synthase F0, B subunit [Roseobacter sp. AzwK-3b]
          Length = 184

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 48/70 (68%)

Query: 7  FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
          F+V +  ++F+ I++Y ++PS+L   LD  A+ I+ ++ EAR LR++++ +L  Y+ K  
Sbjct: 30 FVVTLGFLVFIGILLYFKVPSLLGGLLDKRAEGIKSELDEARALRDEAQTLLAGYERKQK 89

Query: 67 KVEEETREII 76
          +V+E++  II
Sbjct: 90 EVQEQSERII 99


>gi|221640528|ref|YP_002526790.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides KD131]
 gi|221161309|gb|ACM02289.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides KD131]
          Length = 184

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILLYAKVPGRILGMLDKRSVQIRTELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 147 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 181


>gi|283856305|ref|YP_162406.2| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775301|gb|AAV89295.2| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 212

 Score = 59.7 bits (143), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 86/159 (54%), Gaps = 4/159 (2%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V +S+I+FL+++V+ ++PSI+ S LD   D+IR  + +A RLR+++E +  +
Sbjct: 49  LGLSGPAWVSVSIIVFLLVLVWKKVPSIITSGLDKQIDEIRTRLGDAERLRKEAEALKAE 108

Query: 61  YKEKHSKVEEETREIILAAKHRA-KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           Y EK  +   E   II  AK  A  I+A+   Q+ +Q+     K   ++I   + EA   
Sbjct: 109 YDEKTRQATSEAEAIIERAKEDASSIIADAKIQS-QQLVERRQKMATEQIAAAEQEAVAE 167

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIF-EKTISSIQ 157
           +    A  +++   +II QK ND  +  +  ++TI S++
Sbjct: 168 IRQTAAKLALQAATQII-QKQNDASHDKVLIDQTIDSLK 205


>gi|126463456|ref|YP_001044570.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides ATCC 17029]
 gi|332559509|ref|ZP_08413831.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
 gi|226694455|sp|A3PN82|ATPF_RHOS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|126105120|gb|ABN77798.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332277221|gb|EGJ22536.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
          Length = 184

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILLYAKVPGRVLGMLDKRSVQIRTELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 147 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 181


>gi|241761302|ref|ZP_04759390.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752834|ref|YP_003225727.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|241374209|gb|EER63706.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258552197|gb|ACV75143.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 212

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 85/159 (53%), Gaps = 4/159 (2%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V  S+I+FL+++V+ ++PSI+ S LD   D+IR  + +A RLR+++E +  +
Sbjct: 49  LGLSGPAWVSASIIVFLLVLVWKKVPSIITSGLDKQIDEIRTRLGDAERLRKEAEALKAE 108

Query: 61  YKEKHSKVEEETREIILAAKHRA-KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           Y EK  +   E   II  AK  A  I+A+   Q+ +Q+     K   ++I   + EA   
Sbjct: 109 YDEKTRQATSEAEAIIERAKEDASSIIADAKIQS-QQLVERRQKMATEQIAAAEQEAVAE 167

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIF-EKTISSIQ 157
           +    A  +++   +II QK ND  +  +  ++TI S++
Sbjct: 168 IRQTAAKLALQAATQII-QKQNDASHDKVLIDQTIDSLK 205


>gi|254487002|ref|ZP_05100207.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
 gi|214043871|gb|EEB84509.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
          Length = 186

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 85/152 (55%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ I+F+ ++ Y ++PS++   LD  A  I+ ++ EAR LRE+++ +L  Y+ K  
Sbjct: 32  FVVLLAFILFIGVLFYFKVPSLIAGMLDKRATGIKSELEEARALREEAQTLLASYERKQQ 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+++   I+ AAK  A   A++   ++E+  A  +   + +I   +  A + +  +   
Sbjct: 92  EVKDQADRIVTAAKAEAHEAADQARADLEKSIARRVATAQDQIESAQAAAVKEVRDQAII 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V   +++I++KM     +++ +  I+ + S
Sbjct: 152 IAVAAAKDVIAKKMTAAEGNALIDSAIADVDS 183


>gi|77464616|ref|YP_354120.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides 2.4.1]
 gi|123590921|sp|Q3IZ15|ATPF_RHOS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77389034|gb|ABA80219.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides 2.4.1]
          Length = 187

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 30  NTNFIVTLAFLLFMGILLYAKVPGRILGMLDKRSVQIRTELEEARALREEARTILASYDR 89

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 90  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 149

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 150 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 184


>gi|86137237|ref|ZP_01055815.1| ATP synthase F0, B subunit [Roseobacter sp. MED193]
 gi|85826561|gb|EAQ46758.1| ATP synthase F0, B subunit [Roseobacter sp. MED193]
          Length = 186

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 49/73 (67%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ I++++++PS+L   LDA A+ I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTNFVVLLGFLLFVGILLFVKVPSLLGGQLDARAEGIQKELDEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREII 76
           K  +V+ +   I+
Sbjct: 89  KQQEVQAQADRIV 101


>gi|310814623|ref|YP_003962587.1| ATP synthase F0, B subunit [Ketogulonicigenium vulgare Y25]
 gi|308753358|gb|ADO41287.1| ATP synthase F0, B subunit [Ketogulonicigenium vulgare Y25]
          Length = 188

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 49/70 (70%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ ++++ ++P++++  LDA A+ IR  + EAR LR+++  +L  Y++K  
Sbjct: 34  FVVLLAFLLFIGVLIWAKVPALIVRVLDARAETIRAQLAEARALRDEAAALLASYEQKQK 93

Query: 67  KVEEETREII 76
           +V+E+   I+
Sbjct: 94  EVQEQAARIV 103


>gi|159045567|ref|YP_001534361.1| F0F1 ATP synthase subunit B [Dinoroseobacter shibae DFL 12]
 gi|226694396|sp|A8LKH7|ATPF2_DINSH RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|157913327|gb|ABV94760.1| ATP synthase F0 [Dinoroseobacter shibae DFL 12]
          Length = 186

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 45/70 (64%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V +S I F+ ++VY +IP IL   LD  A+ I+ ++ EA+ LRE+++ +L  Y+ K  
Sbjct: 32  FIVLISFIAFIGVLVYFKIPGILSGMLDKRAEGIKAELEEAKALREEAQTLLASYERKQR 91

Query: 67  KVEEETREII 76
           +V+ +   I+
Sbjct: 92  EVQAQADAIV 101


>gi|89053261|ref|YP_508712.1| F0F1 ATP synthase subunit B [Jannaschia sp. CCS1]
 gi|122999622|sp|Q28UC5|ATPF_JANSC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|88862810|gb|ABD53687.1| ATP synthase F0 subcomplex B subunit [Jannaschia sp. CCS1]
          Length = 190

 Score = 57.4 bits (137), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 55/96 (57%)

Query: 25  IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAK 84
           +P +L   LDA A+ IR ++ EAR LRE+++ +L  Y+ K  +VEE++  I+  A+  A+
Sbjct: 54  VPKMLGGMLDARAEGIRSELDEARALREEAQTLLASYERKAREVEEQSARIVTEARANAE 113

Query: 85  ILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             AE+   +IE+     L   E +I   + +A R +
Sbjct: 114 TAAEQAKADIERSITRRLAAAEDQIASAEAKASRAV 149


>gi|27376296|ref|NP_767825.1| FoF1 ATP synthase B chain [Bradyrhizobium japonicum USDA 110]
 gi|81739769|sp|Q89V71|ATPF_BRAJA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|27349436|dbj|BAC46450.1| FoF1 ATP synthase B chain [Bradyrhizobium japonicum USDA 110]
          Length = 161

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 80/157 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD    V ++ +I +V+  YL +    ++ LD  A +I+ ++ +A RL++++  +L  
Sbjct: 1   MFFDPETWVAIAFVILMVVFGYLGVFKSAMTALDHRAARIKAELDDATRLKQEAAKVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + +  E E  +II  AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 61  YKARSATAEREAADIIANAKVEAERIATEAKAKMEDFVARRTKTAESKIALAEAQAVADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A  A+ +V+    I+SQ +   V   +  K+IS ++
Sbjct: 121 RAAAAEAAVQAASTILSQSVKGQVADDLLAKSISEVR 157


>gi|255264092|ref|ZP_05343434.1| ATP synthase B chain (Subunit I) [Thalassiobium sp. R2A62]
 gi|255106427|gb|EET49101.1| ATP synthase B chain (Subunit I) [Thalassiobium sp. R2A62]
          Length = 185

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 45/70 (64%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ ++ Y ++PS+L   LD  A  I+ D+ EA+ LRE+++ +L  Y+ K  
Sbjct: 31  FVVLLAFLLFIGVLFYFKVPSLLSGMLDGRATGIQADLDEAKALREEAQTLLASYERKQK 90

Query: 67  KVEEETREII 76
           +V+ +   I+
Sbjct: 91  EVQAQADRIV 100


>gi|154245919|ref|YP_001416877.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
 gi|226694371|sp|A7IGS7|ATPF1_XANP2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|154160004|gb|ABS67220.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
          Length = 163

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 60/110 (54%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++ ++F+ I++Y+     + S LD+   +I  ++ EARRL+E+++ ++ ++K K  
Sbjct: 9   LWVAVAFLLFVGILIYVGAHRAIGSALDSRGQRIAAELEEARRLKEEAQKLVAEFKRKQR 68

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
           + E E   I+ AAK  A+ LA E    +E       K  E KI   +L+A
Sbjct: 69  EAEAEAESIVTAAKAEAERLASEAKAKLEDFVTRRTKMAEDKIAQAELQA 118


>gi|302383815|ref|YP_003819638.1| H+transporting two-sector ATPase B/B' subunit [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194443|gb|ADL02015.1| H+transporting two-sector ATPase B/B' subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 171

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 57/99 (57%), Gaps = 4/99 (4%)

Query: 2   HF----DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENI 57
           HF    +    V + L+IF+ I +   +P ++   LDA A KI+ ++ EA+RLR ++E +
Sbjct: 8   HFYNLSEPELWVGIGLLIFIGIAIAAGVPKLVAGTLDARAAKIQSELDEAQRLRAEAEAL 67

Query: 58  LMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ 96
           L Q + + +  + + RE++ AA+  A+I+  E    +E+
Sbjct: 68  LAQIRAEKAAADIQAREMLAAAEADARIMEAEAKVRLEE 106


>gi|114705287|ref|ZP_01438195.1| F0F1 ATP synthase subunit B' [Fulvimarina pelagi HTCC2506]
 gi|114540072|gb|EAU43192.1| F0F1 ATP synthase subunit B' [Fulvimarina pelagi HTCC2506]
          Length = 156

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 4  DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
          D +F   ++L++F  +V Y++    +   LD  + +IR ++ EAR L+E+++  L +Y+ 
Sbjct: 2  DNSFWTLIALLVFFGVVFYVKGFRRINQSLDERSKRIRTELEEARELKEEAKQQLAEYQR 61

Query: 64 KHSKVEEETREIILAAKHRA-KILAEEGCQNIE 95
          +  + E+E ++II AAK  A ++LAE   +N E
Sbjct: 62 RRREAEQEAQDIIEAAKREAQQMLAETAKKNKE 94


>gi|8708912|gb|AAF78803.1| Fo ATP synthase B chain [Bradyrhizobium japonicum]
          Length = 169

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 60/116 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD    V ++ +I +V+  YL +    ++ LD  A +I+ ++ +A RL++++  +L  
Sbjct: 10  MFFDPETWVAIAFVILMVVFGYLGVFKSAMTALDHRAARIKAELDDATRLKQEAAKVLAD 69

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
           YK + +  E E  +II  AK  A+ +A E    +E   A   K  E KI   + +A
Sbjct: 70  YKARSATAEREAADIIANAKVEAERIATEAKAKMEDFVARRTKTAESKIALAEAQA 125


>gi|83951212|ref|ZP_00959945.1| ATP synthase F0, B subunit [Roseovarius nubinhibens ISM]
 gi|83839111|gb|EAP78407.1| ATP synthase F0, B subunit [Roseovarius nubinhibens ISM]
          Length = 185

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 46/73 (63%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +S ++F+ ++V L++P  +   LD  A  I+ D+ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTNFVVLISFLLFVGLIVALKVPGKIGEMLDKRAAGIKSDLDEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREII 76
           K  +V+++   I+
Sbjct: 88  KQKEVQDQAARIV 100


>gi|182677733|ref|YP_001831879.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|226694366|sp|B2IGK8|ATPF1_BEII9 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|182633616|gb|ACB94390.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 161

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 64/109 (58%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M F+E F V +  +IF+ I++Y  + + L + LD  AD+IR+D+  A RLRE++  +L  
Sbjct: 1   MEFNEEFYVALGFVIFVAILLYYGVHNKLNAALDKRADRIREDLAHAVRLREEAAALLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           ++++ ++ E E   ++  A+  A+++A+E  + + +      +  E KI
Sbjct: 61  FEKRKAEAEAEAEALVAQARTEAEMIAKEAHERLAEFVQRRTQQAENKI 109


>gi|99082431|ref|YP_614585.1| F0F1 ATP synthase subunit B [Ruegeria sp. TM1040]
 gi|123378663|sp|Q1GDE3|ATPF_SILST RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|99038711|gb|ABF65323.1| H+-transporting two-sector ATPase B/B' subunit [Ruegeria sp.
           TM1040]
          Length = 185

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 82/152 (53%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++  ++PS++   LD  AD I+ ++ EAR LRE+++ +L  Y+ K  
Sbjct: 31  FVVILAFLLFIGILLAAKVPSLIGKQLDNRADSIKSELEEARALREEAQTLLASYERKQQ 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            V+ +   I+  A+  A   AE+   ++    A  L   E++I   +  A + +  +   
Sbjct: 91  DVQAQAERIVANARDEAAAAAEQAKADLAASIARRLTAAEEQIASAEASAVKEVRDRAIT 150

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +VE+  ++IS++M     + + +  I  +++
Sbjct: 151 IAVEVADQVISKQMTAADANKLIDAAIQDVEA 182


>gi|259417462|ref|ZP_05741381.1| ATP synthase B chain (Subunit I) [Silicibacter sp. TrichCH4B]
 gi|259346368|gb|EEW58182.1| ATP synthase B chain (Subunit I) [Silicibacter sp. TrichCH4B]
          Length = 185

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 76/135 (56%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++  ++PS++   LD  AD I+ ++ EAR LRE+++ +L  Y+ K  
Sbjct: 31  FVVVLAFLLFIGILLAAKVPSLIGKQLDNRADSIKSELEEARALREEAQTLLASYERKQQ 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            V+ +   I+  A+  A   AE+   ++    A  L   E++I   +  A + +  +   
Sbjct: 91  DVQAQAERIVANARDEAAAAAEQAKADLAASIARRLAAAEEQISSAEASAVKEVRDRAIT 150

Query: 127 FSVEIVREIISQKMN 141
            +VE+  ++IS++M+
Sbjct: 151 IAVEVADQVISKQMS 165


>gi|254293423|ref|YP_003059446.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
 gi|254041954|gb|ACT58749.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
          Length = 204

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 44/68 (64%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D TF   ++++IFL I+V+ +IP+ +   LD  A KI+D++  AR LREK++  L + + 
Sbjct: 46  DPTFWATIAVLIFLGILVWKKIPATIAKSLDDRAQKIQDELDNARLLREKAQAALAEAER 105

Query: 64  KHSKVEEE 71
             ++ EE+
Sbjct: 106 SQAQAEED 113


>gi|316932387|ref|YP_004107369.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris DX-1]
 gi|315600101|gb|ADU42636.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 163

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V +S +I L +  YL +   +L  LD   D+I+ ++ EAR+L++++  +L  Y+ +
Sbjct: 8   ETW-VAISFVILLGVFAYLGVHRTVLQALDKRRDRIKAELDEARKLKDEAAKLLADYRAR 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
            +  E E + I+ +AK  A+ +A E    +E   A   K  E KI
Sbjct: 67  RASAEREAQAIVESAKADAERIAAEAKAKLEDFVARRTKSAESKI 111


>gi|89069738|ref|ZP_01157074.1| ATP synthase F0, B subunit [Oceanicola granulosus HTCC2516]
 gi|89044684|gb|EAR50795.1| ATP synthase F0, B subunit [Oceanicola granulosus HTCC2516]
          Length = 185

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK 80
           VY ++P +L   LD  AD IR +I EA+ LRE+++++L  Y+ K   V+ +   I+  A+
Sbjct: 45  VYFKVPGMLTKMLDERADSIRKEIDEAKALREEAQSLLASYERKQKDVQAQADRIVENAR 104

Query: 81  HRAKILAEEGCQNIEQISALYLKDLEQKI 109
             A   AE+   +I+   A  L   E++I
Sbjct: 105 AEANSAAEQAKTDIQTSVARRLAAAEEQI 133


>gi|254437689|ref|ZP_05051183.1| ATP synthase B/B' CF(0) family [Octadecabacter antarcticus 307]
 gi|198253135|gb|EDY77449.1| ATP synthase B/B' CF(0) family [Octadecabacter antarcticus 307]
          Length = 194

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 54/96 (56%), Gaps = 1/96 (1%)

Query: 1   MHFDET-FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
              D T  +V ++ +IF+ +++  +IP++L+  LD  A  I+ +I EA+ LRE ++ +L 
Sbjct: 33  WRLDNTDLIVLIAFVIFVGVLIKYKIPAMLMGLLDKRAADIKSEIDEAKALREDAQTLLA 92

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIE 95
            Y+ K   V+ +   I+  AK  A    E+  ++I+
Sbjct: 93  SYERKQRDVQVQADRIVENAKEEATRAGEQAKEDIK 128


>gi|254465155|ref|ZP_05078566.1| ATP synthase B chain [Rhodobacterales bacterium Y4I]
 gi|206686063|gb|EDZ46545.1| ATP synthase B chain [Rhodobacterales bacterium Y4I]
          Length = 186

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 83/152 (54%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ ++F+ I++  ++P +L + LD  A+ I+ ++ EAR LRE+++ IL  Y+ K  
Sbjct: 32  FVVLLAFLLFVGILLLAKVPGLLGNQLDNRAEAIQKELDEARALREEAQTILASYERKQQ 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+ +  +I+ AA+  A   AE    ++E   A  L   +++I   +  A R +  +   
Sbjct: 92  EVQAQADQIVAAARDEAARAAEVAKADLETSIARRLAAAQEQIASAEASAVREVRDQAIS 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V    E+IS++M     + + +  I+ + +
Sbjct: 152 IAVAAADEVISKQMTAAEANKLIDAAIADVDA 183


>gi|209883847|ref|YP_002287704.1| H+-transporting two-sector ATPase, B/B' subunit [Oligotropha
           carboxidovorans OM5]
 gi|226694331|sp|B6JDC7|ATPF_OLICO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209872043|gb|ACI91839.1| H+-transporting two-sector ATPase, B/B' subunit [Oligotropha
           carboxidovorans OM5]
          Length = 161

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 82/153 (53%), Gaps = 1/153 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +H  ET+ V ++ ++ + + +Y     ++   LD  + +IR ++ +AR+L+E+++ ++ +
Sbjct: 2   LHEAETW-VAVAFVLMVALFIYFGAHRMIGEALDRRSARIRKELDDARQLKEEAQKLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ +    E E +EI+ AA+  A+ +A+E    +E   A   K  E KI   + +A   +
Sbjct: 61  YRSRRESAEREAQEIVAAAQADAERIAQEAKAKMEDFVARRTKAAESKIAQAETQAVADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            A  A+ +      ++SQ +   +  ++ EK+I
Sbjct: 121 RAAAAEAAAAAAANVLSQTVKGSIADNLIEKSI 153


>gi|126738037|ref|ZP_01753758.1| ATP synthase F0, B subunit [Roseobacter sp. SK209-2-6]
 gi|126720534|gb|EBA17239.1| ATP synthase F0, B subunit [Roseobacter sp. SK209-2-6]
          Length = 185

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 46/70 (65%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +V +  ++F+ I++++++PS+L   LD  AD I+ ++ EAR LRE+++ +L  Y+ K  
Sbjct: 31  LVVALGFLLFVGILLFVKVPSLLGKQLDNRADGIQKELDEARALREEAQTVLADYERKQQ 90

Query: 67  KVEEETREII 76
           +V+ +   I+
Sbjct: 91  EVQAQADSIV 100


>gi|296446969|ref|ZP_06888904.1| H+transporting two-sector ATPase B/B' subunit [Methylosinus
           trichosporium OB3b]
 gi|296255536|gb|EFH02628.1| H+transporting two-sector ATPase B/B' subunit [Methylosinus
           trichosporium OB3b]
          Length = 158

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFD    V +   IF+V++ ++     L + LD+   +I+ ++ EA RLR ++E +L  
Sbjct: 1   MHFDAELFVAVGFGIFVVVLFWVGAHRKLGAALDSRVHRIKSELAEAERLRSEAEILLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           +++K  + E E + I+  AK  A++LA+E  Q +E+      K +E KI
Sbjct: 61  FEKKREEAEAEAKAIVAQAKSEAEMLAQEARQRLEEFVTRRTKQVEDKI 109


>gi|58039570|ref|YP_191534.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
 gi|81352058|sp|Q5FRW8|ATPF1_GLUOX RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|58001984|gb|AAW60878.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
          Length = 166

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 82/161 (50%), Gaps = 3/161 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D  F   ++ ++F VI    ++   +   LDA AD +R D+ EA RLR ++E +L  
Sbjct: 1   MFHDPRFWTALAFVLFFVIFGR-KLWVAITGHLDARADSVRHDLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  K   ET+ ++  ++  A  LAE   ++ E  +A Y K  + +IH  +  A R +
Sbjct: 60  ANREREKTLAETQAMLARSEAEAAGLAERARKDAEAAAARYEKMAQDRIHAAERSAIREI 119

Query: 121 YAKIADFSVEIVREIISQKMND--DVNSSIFEKTISSIQSC 159
             + A  +V   R+++S ++ +  D+ +++ +K I S+   
Sbjct: 120 QDRAAQIAVAAARDVVSTRLTESPDIAATLIDKGIDSLPEA 160


>gi|39933920|ref|NP_946196.1| H+-transporting two-sector ATPase subunit B/B' [Rhodopseudomonas
           palustris CGA009]
 gi|192289339|ref|YP_001989944.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|81698371|sp|Q6NBI5|ATPF_RHOPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694454|sp|B3QF34|ATPF_RHOPT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|39647767|emb|CAE26287.1| putative Fo ATP synthase B chain [Rhodopseudomonas palustris
           CGA009]
 gi|192283088|gb|ACE99468.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 163

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 1/105 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V ++ +I L +  YL +   +L  LD   D+I+ ++ EAR+L++++  +L  Y+ +
Sbjct: 8   ETW-VAIAFVILLGVFAYLGVHRTVLQALDKRRDRIKAELDEARKLKDEAAKLLADYRAR 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
            +  E E + I+ +AK  A+ +A E    +E   A   K  E KI
Sbjct: 67  RASAEREAQAIVDSAKADAERIAAEAKAKLEDFVARRTKTAESKI 111


>gi|330813669|ref|YP_004357908.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486764|gb|AEA81169.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 162

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 92/162 (56%), Gaps = 10/162 (6%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF V +S  +F++++VY ++P I+ + L+    +I++ + +A  L+++S ++L +Y+
Sbjct: 1   MDSTFWVGISFCLFVLLLVYKKVPGIINNVLEGKIKEIKNKLEDAENLKKESNHLLGKYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQIS---ALYLKDLEQKIHYMKLEAKRL 119
           ++  + ++E  EI+  A   +KI   E     E+++   AL  K++ +K++  K  A + 
Sbjct: 61  KQLDESKKECEEILQRA---SKINESESSTMKEKMNSMMALKEKNINEKVNQAKNGAIKE 117

Query: 120 LYAKIADFSVEIVREIISQKMN----DDVNSSIFEKTISSIQ 157
           +       +VE  ++II+Q ++    D +N +  ++ + S++
Sbjct: 118 MKKIATIIAVESAKKIITQTIDKEKIDSINYTSIQENLESLK 159


>gi|84515978|ref|ZP_01003339.1| FoF1 ATP synthase, subunit B [Loktanella vestfoldensis SKA53]
 gi|84510420|gb|EAQ06876.1| FoF1 ATP synthase, subunit B [Loktanella vestfoldensis SKA53]
          Length = 185

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 48/77 (62%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V ++ +IF+ I++Y ++P+++   LD  A  IR ++ EA+ LRE++  +L  Y+ K  
Sbjct: 31  FVVLVAFLIFIGILLYYKVPALVADMLDKRAVNIRAELDEAKALREEAMALLASYERKQK 90

Query: 67  KVEEETREIILAAKHRA 83
            V+ +   I+ +AK  A
Sbjct: 91  DVQVQADRIVASAKQEA 107


>gi|149201372|ref|ZP_01878347.1| H+-transporting two-sector ATPase, B/B' subunit [Roseovarius sp.
           TM1035]
 gi|149145705|gb|EDM33731.1| H+-transporting two-sector ATPase, B/B' subunit [Roseovarius sp.
           TM1035]
          Length = 186

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 46/73 (63%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+  ++Y+++P++L   LD  A  I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTNFVVLLAFLLFVGFLIYVKVPTLLGKKLDERAANIKGELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREII 76
           K   V+ +   I+
Sbjct: 89  KQKDVQAQADRIV 101


>gi|254510893|ref|ZP_05122960.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
 gi|221534604|gb|EEE37592.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
          Length = 186

 Score = 52.4 bits (124), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 43/70 (61%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V +  I+F+ I+ Y ++P ++   LD  A+ I+ ++ EAR L E++ ++L  Y+ K  
Sbjct: 32  FVVLLGFIVFIAILFYFKVPGMIGGALDKRAEGIQSELDEARALHEEARSLLASYERKQR 91

Query: 67  KVEEETREII 76
           +V+ +   I+
Sbjct: 92  EVQTQADAIV 101


>gi|86751672|ref|YP_488168.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris HaA2]
 gi|123003608|sp|Q2IRA3|ATPF_RHOP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86574700|gb|ABD09257.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris HaA2]
          Length = 163

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 78/154 (50%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V ++ +I + I  YL +   +L  LD   D+I+ ++ EAR+L++++  +L  Y+ +
Sbjct: 8   ETW-VAIAFVILMGIFAYLGVHRTVLKALDNRRDRIKAELDEARKLKDEAAKLLADYRAR 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            ++ E E   I+ +AK  A+ +A E    +E       K  E KI   + +A   + A  
Sbjct: 67  RAQAEREAEAIVASAKADAERIAAESKAKLEDFVVRRTKTAESKIALAEAQALADVRAAA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A+ +V     ++SQ +   V   +  K I  ++S
Sbjct: 127 AEAAVSAAAIVLSQSVKGQVADDLLGKGIQEVRS 160


>gi|91975307|ref|YP_567966.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB5]
 gi|123749362|sp|Q13CX4|ATPF_RHOPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91681763|gb|ABE38065.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB5]
          Length = 163

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 78/154 (50%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V ++ +I + +  YL +   +L  LD    +I+ ++ EAR+L++++  +L  Y+ +
Sbjct: 8   ETW-VAVAFVILMALFAYLGVHRTVLQALDNRRARIKAELDEARKLKDEAAKLLADYRAR 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            ++ E E   II +AK  A+ +A E    +E   A   K  E KI   + +A   + A  
Sbjct: 67  RAQAEREAEAIISSAKADAERIAAESKAKLEDFVARRTKTAESKIALAEAQAVADVRAAA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A+ +V     I+SQ +   V   +  K I  ++S
Sbjct: 127 AEAAVSAAATILSQSVKGQVADDLLGKGIQEVRS 160


>gi|332362652|gb|EGJ40450.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK49]
          Length = 164

 Score = 51.2 bits (121), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 74/153 (48%), Gaps = 10/153 (6%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREESL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +   EE   I+      A K++A ILA       E+   L  K   Q+I   K EA   +
Sbjct: 71  AGSREEAATIVETAKETAEKNKAGILA----NAAEEAGRLKAK-ANQEIAQNKAEAMSSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 126 KGEVADLTVALASKILSQELDKEAQSELIDRYI 158


>gi|115526764|ref|YP_783675.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
 gi|122294477|sp|Q07H89|ATPF_RHOP5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|115520711|gb|ABJ08695.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
          Length = 164

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 78/154 (50%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V +   I +V+ VY  +   +L+ LD   D+I+ ++ EA RL+E++  +L  YK +
Sbjct: 9   ETW-VAVGFAILMVVFVYFGVHRTVLNALDNRRDRIKAELDEASRLKEEAAKLLADYKAR 67

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  E E   II +AK  A+ +A E    +E   A   K  E KI   + +A   + A  
Sbjct: 68  AASAEREAEAIIASAKDEAERIAAEAKAKLEDFVARRTKTAEGKIAMAEAQAIADVRAAA 127

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A+ +V     I+SQ +   V   +  K I+ ++S
Sbjct: 128 ANAAVAAASSILSQSVKGSVADELIGKGIAEVRS 161


>gi|85706759|ref|ZP_01037851.1| ATP synthase F0, B subunit [Roseovarius sp. 217]
 gi|85668817|gb|EAQ23686.1| ATP synthase F0, B subunit [Roseovarius sp. 217]
          Length = 186

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 47/73 (64%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+  ++Y+++PS++   LD  A  I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTNFVVLLAFLLFVGFLIYVKVPSLVGKKLDERAVSIKAELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREII 76
           K  +V+ +   I+
Sbjct: 89  KQKEVQAQADRIV 101


>gi|260428790|ref|ZP_05782767.1| ATP synthase B chain [Citreicella sp. SE45]
 gi|260419413|gb|EEX12666.1| ATP synthase B chain [Citreicella sp. SE45]
          Length = 187

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 18  VIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIIL 77
            I+VY ++P +L   LD  A+ IRD++ EAR LRE+++ +L  Y+ K  +V  +  E+I+
Sbjct: 44  AILVYFKVPPVLGKLLDKRAEGIRDELDEARALREEAQTLLASYERKQKEVAAQA-ELIV 102

Query: 78  A 78
           A
Sbjct: 103 A 103


>gi|330991389|ref|ZP_08315340.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
 gi|329761408|gb|EGG77901.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
          Length = 164

 Score = 49.7 bits (117), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 76/160 (47%), Gaps = 3/160 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVY-LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M  D  F   ++ ++F V+    L  P  L+S LD  A++IR ++ EA RLR ++E +L 
Sbjct: 1   MFHDPRFWSAVAFVLFFVLFGRSLWKP--LVSALDGRAERIRAELDEAARLRREAEQMLE 58

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
                      E RE++  +   A  +A +  ++ E  +A   +  + +I   +  A R 
Sbjct: 59  DATRDREAALAEARELVEHSLREAANIAAQARKDAEDAAARREQMAKDRIASAERSALRE 118

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +     D +++  RE ++ K+  D +  I +++I  + + 
Sbjct: 119 VRETAVDIAIQATRETLAAKLQADDDGKIVDRSIGDLSAA 158


>gi|294084673|ref|YP_003551431.1| ATP synthase subunit B [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664246|gb|ADE39347.1| ATP synthase B chain precursor [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 162

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 76/148 (51%), Gaps = 4/148 (2%)

Query: 15  IFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE 74
           +F VI+V+ +  ++L + LD  ++KIR D+ EA+ LR+ +   L  Y+  H +  +E + 
Sbjct: 17  VFFVILVWKKAGAVLATMLDERSEKIRADLAEAKDLRDAAITELHNYQRLHREAADEAKV 76

Query: 75  IILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL--LYAKIADFSVEIV 132
           II  A+  A+ + E   +N     A+  ++ +        EA  +  L  + A  +V   
Sbjct: 77  IIKNAEITAERIRETAEKNAND--AVKRREAQATAKIKAAEANMVAELRERAASLAVATA 134

Query: 133 REIISQKMNDDVNSSIFEKTISSIQSCH 160
            EIIS K++ D + ++ ++  + I+  +
Sbjct: 135 TEIISSKLDKDASLAMIDEAAAEIEKLN 162


>gi|260432718|ref|ZP_05786689.1| ATP synthase B chain [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416546|gb|EEX09805.1| ATP synthase B chain [Silicibacter lacuscaerulensis ITI-1157]
          Length = 186

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 77/150 (51%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+V +  I+F+ ++ Y ++P ++   LD  A  I+ ++ EAR L E++  +L  Y+ K  
Sbjct: 32  FVVSLGFIVFIAVLFYFKVPGMIGGALDNRAQGIQAELDEARALHEEARALLASYERKQR 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V+ +   I+ AAK  A + AE+   ++E+  A  L   + +I   +  A + +  +   
Sbjct: 92  EVQAQADAIVAAAKEDAVLAAEQAKADLEKSIARRLAAAQDQIASAEAAAVKEVRDQAVA 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +V   + +++Q+M     + + +  I  +
Sbjct: 152 AAVAAAKSVLAQQMTAAQANKLIDDAIGEV 181


>gi|327473285|gb|EGF18705.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK408]
          Length = 164

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 10/153 (6%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E +  + +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEALAQKREEAL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +   EE   I+      A K++A ILA       E+   L  K   Q+I   K EA   +
Sbjct: 71  AGSREEAATIVETAKETAEKNKAGILA----NAAEEAGRLKAK-ANQEIAQNKAEAMSSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 126 KGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|322392089|ref|ZP_08065551.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
 gi|321144989|gb|EFX40388.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
          Length = 164

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 79/157 (50%), Gaps = 12/157 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKFAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E + II      A K +A ILAE       ++ A  LKD   Q+I   K EA + 
Sbjct: 71  AGSRKEAKTIIDNAKDTAEKSKADILAE------AKLEAGRLKDKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           +  ++AD +V +  +IIS+ ++   +  + ++ I  +
Sbjct: 125 VKGEVADLTVSLAGKIISKNLDGHAHKELIDQYIDQL 161


>gi|254455815|ref|ZP_05069244.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082817|gb|EDZ60243.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 165

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 74/153 (48%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S IIF   ++YL+IP  +   L+     I+++I E+ +LR  ++ +L  
Sbjct: 1   MAIDATFWVAVSFIIFFGALIYLKIPQKITEILNKMISDIKNEIDESEKLRTDAKTLLDN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + EI+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 61  AQNKLDTAQSVSSEILEEAKKDSDKLIIELNDKFHKSSEIKKNLAENKISQMKEAAIKEI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
                  +V+ V++II+  ++     ++F+K +
Sbjct: 121 KDASIKIAVDSVKKIITTSVDKSKLDAVFQKNL 153


>gi|23004074|ref|ZP_00047593.1| hypothetical protein Magn03000159 [Magnetospirillum
          magnetotacticum MS-1]
          Length = 159

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%)

Query: 7  FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
          F V ++ + FL IV  +   S++ S LD  A ++R ++ EARRLRE++  +L  YK + +
Sbjct: 7  FWVAVAFVAFLAIVWRVGGFSMMTSGLDNRAKRVRHELDEARRLREEAAAVLADYKRRRA 66

Query: 67 KVEEETREIILAAKHRAKILAEEG 90
          + E+E   I+  A+  A+ LA EG
Sbjct: 67 EAEKEAEAIVANAREDAERLAAEG 90


>gi|158425887|ref|YP_001527179.1| putative Fo ATP synthase B chain [Azorhizobium caulinodans ORS 571]
 gi|226741324|sp|A8HT73|ATPF_AZOC5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158332776|dbj|BAF90261.1| putative Fo ATP synthase B chain [Azorhizobium caulinodans ORS 571]
          Length = 164

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++  +F+ I++Y  +   L   LDA   +I  ++ EARRL+E+++ ++ +YK K  
Sbjct: 9   LWVAVAFFVFVGILLYNGVHKALAKALDARGARIAAELDEARRLKEEAQKLVAEYKRKQR 68

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
           + E E   I+ AAK  A+ LA E    +E+  +   +  E KI
Sbjct: 69  EAEAEAEAIVTAAKAEAERLAAETKAKLEEFVSRRTRMAEDKI 111


>gi|144898768|emb|CAM75632.1| ATP synthase B chain precursor [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 176

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 87/165 (52%), Gaps = 12/165 (7%)

Query: 2   HFDETFLVFMSLIIFLVI-VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + D  F V ++   FLV  + +  +   L + LDA A KI+  + EA RLRE+++ +L  
Sbjct: 18  YADAAFWVGVAF--FLVAGLAFKPVFRALGAGLDARAAKIKARLDEAARLREEAQEMLAT 75

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K     +E  EII  AK  A+ LA++  ++++  ++L  ++ +      + EA  L 
Sbjct: 76  YQRKQRDAMKEAEEIIAHAKAEAERLAQQAAKDLD--ASLKRREAQAMDRIAQAEAAALR 133

Query: 121 YAKIADFSVEI----VREIISQKMNDDVNSSIFEKTISSI-QSCH 160
             ++ + +VE+     R++++  ++ D  + + +K I+ + Q  H
Sbjct: 134 --EVQNVAVEVAINAARDVLASSISADQAAKLVDKAIAELPQKLH 176


>gi|307294417|ref|ZP_07574261.1| H+transporting two-sector ATPase B/B' subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306880568|gb|EFN11785.1| H+transporting two-sector ATPase B/B' subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 208

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I+V  ++P ++   LD    +I+  + EA +LR ++E +  +Y+
Sbjct: 51  MDATAWVSLAMAVFILILVIKKVPGLIGGALDGRIAQIKTQLEEASKLRAEAEALKAEYE 110

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
            K +    E   +  +A+H A  L E+   N   + +   K  E KI
Sbjct: 111 AKLTAAAGEADAMRKSAEHEAATLLEDAKTNAAALVSRRQKMAEDKI 157


>gi|85713869|ref|ZP_01044858.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter sp.
          Nb-311A]
 gi|85698995|gb|EAQ36863.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter sp.
          Nb-311A]
          Length = 161

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 5  ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
          ET+ V ++ +I + +  Y+ +   +LS LD  + +I+ ++ +ARRL++ +  +L  YK +
Sbjct: 6  ETW-VAIAFLILMGVFAYVGVHRTVLSALDRRSARIKGELDDARRLKDDAAKLLADYKAR 64

Query: 65 HSKVEEETREII 76
          H+  E E ++II
Sbjct: 65 HASAEREAQDII 76


>gi|306825333|ref|ZP_07458674.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432465|gb|EFM35440.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 165

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 77/154 (50%), Gaps = 12/154 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I LV++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 12  NFILIAGSFILLVVLVKKYAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKREDEL 71

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +    E + II      A K ++ ILAE       ++ A  LK+   Q+I   K EA + 
Sbjct: 72  AGSRSEAKTIIENAKETAEKSKSDILAE------AKLEAGRLKEKANQEIAQNKAEALQS 125

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           +  ++AD +V +  +IISQ ++   +  + ++ I
Sbjct: 126 VKGEVADLTVSLAGKIISQNLDSHAHKELIDQYI 159


>gi|4100653|gb|AAD00914.1| proton-translocating ATPase b subunit [Streptococcus sanguinis]
          Length = 164

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 74/153 (48%), Gaps = 10/153 (6%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +    E   I+      A K++A ILA+      E+   L  K   Q+I   K EA   +
Sbjct: 71  AGSRAEAVAIVETAKETAEKNKAGILADAA----EEAGRLKAK-ANQEIAQNKAEAMSSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 126 KGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|75674434|ref|YP_316855.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
          winogradskyi Nb-255]
 gi|123614286|sp|Q3SW38|ATPF_NITWN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|74419304|gb|ABA03503.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
          winogradskyi Nb-255]
          Length = 161

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 47/72 (65%), Gaps = 1/72 (1%)

Query: 5  ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
          ET+ V ++ ++ + +  Y+ +   +LS LD  + +I++++ +ARRL++++  +L  YK +
Sbjct: 6  ETW-VAIAFLLLMGVFAYVGVHRTVLSALDRRSARIKNELDDARRLKDEAAKLLADYKAR 64

Query: 65 HSKVEEETREII 76
          H+  E E ++II
Sbjct: 65 HASAEREAQDII 76


>gi|327468904|gb|EGF14376.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK330]
          Length = 164

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREEAL 70

Query: 64  KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA  
Sbjct: 71  AGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMS 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 124 SIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|327458649|gb|EGF04997.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1057]
          Length = 164

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI +DI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISEDIDGAEAARQKAEDLAQKREEAL 70

Query: 64  KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA  
Sbjct: 71  AGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMS 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +  ++AD +V +  +I+SQ+++ D  S + ++ I
Sbjct: 124 SIKGEVADLTVTLASKILSQELDKDAQSELIDRYI 158


>gi|324993290|gb|EGC25210.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK405]
          Length = 164

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 74/153 (48%), Gaps = 10/153 (6%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDSAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +    E   I+      A K++A ILA+     +E+   L  K   Q+I   K E    +
Sbjct: 71  AGSRAEAVAIVETAKETAEKNKAGILADA----VEEAGRLKAK-ANQEIAQNKAETMSSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 126 KGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|332361636|gb|EGJ39440.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1056]
 gi|332363074|gb|EGJ40861.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK355]
          Length = 164

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAESARKKAEDLAQKREEAL 70

Query: 64  KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA  
Sbjct: 71  AGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMS 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 124 SIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|209966768|ref|YP_002299683.1| ATP synthase F0, B subunit [Rhodospirillum centenum SW]
 gi|226694398|sp|B6IX47|ATPF2_RHOCS RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP
          synthase F(0) sector subunit b 2; AltName: Full=ATPase
          subunit I 2; AltName: Full=F-type ATPase subunit b 2;
          Short=F-ATPase subunit b 2
 gi|209960234|gb|ACJ00871.1| ATP synthase F0, B subunit [Rhodospirillum centenum SW]
          Length = 160

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
          M  + TF V ++ ++F V  V+    + +   LD  A++IR++I +A++LRE ++  L Q
Sbjct: 1  MLQNPTFWVLVAFVLF-VAAVWRIAANTIGKALDDRAERIREEIEQAQKLREDAQAALAQ 59

Query: 61 YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIE 95
          Y+ K     +E   II AA+  A  +      ++E
Sbjct: 60 YQRKQRDALKEAENIIAAAREEADRIRRRAATDLE 94


>gi|83313095|ref|YP_423359.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1]
 gi|123540650|sp|Q2W025|ATPF_MAGSA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|82947936|dbj|BAE52800.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1]
          Length = 178

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 72/147 (48%), Gaps = 17/147 (11%)

Query: 15  IFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE 74
           I +V + +  +   + + LDA + KI+  + EA +LRE+++ +L  Y+ K     +E  E
Sbjct: 32  ILVVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQRKQRDAMKEAEE 91

Query: 75  IILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE 134
           II  AK  A+ LA++  +++E    + +K  EQ    M ++       +IA    + VRE
Sbjct: 92  IIAHAKAEAERLAKQAAKDLE----VSMKRREQ----MAMD-------RIAQAEAQAVRE 136

Query: 135 IISQKMNDDVNSSIFEKTISSIQSCHQ 161
           +  Q +  DV     +K I    S  Q
Sbjct: 137 V--QNLAVDVAIGAAQKVIGESLSAAQ 161


>gi|325690060|gb|EGD32064.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK115]
 gi|328945467|gb|EGG39618.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1087]
          Length = 164

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 64  KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA  
Sbjct: 71  AGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMS 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 124 SIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|325688345|gb|EGD30364.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK72]
          Length = 164

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 76/156 (48%), Gaps = 16/156 (10%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E+ L Q +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAED-LAQKREDA 69

Query: 64  -KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
              S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA 
Sbjct: 70  LAGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAM 122

Query: 118 RLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 123 SSIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|325693993|gb|EGD35911.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK150]
          Length = 164

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 64  KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA  
Sbjct: 71  AGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMS 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 124 SIKGEVADLTVALASKILSQELDKEAQSELIDRYI 158


>gi|324995407|gb|EGC27319.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK678]
          Length = 164

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 75/155 (48%), Gaps = 14/155 (9%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREEAL 70

Query: 64  KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
             S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA  
Sbjct: 71  AGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMS 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 124 SIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|94498731|ref|ZP_01305281.1| AtpF, ATP synthase F0, B subunit [Sphingomonas sp. SKA58]
 gi|94421830|gb|EAT06881.1| AtpF, ATP synthase F0, B subunit [Sphingomonas sp. SKA58]
          Length = 204

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 60/107 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I++  ++P+++   LD    +I++ + EA RLR ++E +  +Y+
Sbjct: 47  MDATAWVSLAMAVFILILLVKKVPALIGGALDGRIAQIKEQLAEASRLRAEAEALKGEYE 106

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
            K +    E   +  AA+H A++L ++   + E++     K  E KI
Sbjct: 107 AKLAAAAGEADAMRKAAEHEAEVLVDDARTHAEELVVRRQKMAEDKI 153


>gi|92115897|ref|YP_575626.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
          hamburgensis X14]
 gi|122418843|sp|Q1QRI1|ATPF_NITHX RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|91798791|gb|ABE61166.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
          hamburgensis X14]
          Length = 161

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 46/72 (63%), Gaps = 1/72 (1%)

Query: 5  ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
          ET+ V ++ +I + +  Y+ +   +L+ LD  + +I+ ++ +ARRL++++  +L  Y+ +
Sbjct: 6  ETW-VAIAFVILMGVFAYVGVHRTVLTTLDRRSARIKGELDDARRLKDEAAKLLADYRAR 64

Query: 65 HSKVEEETREII 76
          H+  E E ++II
Sbjct: 65 HASAEREAQDII 76


>gi|296127000|ref|YP_003634252.1| ATP synthase F0, B subunit [Brachyspira murdochii DSM 12563]
 gi|296018816|gb|ADG72053.1| ATP synthase F0, B subunit [Brachyspira murdochii DSM 12563]
          Length = 166

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 77/153 (50%), Gaps = 2/153 (1%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPS--ILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  ++  + I FL+++  L   +  I+L  L+A ADKI++D+ EA + RE ++  L  Y+
Sbjct: 7   DPGIIIWTWITFLLVLAILGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYR 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+    + E   II  A+  A  + ++   N  + + +    +  +I   K EA   +  
Sbjct: 67  EQIDNAKAEASSIIENARVEANRIRDKIINNAREEAEVNKNKIMSEIDRSKEEAMNSVKK 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           +  D +V +   I+ + +N + N +I  + I++
Sbjct: 127 QALDIAVVMAETILKRNINKEDNQAIINEFINN 159


>gi|319947326|ref|ZP_08021559.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
 gi|319746568|gb|EFV98828.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
          Length = 164

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 80/159 (50%), Gaps = 12/159 (7%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S LDA A+KI +DI EA   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKFAWGNITSILDARAEKITNDIDEAEAARKKAEELATKREAELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQ-KIHYMKLEAKRLL 120
              +E   I+      A K++A IL+E   +      AL LK+  Q +I   K EA   +
Sbjct: 72  GSRQEATTILETAKETAEKNKAHILSEANQE------ALRLKEKAQLEISQNKEEAMNSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD +V +  +++SQ+++ + +  + ++ ++ +   
Sbjct: 126 KGDVADLTVNLAGKLLSQQLDSEGHRQLIDRYLNELGDA 164


>gi|23016150|ref|ZP_00055909.1| COG0711: F0F1-type ATP synthase, subunit b [Magnetospirillum
           magnetotacticum MS-1]
          Length = 178

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 71/147 (48%), Gaps = 17/147 (11%)

Query: 15  IFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE 74
           I +V + +  +   + + LDA + KI+  + EA +LRE+++ +L  Y+ K     +E  E
Sbjct: 32  ILVVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQRKQRDAMKEAEE 91

Query: 75  IILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE 134
           II  AK  A+ LA++  +++E      +K  EQ    M ++       +IA    + VRE
Sbjct: 92  IIAHAKAEAERLAKQAAKDLE----ASMKRREQ----MAMD-------RIAQAEAQAVRE 136

Query: 135 IISQKMNDDVNSSIFEKTISSIQSCHQ 161
           +  Q +  DV     +K I    S  Q
Sbjct: 137 V--QNLAVDVAIGAAQKVIGESLSAAQ 161


>gi|319939419|ref|ZP_08013779.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
 gi|319811405|gb|EFW07700.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
          Length = 164

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 77/159 (48%), Gaps = 13/159 (8%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            LV  S ++ +V++      +I  +F +  A KI DDI  A   R+K+E++  + + + +
Sbjct: 13  ILVAGSFLLLIVLIKKFAWDNITSTF-EQRAKKISDDIDSAESARQKAEDLAQKRETELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRLL 120
              +E   II      A K++A ILA+   +      A  LK+   Q+I   K EA   +
Sbjct: 72  GSRQEATTIIENAKETAEKNKAGILADAADE------AGRLKEKANQEIAQTKAEAMNSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD +V +  +I+ QK++ + +  + ++ I  +   
Sbjct: 126 KGDVADLTVNLASKILGQKLDQEAHKELIDRYIDKLGDA 164


>gi|125717632|ref|YP_001034765.1| F0F1 ATP synthase subunit B [Streptococcus sanguinis SK36]
 gi|226696182|sp|A3CM10|ATPF_STRSV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125497549|gb|ABN44215.1| Proton-translocating ATPase, F0 sector, subunit b, putative
           [Streptococcus sanguinis SK36]
 gi|332365950|gb|EGJ43706.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1059]
          Length = 164

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 76/156 (48%), Gaps = 16/156 (10%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E+ L Q +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAED-LAQKREDA 69

Query: 64  -KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
              S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA 
Sbjct: 70  LAGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAM 122

Query: 118 RLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 123 SSIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|315221772|ref|ZP_07863686.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
 gi|315189158|gb|EFU22859.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
          Length = 164

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 77/159 (48%), Gaps = 13/159 (8%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            LV  S ++ +V++      +I  +F +  A KI DDI  A   R+K+E++  + + + +
Sbjct: 13  ILVAGSFLLLIVLIKKFAWDNITSTF-EQRAKKISDDIDGAESARQKAEDLAQKRETELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRLL 120
              +E   II      A K++A ILA+   +      A  LK+   Q+I   K EA   +
Sbjct: 72  GSRQEATTIIENAKETAEKNKAGILADAADE------AGRLKEKANQEIAQTKAEAMNSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD +V +  +I+ QK++ + +  + ++ I  +   
Sbjct: 126 KGDVADLTVNLASKILGQKLDQEAHKELIDRYIDKLGDA 164


>gi|16124620|ref|NP_419184.1| ATP synthase F0, B subunit [Caulobacter crescentus CB15]
 gi|221233309|ref|YP_002515745.1| F0F1 ATP synthase subunit B [Caulobacter crescentus NA1000]
 gi|81782749|sp|Q9AB66|ATPF_CAUCR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|13421520|gb|AAK22352.1| ATP synthase F0, B subunit [Caulobacter crescentus CB15]
 gi|220962481|gb|ACL93837.1| ATP synthase B chain [Caulobacter crescentus NA1000]
          Length = 169

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 7  FLVFMSLIIFLVIVVYLRI-PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
          F V  +L+IF  ++V L++ P  L   LD +A KI+ ++ EA++LRE+++ +L   K + 
Sbjct: 14 FWVLAALVIFFGLLVVLKVLPGALFGALDGYAAKIKAELDEAQQLREEAQALLADVKAQR 73

Query: 66 SKVEEE 71
             E +
Sbjct: 74 EDAERQ 79


>gi|293365285|ref|ZP_06612002.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307703825|ref|ZP_07640766.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
 gi|291316735|gb|EFE57171.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307622660|gb|EFO01656.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
          Length = 164

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +    E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADA------KVEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMN 141
           +  ++AD +V +  +IIS+ ++
Sbjct: 125 VKGEVADLTVSLAGKIISKNLD 146


>gi|269216179|ref|ZP_06160033.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
 gi|269130438|gb|EEZ61516.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
          Length = 215

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 73/151 (48%), Gaps = 1/151 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   + ++ +I  VI+     P +    L+  A  IR+D+  A   R++SE +L +YK
Sbjct: 57  MNEFIPMLVAFVILWVILAKFGWP-VFDRMLEKRATTIREDLKSAEAARQESEKLLAEYK 115

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ +  + E   I+  AK   + +  +  +     +A  ++  +  I   + +A   L  
Sbjct: 116 QQLADAKAEASSIVAEAKKTGEAVKADIQKKAADEAAGMIEKAQAAIEAERKQAVSDLQK 175

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            +AD SV +  ++I   ++DD + +I ++ +
Sbjct: 176 SVADISVSVASKLIGTDLSDDEHRAIIKRYV 206


>gi|331266493|ref|YP_004326123.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
 gi|326683165|emb|CBZ00783.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
          Length = 164

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 79/160 (49%), Gaps = 12/160 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +    E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADA------KVEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +  ++AD ++ +  +IIS+ ++   +  + ++ I  ++  
Sbjct: 125 VKGEVADLTISLAGKIISKNLDSHAHKELIDQYIDQLEEA 164


>gi|114570754|ref|YP_757434.1| H+-transporting two-sector ATPase subunit B/B' [Maricaulis maris
           MCS10]
 gi|122314859|sp|Q0AK30|ATPF2_MARMM RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|114341216|gb|ABI66496.1| H+-transporting two-sector ATPase, B/B' subunit [Maricaulis maris
           MCS10]
          Length = 183

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 49/86 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D +F  F++L+IF  +++++ +   +   LD  A+ I +++ EA+RLRE +  +L  Y+ 
Sbjct: 26  DPSFYAFLALLIFFGLLLHMGVHRTIAKTLDDRAEGISNELDEAKRLREDAAEMLASYQR 85

Query: 64  KHSKVEEETREIILAAKHRAKILAEE 89
           K  + E E   II  AK  AK L  E
Sbjct: 86  KQREAEAEAEAIIAQAKTEAKSLKAE 111


>gi|163794978|ref|ZP_02188947.1| ATP synthase B chain precursor [alpha proteobacterium BAL199]
 gi|159179797|gb|EDP64324.1| ATP synthase B chain precursor [alpha proteobacterium BAL199]
          Length = 160

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
          M  D TF V +S ++F+ +   + +     + LDA A++IR+ + EA+ LRE+++     
Sbjct: 1  MFADPTFWVAVSFVLFVALTFKM-VWQKATTALDARANEIRNRLEEAQNLREEAQAAKAN 59

Query: 61 YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIE 95
          Y+       +E   I+  A+  AK + EEG + +E
Sbjct: 60 YQRLQRDALKEAEAILAHAREEAKRMREEGEKKLE 94


>gi|306829404|ref|ZP_07462594.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315613054|ref|ZP_07887965.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|322374420|ref|ZP_08048934.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
 gi|304428490|gb|EFM31580.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315315164|gb|EFU63205.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|321279920|gb|EFX56959.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
          Length = 164

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +    E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADA------KVEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMN 141
           +  ++AD ++ +  +IIS+ ++
Sbjct: 125 VKGEVADLTISLAGKIISKNLD 146


>gi|91762750|ref|ZP_01264715.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718552|gb|EAS85202.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 168

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 79/157 (50%), Gaps = 8/157 (5%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S +IF+  +VYL+IP  +   L+     I+++I E+ +LR++++ +L  
Sbjct: 4   MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN 63

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + +I+  AK  +  L  E      + S +     E KI  MK  A +  
Sbjct: 64  AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALK-- 121

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSS----IFEKTI 153
             +I D S++I  + + + +N  V+ S    +FEK +
Sbjct: 122 --EIKDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNL 156


>gi|324990544|gb|EGC22480.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK353]
          Length = 164

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 72/153 (47%), Gaps = 10/153 (6%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +    E   I+      A K++A ILA+      E+   L  K   Q+I   K E    +
Sbjct: 71  AGSRAEAVAIVETAKETAEKNKAGILADAA----EEAGRLKAK-ANQEIAQNKAETMSSI 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 126 KGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|225621094|ref|YP_002722352.1| putative F0F1-type ATP synthase subunit B [Brachyspira
           hyodysenteriae WA1]
 gi|225215914|gb|ACN84648.1| putative F0F1-type ATP synthase, subunit B [Brachyspira
           hyodysenteriae WA1]
          Length = 167

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 76/150 (50%), Gaps = 2/150 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPS--ILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           ++  + I FL+++  L   +  I+L  L+A ADKI++D+ EA + RE ++  L  Y+E+ 
Sbjct: 10  IIIWTWITFLLVLAILGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYREQI 69

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + E   II  A+  A  + ++   N  + + L    +  +I   K EA   +  +  
Sbjct: 70  DNAKVEASAIIENARVEANRIRDKIINNAREEAELNKNKIMSEIDRSKEEAMNSVKKQAL 129

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           D +V +   I+ + +N + N ++  + I++
Sbjct: 130 DIAVVMAETILKRNINKEDNQALINEFINN 159


>gi|323352618|ref|ZP_08087588.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
 gi|322121654|gb|EFX93400.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
          Length = 164

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 75/156 (48%), Gaps = 16/156 (10%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE-- 63
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E+ L Q +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAED-LAQKREDA 69

Query: 64  -KHSKVE-----EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
              S+VE     E  +E   A K++A ILA       E+   L  K   Q+I   K EA 
Sbjct: 70  LAGSRVEAVSIVETAKET--AEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAM 122

Query: 118 RLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             +  ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 123 SSIKGEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|237744084|ref|ZP_04574565.1| ATP synthase subunit B [Fusobacterium sp. 7_1]
 gi|229431313|gb|EEO41525.1| ATP synthase subunit B [Fusobacterium sp. 7_1]
          Length = 163

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 85/164 (51%), Gaps = 16/164 (9%)

Query: 1   MHFDETFLVFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEARRLREKSEN 56
           +  D TF  F  +I F +++     Y + P  +   ++   +KI  ++  A + RE+SE+
Sbjct: 4   ISIDATF--FWQIINFFLLLFIVKKYFKEP--ISKIMNKRKEKIETELVTATKNREESEH 59

Query: 57  ILMQYKEKHSKVEEETREIILAAKHR----AKILAEEGCQNIEQISALYLKDLEQKIHYM 112
           +L + + + +   +E  EII  A+ +    A+ L  E  +N E I    +K  E ++  M
Sbjct: 60  LLKEAETQINSSRKEASEIIKNAQRKAEEEARNLISEARENRENI----IKATEFEVTKM 115

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K +AK  L  ++ D + E+  +II +K++D   +S+ +K IS +
Sbjct: 116 KNDAKEELSREVKDLAAELAEKIIKEKVDDIQETSLIDKFISEV 159


>gi|71082827|ref|YP_265546.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71061940|gb|AAZ20943.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 165

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 78/157 (49%), Gaps = 8/157 (5%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S +IF+  +VYL+IP  +   L+     I+++I E+ +LR++++ +L  
Sbjct: 1   MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + +I+  AK  +  L  E      + S +     E KI  MK  A    
Sbjct: 61  AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAA---- 116

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSS----IFEKTI 153
             +I D S++I  + + + +N  V+ S    +FEK +
Sbjct: 117 LKEIKDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNL 153


>gi|114763715|ref|ZP_01443109.1| ATP synthase F0, B subunit [Pelagibaca bermudensis HTCC2601]
 gi|114543716|gb|EAU46729.1| ATP synthase F0, B subunit [Roseovarius sp. HTCC2601]
          Length = 187

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREII 76
            Y ++P +L   LD  AD IR+++ EAR LRE+++ +L  Y+ +  +V  +   I+
Sbjct: 47  AYFKVPGMLGKLLDKRADDIRNELDEARALREEAQTLLASYERQQHEVSAQADRIV 102


>gi|307701975|ref|ZP_07638983.1| ATP synthase F0, B subunit [Streptococcus mitis NCTC 12261]
 gi|35436127|gb|AAO45680.1| AtpB [Streptococcus mitis]
 gi|307616620|gb|EFN95809.1| ATP synthase F0, B subunit [Streptococcus mitis NCTC 12261]
          Length = 164

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 79/156 (50%), Gaps = 12/156 (7%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLVKKYAWSNLTSIFEQRAEKIAADIDGAEQARQKAEVLAQKREDELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRLL 120
              +E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + +
Sbjct: 72  GSRKEAKTIIENAKETAEKSKASILAD------AKLEAGRLKEKANQEIAQNKAEALQSV 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++AD ++ +  +IISQ ++   +  + ++ I  +
Sbjct: 126 KGEVADLTISLAGKIISQNLDGHAHKELIDQYIDQL 161


>gi|325989796|ref|YP_004249495.1| ATP synthase subunit b [Mycoplasma suis KI3806]
 gi|323574881|emb|CBZ40541.1| ATP synthase subunit b [Mycoplasma suis]
          Length = 190

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 77/153 (50%), Gaps = 4/153 (2%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           FL  + +IIF  IV Y   P+   +FL    DK+     +     ++++  L Q K + S
Sbjct: 32  FLSSIFVIIF--IVYYFWKPTN--AFLAKQKDKLDKVHTQLASATKETKVALSQLKTQQS 87

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            ++EE + II   K +A+ +  +  +  E++    +++ ++K   ++ EAK+ +  K+ D
Sbjct: 88  NLKEEEKRIITEQKQKAEKILSQKLEEAEKLKQSIIEESKRKAQQIEEEAKKTINGKVID 147

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SVE+  +++   +N   ++ +  + IS I   
Sbjct: 148 LSVELAEKLVGVSINQKTHNKLVNEYISDINKA 180


>gi|270292839|ref|ZP_06199050.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
 gi|270278818|gb|EFA24664.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
          Length = 164

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +    E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRNEAKTIIENAKGTAEKSKADILADA------KLEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMN 141
           +  ++AD ++ +  +IIS+ ++
Sbjct: 125 VKGEVADLTISLAAKIISKNLD 146


>gi|325973361|ref|YP_004250425.1| ATP synthase F0 subunit beta [Mycoplasma suis str. Illinois]
 gi|323651963|gb|ADX98045.1| ATP synthase F0, B subunit [Mycoplasma suis str. Illinois]
          Length = 190

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 77/153 (50%), Gaps = 4/153 (2%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           FL  + +IIF  IV Y   P+   +FL    DK+     +     ++++  L Q K + S
Sbjct: 32  FLSSIFVIIF--IVYYFWKPTN--AFLAKQKDKLDKVHTQLASATKETKVALSQLKTQQS 87

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            ++EE + II   K +A+ +  +  +  E++    +++ ++K   ++ EAK+ +  K+ D
Sbjct: 88  NLKEEEKRIITEQKQKAEKILSQKLEEAEKLKQSIIEESKRKAQQIEEEAKKTINGKVID 147

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SVE+  +++   +N   ++ +  + IS I   
Sbjct: 148 LSVELAEKLVGVSINQKTHNKLVNEYISDINKA 180


>gi|325264961|ref|ZP_08131688.1| ATP synthase F0, B subunit [Clostridium sp. D5]
 gi|324029651|gb|EGB90939.1| ATP synthase F0, B subunit [Clostridium sp. D5]
          Length = 172

 Score = 44.3 bits (103), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 78/150 (52%), Gaps = 2/150 (1%)

Query: 6   TFLVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
            + +  SLI  +V+V+ L+      + SF++A   ++ + + EA+  RE+++  L +Y+ 
Sbjct: 13  NWNLLFSLITVVVLVLILKKFFFEKVHSFMEARQQQVVNTLQEAQATREEAQQKLEEYEA 72

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + +  E E REII  A   AK  A    ++  + ++   +   ++I   KL AK+ L  +
Sbjct: 73  QMAWAESEKREIIKKAMQEAKDQAGAVLEDAGKEASQVREQTRREIERDKLIAKKELQRE 132

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           I D +V    +II +++N    + + +K I
Sbjct: 133 IGDMAVLAAGKIIGEELNPKRQAEVVDKII 162


>gi|322387997|ref|ZP_08061604.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
 gi|321141270|gb|EFX36768.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
          Length = 164

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 73/153 (47%), Gaps = 12/153 (7%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S LD  A+KI  DI  A   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKYAWGNITSVLDERAEKISSDIDGAEEARKKAEELASKREAELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRLL 120
               E + II      A K +A ILAE       ++ A  LK+   Q+I   K EA + +
Sbjct: 72  GSRTEAKTIIENAKETAEKSKADILAE------AKLEAGRLKEKANQEIAQNKAEALQSV 125

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
              +AD ++ +  +IISQ ++   +  + ++ I
Sbjct: 126 KGDVADLTISLAGKIISQNLDGQAHKELIDQYI 158


>gi|256028110|ref|ZP_05441944.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp. D11]
 gi|289766051|ref|ZP_06525429.1| ATP synthase subunit B [Fusobacterium sp. D11]
 gi|289717606|gb|EFD81618.1| ATP synthase subunit B [Fusobacterium sp. D11]
          Length = 163

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 85/164 (51%), Gaps = 16/164 (9%)

Query: 1   MHFDETFLVFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEARRLREKSEN 56
           +  D TF  F  +I F +++     Y + P  +   ++   +KI  ++  A + RE+SE+
Sbjct: 4   ISIDATF--FWQIINFFLLLFIVKKYFKEP--ISKIMNKRKEKIETELVTATKNREESEH 59

Query: 57  ILMQYKEKHSKVEEETREIILAAKHR----AKILAEEGCQNIEQISALYLKDLEQKIHYM 112
           +L + + + +   +E  EII  A+ +    A+ L  E  +N E I    +K  E ++  M
Sbjct: 60  LLKEAETQINSSRKEASEIIKNAQRKAEEEARNLISEARENRENI----IKATEFEVTKM 115

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K +AK  L  ++ D + E+  +II ++++D   +S+ +K IS +
Sbjct: 116 KNDAKEELSREVKDLAAELAEKIIKERVDDIQETSLIDKFISEV 159


>gi|260494331|ref|ZP_05814462.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_33]
 gi|260198477|gb|EEW95993.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_33]
          Length = 163

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 85/164 (51%), Gaps = 16/164 (9%)

Query: 1   MHFDETFLVFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEARRLREKSEN 56
           +  D TF  F  +I F +++     Y + P  +   ++   +KI  ++  A + RE+SE+
Sbjct: 4   ISIDATF--FWQIINFFLLLFIVKKYFKEP--ISKIMNKRKEKIETELVTATKNREESEH 59

Query: 57  ILMQYKEKHSKVEEETREIILAAKHR----AKILAEEGCQNIEQISALYLKDLEQKIHYM 112
           +L + + + +   +E  EII  A+ +    A+ L  E  +N E I    +K  E ++  M
Sbjct: 60  LLKEAETQINSSRKEASEIIKNAQRKAEEEARNLINEARENRENI----IKATEFEVTKM 115

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K +AK  L  ++ D + E+  +II ++++D   +S+ +K IS +
Sbjct: 116 KNDAKEELSREVKDLAAELAEKIIKERVDDIQETSLIDKFISEV 159


>gi|319899220|ref|YP_004159313.1| ATP synthase B chain (modular protein) [Bartonella clarridgeiae 73]
 gi|319403184|emb|CBI76743.1| ATP synthase B chain (modular protein) [Bartonella clarridgeiae 73]
          Length = 210

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 82/156 (52%), Gaps = 10/156 (6%)

Query: 1   MHFDETFLVF-MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M+F   FL   +S  +F + +  + +P I    ++   D+I  D+ +A RL+++++N++ 
Sbjct: 57  MYFGSHFLWLAISFGLFYLFISRVIVPRIG-GVIETRRDRIVSDLDQAMRLKQEADNVVE 115

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
            YK+K +K   E + II    +  KI A+   + IE+     LK  E KI  ++ +A + 
Sbjct: 116 VYKQKLAKARLEAKTIIQTESNEIKIRADLQRKKIEEDLEKKLKKSEDKIKEIQNKAMQN 175

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           +     + + EIV+++I      D+N S   K++SS
Sbjct: 176 VGLIAEEITFEIVKKLI------DINVS--RKSVSS 203


>gi|15901359|ref|NP_345963.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae TIGR4]
 gi|15903407|ref|NP_358957.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae R6]
 gi|111657414|ref|ZP_01408167.1| hypothetical protein SpneT_02001384 [Streptococcus pneumoniae
           TIGR4]
 gi|116515510|ref|YP_816801.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae D39]
 gi|148984855|ref|ZP_01818108.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|148992604|ref|ZP_01822272.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|148997428|ref|ZP_01825033.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|149003274|ref|ZP_01828170.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|149007582|ref|ZP_01831217.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|149011746|ref|ZP_01832942.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|149021779|ref|ZP_01835786.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168489672|ref|ZP_02713871.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|168492581|ref|ZP_02716724.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|168493413|ref|ZP_02717556.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|168575967|ref|ZP_02721882.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|169832491|ref|YP_001694918.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Hungary19A-6]
 gi|182684466|ref|YP_001836213.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|194396745|ref|YP_002038142.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae G54]
 gi|221232224|ref|YP_002511377.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225854956|ref|YP_002736468.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae JJA]
 gi|225857137|ref|YP_002738648.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae P1031]
 gi|225859269|ref|YP_002740779.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae 70585]
 gi|225861345|ref|YP_002742854.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649217|ref|ZP_04523469.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974]
 gi|237821826|ref|ZP_04597671.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974M2]
 gi|298255868|ref|ZP_06979454.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298503247|ref|YP_003725187.1| H (+)-transporting two-sector ATPase subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|303254151|ref|ZP_07340264.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|303260734|ref|ZP_07346694.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|303263061|ref|ZP_07348993.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|303264465|ref|ZP_07350385.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|303267443|ref|ZP_07353297.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|303269782|ref|ZP_07355531.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|307068156|ref|YP_003877122.1| F0F1-type ATP synthase subunit b [Streptococcus pneumoniae AP200]
 gi|307127716|ref|YP_003879747.1| ATP synthase F0 subunit B [Streptococcus pneumoniae 670-6B]
 gi|61219603|sp|P0A2Z2|ATPF_STRPN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219605|sp|P0A2Z3|ATPF_STRR6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122277701|sp|Q04HT5|ATPF_STRP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695882|sp|B5E675|ATPF_STRP4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696178|sp|B1ICT3|ATPF_STRPI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696179|sp|B2IQX4|ATPF_STRPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15004343|gb|AAK77043.1|AF334396_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|15004348|gb|AAK77047.1|AF334397_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|18253301|gb|AAL66413.1|AF368465_3 proton-translocating ATPase b subunit [Streptococcus pneumoniae]
 gi|14973002|gb|AAK75603.1| ATP synthase F0, B subunit [Streptococcus pneumoniae TIGR4]
 gi|15459012|gb|AAL00168.1| Proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           pneumoniae R6]
 gi|116076086|gb|ABJ53806.1| ATP synthase F0, B subunit [Streptococcus pneumoniae D39]
 gi|147756483|gb|EDK63524.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|147758734|gb|EDK65731.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|147760941|gb|EDK67911.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|147764177|gb|EDK71109.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|147922877|gb|EDK73993.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|147928621|gb|EDK79635.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|147930015|gb|EDK81002.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168994993|gb|ACA35605.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Hungary19A-6]
 gi|182629800|gb|ACB90748.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|183571984|gb|EDT92512.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|183573266|gb|EDT93794.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|183576602|gb|EDT97130.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|183578325|gb|EDT98853.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|194356412|gb|ACF54860.1| ATP synthase F0, B chain [Streptococcus pneumoniae G54]
 gi|220674685|emb|CAR69258.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225721806|gb|ACO17660.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 70585]
 gi|225722344|gb|ACO18197.1| ATP synthase F0, B subunit [Streptococcus pneumoniae JJA]
 gi|225726166|gb|ACO22018.1| ATP synthase F0, B subunit [Streptococcus pneumoniae P1031]
 gi|225726416|gb|ACO22267.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238842|gb|ADI69973.1| H (+)-transporting two-sector ATPase, subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301794524|emb|CBW36966.1| ATP synthase B chain [Streptococcus pneumoniae INV104]
 gi|301800348|emb|CBW32977.1| ATP synthase B chain [Streptococcus pneumoniae OXC141]
 gi|301802232|emb|CBW34982.1| ATP synthase B chain [Streptococcus pneumoniae INV200]
 gi|302598877|gb|EFL65910.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|302635824|gb|EFL66327.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|302638137|gb|EFL68612.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|302640675|gb|EFL71073.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|302643034|gb|EFL73327.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|302646277|gb|EFL76504.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|306409693|gb|ADM85120.1| F0F1-type ATP synthase, subunit b [Streptococcus pneumoniae AP200]
 gi|306484778|gb|ADM91647.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 670-6B]
 gi|327389695|gb|EGE88040.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA04375]
 gi|332072303|gb|EGI82786.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17570]
 gi|332074263|gb|EGI84740.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17545]
 gi|332199556|gb|EGJ13631.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41317]
 gi|332200951|gb|EGJ15022.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47901]
          Length = 164

 Score = 43.9 bits (102), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 78/152 (51%), Gaps = 8/152 (5%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKD-LEQKIHYMKLEAKRLLY 121
           +   +E + II      AK  AE+   NI    ++ A +LK+   Q+I   K+EA + + 
Sbjct: 71  AGSRKEAKTII----ENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVK 126

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            ++AD ++ +  +IISQ ++   + ++ ++ I
Sbjct: 127 GEVADLTISLAGKIISQNLDSHAHKALIDQYI 158


>gi|148988556|ref|ZP_01819989.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|168483879|ref|ZP_02708831.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|168487555|ref|ZP_02712063.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|147925757|gb|EDK76832.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|172042717|gb|EDT50763.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|183569630|gb|EDT90158.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|332073846|gb|EGI84324.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41301]
 gi|332200072|gb|EGJ14145.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47368]
          Length = 164

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 79/150 (52%), Gaps = 9/150 (6%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           L+  S I+ LV++      +I   F +  A+KI  DI  A   R+K+E +  + +++ + 
Sbjct: 14  LITGSFILLLVLIKKFAWSNITGIF-EERAEKIASDIDRAEEARQKAEVLAQKREDELAG 72

Query: 68  VEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKD-LEQKIHYMKLEAKRLLYAK 123
             +E + II      AK  AE+   NI    ++ A +LK+   Q+I   K+EA + +  +
Sbjct: 73  SRKEAKTII----ENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGE 128

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           +AD ++ +  +IISQ ++   + ++ ++ I
Sbjct: 129 VADLTISLAGKIISQNLDSHAHKALIDQYI 158


>gi|257064831|ref|YP_003144503.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
 gi|256792484|gb|ACV23154.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
          Length = 203

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 73/156 (46%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   + ++ II  +I+     P I    L+     IR+D+  A   R +SE IL +YK
Sbjct: 45  MNEFIPMLVAFIILWIILAKFGWP-IFDGMLEKRESTIRNDLKNAEEARMESERILAEYK 103

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++ + E  +I+  AK   + +  +     +  +   ++     I   K  A   L  
Sbjct: 104 QQLAEAKAEASQIVANAKKAGEDVKADITAKAQVEADGMIEKARAAIEAEKKAAIADLQG 163

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +AD SVE+  ++I   ++DD + +I ++ +  + S
Sbjct: 164 SVADISVEVASKVIGTDLSDDEHRAIIKRYVEEVGS 199


>gi|326407255|gb|ADZ64326.1| F-type H+-transporting ATPase subunit b [Lactococcus lactis subsp.
           lactis CV56]
          Length = 168

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 72/133 (54%), Gaps = 12/133 (9%)

Query: 16  FLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           F++++V LR+   + + S   + A KI DDI  A    +++ +++ Q + + ++ +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELARSKEEAA 83

Query: 74  EII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
            II      A+++RAK+LA       E+ ++L  K  ++ I   + EA   +   +AD S
Sbjct: 84  NIIQVANDTASQNRAKVLATAN----EEATSLK-KRAQEDIEQERKEALNTVKGDVADIS 138

Query: 129 VEIVREIISQKMN 141
           V+I  ++I Q ++
Sbjct: 139 VQIAEKLIGQSLD 151


>gi|162146972|ref|YP_001601433.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544036|ref|YP_002276265.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|226741476|sp|A9HDM4|ATPF_GLUDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|161785549|emb|CAP55120.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531713|gb|ACI51650.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 164

 Score = 43.1 bits (100), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 73/152 (48%), Gaps = 2/152 (1%)

Query: 10  FMSLIIFLVIVVYL--RIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           F S + F++  V    ++ + L + LD+ AD+IR D+ EA RLR ++E +L     +   
Sbjct: 7   FWSAVAFVLFFVLFGKKLWTPLAAALDSRADRIRADLDEAARLRREAEQMLEDATRERET 66

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E R ++  +   A  +A+E  +  E ++    +    +I   +  A R +     D 
Sbjct: 67  AMVEARALVEHSLIEAARIADEARREAEAVATRREQMARDRIAASERSAVREVRQVAIDV 126

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +++  R++++  +    + +I ++ I+ + S 
Sbjct: 127 AIQATRDVLATALPAGADHAIVDRAIADLPSA 158


>gi|170744960|ref|YP_001773615.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
          sp. 4-46]
 gi|226741511|sp|B0ULY4|ATPF_METS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|168199234|gb|ACA21181.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
          sp. 4-46]
          Length = 161

 Score = 43.1 bits (100), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%)

Query: 7  FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
          F V ++ +IF  IV        +++ LD   +++R ++ EARRLRE++  +L  Y+++  
Sbjct: 6  FWVAVAFVIFCGIVWKAGGFDQIINGLDRRGERVRRELEEARRLREEAAALLADYQKRRG 65

Query: 67 KVEEETREII 76
          + E E   I+
Sbjct: 66 EAEREAEAIV 75


>gi|114798056|ref|YP_760623.1| ATP synthase F0 subunit B family protein [Hyphomonas neptunium ATCC
           15444]
 gi|123027989|sp|Q0C0X0|ATPF_HYPNA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114738230|gb|ABI76355.1| ATP synthase F0, B subunit family protein [Hyphomonas neptunium
           ATCC 15444]
          Length = 189

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 1/94 (1%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF+ F+ ++ FL+I   +     +L  LD  A  IR ++ EA  LRE++   L   + + 
Sbjct: 38  TFVAFLCMVTFLLIAARMGAFKTILGGLDTRASNIRKELEEAASLREQAAEALALAERRA 97

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNI-EQIS 98
              ++E   II  AK  AK + EE  +++ E+IS
Sbjct: 98  QDADKEAEAIIDQAKRDAKAMLEEARRDLAEKIS 131


>gi|300870197|ref|YP_003785068.1| putative F0F1 type ATP synthase subunit B [Brachyspira pilosicoli
           95/1000]
 gi|300687896|gb|ADK30567.1| putative F0F1 type ATP synthase subunit B [Brachyspira pilosicoli
           95/1000]
          Length = 166

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 78/155 (50%), Gaps = 2/155 (1%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPS--ILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  ++  + I FL+++  L   +  I+L  L+A ADKI++D+ EA + RE ++  L  Y+
Sbjct: 7   DPGIIIWTWITFLLVLAVLGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYR 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+    + E   II  A+  A  + ++   N  + +  +   +  +I   K EA   +  
Sbjct: 67  EQIDNAKAEASSIIENARIEANRVRDKIIGNAREEAESHRNKILSEIDRAKDEAMGNVRK 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           +  D +V +   I+ + ++ + N ++  + +++ +
Sbjct: 127 QAVDIAVVMAETILKRNIDKNDNQALINEFVNNFE 161


>gi|222085044|ref|YP_002543573.1| ATP synthase protein [Agrobacterium radiobacter K84]
 gi|221722492|gb|ACM25648.1| ATP synthase protein [Agrobacterium radiobacter K84]
          Length = 197

 Score = 42.7 bits (99), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 72/147 (48%), Gaps = 13/147 (8%)

Query: 3   FDETFLVFMSLIIFLVI---VVYLRIPSILL----SFLDAHADKIRDDIFEARRLREKSE 55
           FD T   + S +++LVI   + YL +  I++    S L++  D+I  DI EA RL+ +++
Sbjct: 37  FDHT--TYPSQLLWLVITFVIFYLAMQKIVIPRVGSILESRHDRIAQDIEEASRLKSEAD 94

Query: 56  NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE 115
             +  Y+ + +    +   I   A+  AK  AEE  + IE   +  LK  E +I  +K +
Sbjct: 95  AAVATYESELAAARAKANTIGATARDAAKAKAEEDRKAIEASLSQKLKTAEARIGEIKTK 154

Query: 116 AKRLLYAKIADFSVEIVREIISQKMND 142
           A    +A +   + E    ++ Q + +
Sbjct: 155 A----FADVGAIAEETASAVVEQLVGN 177


>gi|15673750|ref|NP_267924.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116512627|ref|YP_811534.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125624729|ref|YP_001033212.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281492360|ref|YP_003354340.1| ATP synthase F0 subunit B [Lactococcus lactis subsp. lactis KF147]
 gi|61219599|sp|P0A2Z0|ATPF_LACLA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219602|sp|P0A2Z1|ATPF_LACLM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123320232|sp|Q02XA1|ATPF_LACLS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6048349|gb|AAF02204.1|AF059739_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|12724791|gb|AAK05866.1|AE006407_2 ATP synthase subunit b [Lactococcus lactis subsp. lactis Il1403]
 gi|116108281|gb|ABJ73421.1| ATP synthase F0 subcomplex B subunit [Lactococcus lactis subsp.
           cremoris SK11]
 gi|124493537|emb|CAL98518.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281376024|gb|ADA65515.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. lactis KF147]
 gi|300071526|gb|ADJ60926.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 168

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 71/133 (53%), Gaps = 12/133 (9%)

Query: 16  FLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           F++++V LR+   + + S   + A KI DDI  A    +++ +++ Q + + +  +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAA 83

Query: 74  EII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
            II      A+++RAK+LA       E+ ++L  K  ++ I   + EA   +   +AD S
Sbjct: 84  NIIQVANDTASQNRAKVLATAN----EEATSLK-KRAQEDIEQERKEALNTVKGDVADIS 138

Query: 129 VEIVREIISQKMN 141
           V+I  ++I Q ++
Sbjct: 139 VQIAEKLIGQSLD 151


>gi|296876804|ref|ZP_06900852.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|312867266|ref|ZP_07727476.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
 gi|296432306|gb|EFH18105.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|311097395|gb|EFQ55629.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
          Length = 164

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + L+ ++     + +   L+A A KI DDI  A   R+K+E +  + +E+ 
Sbjct: 11  NFILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREEEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E   I+      A K++++IL+E   +      A+ LK+  +Q+I + K EA   
Sbjct: 71  AGSRKEAASIVENAKETAEKNKSQILSEATQE------AVRLKEKAQQEIAHNKEEALNS 124

Query: 120 LYAKIADFSVEIVREIISQKMN 141
           +   +AD +V +  +++SQ+++
Sbjct: 125 IKGDVADLTVNLASKLLSQQLD 146


>gi|296120445|ref|YP_003628223.1| ATP synthase F0 subunit beta [Planctomyces limnophilus DSM 3776]
 gi|296012785|gb|ADG66024.1| ATP synthase F0, B subunit [Planctomyces limnophilus DSM 3776]
          Length = 238

 Score = 42.4 bits (98), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 8   LVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           L+  SLI F+  V  L       L + LD    +IR+DI EA   R K++ +L +++ + 
Sbjct: 83  LMVWSLITFVAFVFLLSKFAWKPLAAGLDQREARIRNDIQEAESARLKAQQLLAEHEARL 142

Query: 66  SKVEEETREIILAAKHRAK 84
           +K EE  RE+I  AK  A+
Sbjct: 143 AKTEETVRELIAEAKRDAE 161


>gi|87199340|ref|YP_496597.1| H+-transporting two-sector ATPase, B/B' subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135021|gb|ABD25763.1| H+-transporting two-sector ATPase, B/B' subunit [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 184

 Score = 42.4 bits (98), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V +++ IFL I+V  ++P  ++  LD     IR  + EA+ LR ++E +  +
Sbjct: 27  LGLGPGAWVALAMFIFLAILVVKKVPGAIVGGLDKQIGAIRKQLDEAKVLRAEAEKLRAE 86

Query: 61  YKEKHSKVEEETREII 76
           Y  K +  E++   ++
Sbjct: 87  YAAKIANAEKDAAAMV 102


>gi|284928724|ref|YP_003421246.1| ATP synthase F0 subcomplex B' subunit [cyanobacterium UCYN-A]
 gi|284809183|gb|ADB94888.1| ATP synthase F0 subcomplex B' subunit [cyanobacterium UCYN-A]
          Length = 143

 Score = 42.4 bits (98), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 71/138 (51%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD T  V     I LVI++       L   LD  AD IR      +   EK+  +  QY+
Sbjct: 4   FDATLPVMALQFILLVIILNATFYKPLNEVLDKRADYIRQQEIGGKEHLEKARELAAQYE 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ S+  ++++E++++A+  AK +A E     +Q + +  + + ++I   + +A ++L  
Sbjct: 64  QQLSETRKKSQEVVISAQSEAKKIASEAIVIAQQEAQIKKEAVAKEIAQQRQDALKVLEK 123

Query: 123 KIADFSVEIVREIISQKM 140
           ++   S +I+ +++  K+
Sbjct: 124 QVDILSHQILEKLLGPKL 141


>gi|28378942|ref|NP_785834.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum WCFS1]
 gi|254557147|ref|YP_003063564.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300769657|ref|ZP_07079540.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181150|ref|YP_003925278.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|81631034|sp|Q88UT9|ATPF_LACPL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28271779|emb|CAD64685.1| H(+)-transporting two-sector ATPase, B subunit [Lactobacillus
           plantarum WCFS1]
 gi|254046074|gb|ACT62867.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300492700|gb|EFK27885.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308046641|gb|ADN99184.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 171

 Score = 42.4 bits (98), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 79/157 (50%), Gaps = 19/157 (12%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           +F+V M+LI    +V +  I  ++       ADKI +DI  A++ R+++ ++  Q ++  
Sbjct: 23  SFIVLMALI---SVVAWKPITKMMAD----RADKIANDIDSAQKSRQEASDLADQRRDAL 75

Query: 66  SKVEEETREIILAA-----KHRAKILAEEGCQN-IEQISALYLKDLEQKIHYMKLEAKRL 119
           S    E  EI+  A     K R+ I+A+   QN   Q      KD+EQ+    + +A + 
Sbjct: 76  SHSRAEASEIVADAKKSGEKQRSSIVAD--AQNEATQYKQNARKDIEQE----RQDALKN 129

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           + + +AD SV I  +II ++++ +   ++    I  +
Sbjct: 130 VQSDVADISVAIATKIIKKQLDPEGQQALINSYIEGL 166


>gi|322389183|ref|ZP_08062744.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
 gi|321144088|gb|EFX39505.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
          Length = 164

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + L+ ++     + +   L+A A KI DDI  A   R+K+E +  + +E+ 
Sbjct: 11  NFILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREEEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E   I+      A K++++IL+E   +      A+ LK+  +Q+I + K EA   
Sbjct: 71  AGSRKEAASIVENAKETAEKNKSQILSEATQE------AVRLKEKAQQEIAHNKEEALNS 124

Query: 120 LYAKIADFSVEIVREIISQKMN 141
           +   +AD +V +  +++SQ+++
Sbjct: 125 IKGDVADLTVNLAGKLLSQQLD 146


>gi|325696687|gb|EGD38575.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK160]
 gi|327461561|gb|EGF07892.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1]
 gi|327489415|gb|EGF21208.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1058]
          Length = 164

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 11/152 (7%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            LV  S ++ +V++      +I  S  +  A KI DDI  A   R+K+E +  + + + +
Sbjct: 13  ILVAGSFLLLIVLIKKFAWGNIT-SIFEERAKKISDDIDSAESARQKAEELAQKREHELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
               E   I+      A K++A ILA       E+   L  K   Q+I   K EA   + 
Sbjct: 72  GSRAEAVTIVETAKETAEKNKAGILANAA----EEAGRLKAK-ANQEIAQNKAEAMSSIK 126

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
            ++AD +V +  +I+SQ+++ +  S + ++ I
Sbjct: 127 GEVADLTVTLASKILSQELDKEAQSELIDRYI 158


>gi|89897662|ref|YP_521149.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219670791|ref|YP_002461226.1| ATP synthase F0 subunit beta [Desulfitobacterium hafniense DCB-2]
 gi|122480523|sp|Q24MN7|ATPF_DESHY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|89337110|dbj|BAE86705.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219541051|gb|ACL22790.1| ATP synthase F0, B subunit [Desulfitobacterium hafniense DCB-2]
          Length = 164

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 85/163 (52%), Gaps = 14/163 (8%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           +HFD T +V   ++ FL++V  LR    + L++ ++    +I  +I  A + R ++E I 
Sbjct: 4   IHFDLTLVV--QVLSFLLLVYILRRFAWNPLINMMEERRSQIEANIANAEKERLQAEQIK 61

Query: 59  MQYKEKHSKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMK 113
            +Y+E+  K  +E +E+I     L+ +  A+ILA    +  E+I    L D+E++    +
Sbjct: 62  REYQEEMRKARQEAQEVIAKATKLSEQRAAEILAAAHGE-AEKIKQSALADIERE----R 116

Query: 114 LEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             A   + A++AD SV +  +II + ++      + E+ I  +
Sbjct: 117 DRAIAQVQAQVADLSVAVAEKIIRKNLDVRGQEDMIEQFIQEV 159


>gi|224543576|ref|ZP_03684115.1| hypothetical protein CATMIT_02785 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523503|gb|EEF92608.1| hypothetical protein CATMIT_02785 [Catenibacterium mitsuokai DSM
           15897]
          Length = 166

 Score = 42.0 bits (97), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 75/150 (50%), Gaps = 12/150 (8%)

Query: 12  SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEE 71
           + I+ L+   YL   + +L F    AD I  +I +A+   EK+   L++ +++  +  ++
Sbjct: 22  TAIMLLLFKKYLW--NYVLEFFQKRADFIEGNINDAKAKNEKASEYLLESEKQAKEAAKQ 79

Query: 72  TREIILAAKH-----RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            +EII  AK      ++KI+ E   Q  E+I     +    +I   KL A+  +  +I D
Sbjct: 80  YKEIIDQAKEDAVKAKSKIMDEANKQAQEKI-----EQARHEIESEKLAAQDEMKKEIVD 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +VE+  +++ Q MN + N ++ +  +  +
Sbjct: 135 VAVEVATKVMDQNMNTEANKALVDDFVKQV 164


>gi|322385219|ref|ZP_08058866.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
 gi|321270843|gb|EFX53756.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
          Length = 164

 Score = 42.0 bits (97), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 10/152 (6%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S L+  + KI DDI  A   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKFAWGNITSILEERSKKITDDIDGAESARKKAEELAQKRENELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
              +E   II      A K++A ILA+      E+   L  K   Q+I   K EA   + 
Sbjct: 72  GSRQEATTIIEHAKETAEKNKAGILADAA----EEAGRLKAK-ANQEIAQSKAEALNSIK 126

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
             +AD +V +  +I+SQ+++   +S + ++ I
Sbjct: 127 DDVADLTVSLASKILSQQLDTKAHSELIDRYI 158


>gi|307709039|ref|ZP_07645499.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
 gi|307620375|gb|EFN99491.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
          Length = 164

 Score = 42.0 bits (97), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 77/154 (50%), Gaps = 12/154 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S + S  +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITSIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRKEAKTIIENAKETAEKSKASILAD------AKLEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           +  ++AD ++ +  +IISQ ++   +  + ++ I
Sbjct: 125 VKGEVADLTISLAGKIISQNLDGHAHKELIDQYI 158


>gi|281420261|ref|ZP_06251260.1| ATP synthase F0, B subunit [Prevotella copri DSM 18205]
 gi|281405756|gb|EFB36436.1| ATP synthase F0, B subunit [Prevotella copri DSM 18205]
          Length = 166

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 78/152 (51%), Gaps = 23/152 (15%)

Query: 4   DETFLVFMSLIIFLVIVVYLR--IPSILL------SFLDAHADKIRDDIFEARRLREKSE 55
           D   L +M+L+  +V ++  +   P+I+       +F+D    K  +   +   ++++ E
Sbjct: 7   DSGLLFWMTLVFIIVFIILWKAGFPAIIKMVNERKAFIDDSLKKAHEANEKLANIQKEGE 66

Query: 56  NILMQYKEKHS---KVEEETREIIL-AAKHRAKILAEEGCQNIEQISALYLKDLEQKIHY 111
           +IL + +EK +   K   ETR+ I+  A+ +A+   EEG +         L D +++I  
Sbjct: 67  SILQEAREKQAALLKEAAETRDAIVEKAQDKAR---EEGAR--------LLSDAKKQIET 115

Query: 112 MKLEAKRLLYAKIADFSVEIVREIISQKMNDD 143
            K  A R +  ++A+ SV+I  +++  K++DD
Sbjct: 116 EKQNAIREIRGQVAELSVQIAEKVLKAKLSDD 147


>gi|329850278|ref|ZP_08265123.1| ATP synthase B chain [Asticcacaulis biprosthecum C19]
 gi|328840593|gb|EGF90164.1| ATP synthase B chain [Asticcacaulis biprosthecum C19]
          Length = 163

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 52/90 (57%), Gaps = 1/90 (1%)

Query: 5  ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
          ET+ V ++L++F +I++  ++P  +   L      +R ++ EA R+R+++ ++L   K +
Sbjct: 8  ETW-VRIALVLFFLILIVAKVPGKVWGSLGDTGKAVRAELDEAVRIRQEATDLLNTIKAQ 66

Query: 65 HSKVEEETREIILAAKHRAKILAEEGCQNI 94
              E++ RE+I  A+  A  L++E  + +
Sbjct: 67 RVAAEQKARELIALAEEEAARLSKEAREKL 96


>gi|296114242|ref|ZP_06832897.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979318|gb|EFG86041.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 164

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 71/152 (46%), Gaps = 2/152 (1%)

Query: 10  FMSLIIFLV--IVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           F S + F +  I+   ++   L + LDA A KIR D+ EA RLR ++E +L     +   
Sbjct: 7   FWSAVAFFLFFILFGAKLWRPLSAALDARAQKIRADLDEAARLRREAEQMLEDATREREA 66

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E R ++  +   A  +A +  Q+ + I+    +    +I   +  A R +     D 
Sbjct: 67  ALAEARAMVEHSLQEAARIAAQASQDADDIARRREQMARDRIAAAERGAIREVREAAIDI 126

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +++  RE ++  ++ D + S+ +  IS + S 
Sbjct: 127 AMQATRETLAASLSADGDKSLIDSAISGLPSA 158


>gi|83594573|ref|YP_428325.1| H+-transporting two-sector ATPase, subunit B/B' [Rhodospirillum
           rubrum ATCC 11170]
 gi|114626|sp|P15013|ATPF_RHORU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|123525687|sp|Q2RPA7|ATPF_RHORT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46374|emb|CAA31249.1| ATPase F-0-subunit b (AA 1 - 182) [Rhodospirillum rubrum]
 gi|152602|gb|AAA26458.1| ATP synthase F-0 sector, b subunit [Rhodospirillum rubrum]
 gi|83577487|gb|ABC24038.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 182

 Score = 41.6 bits (96), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 9   VFMSLIIFLVIV--VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            F   I FL++V  VY++  + +L  LD     ++  + EAR+LR+ ++ +L +Y+ +  
Sbjct: 28  AFWVSIAFLMVVGFVYIKAKNKILGALDGRGAAVKAKLDEARKLRDDAQALLAEYQRRQR 87

Query: 67  KVEEETREIILAAKHRAKIL 86
              +E  EII  AK  A  L
Sbjct: 88  DAMKEADEIIRHAKDEAARL 107


>gi|184154913|ref|YP_001843253.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956]
 gi|226741492|sp|B2GAU1|ATPF_LACF3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|183226257|dbj|BAG26773.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956]
          Length = 168

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S +I   +V +     +    +   ADKI +DI  A + RE+++ +  +
Sbjct: 10  LYLGDMLFYLVSFLIMAALVWHFAWKPVT-QMMQKRADKIANDIDSAAQSREEAQKLAAK 68

Query: 61  YKEKHSKVEEETREIILAAK-----HRAKIL--AEEGCQNIEQISALYLKDLEQKIHYMK 113
            +E+     +E   I+  AK      RA+I+  A++  QN++  +    KD EQ     +
Sbjct: 69  RQEELKGSRQEAARIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQ---KDAEQ----AR 121

Query: 114 LEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +A R     IA+ S+EI  ++I +++N D   ++ +  I  +
Sbjct: 122 QDALRGAKKDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164


>gi|15082069|gb|AAK84015.1|AF393838_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 41.2 bits (95), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 69/134 (51%), Gaps = 14/134 (10%)

Query: 16  FLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           F++++V LR+   + + S   + A KI DDI  A    +++ +++ Q + + +  +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAASKEEAA 83

Query: 74  EII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQK-IHYMKLEAKRLLYAKIADF 127
            II      A+++RAK+LA      I    A  LK   Q+ I   + EA   +   +AD 
Sbjct: 84  NIIQVANDTASQNRAKVLA------IANEEATSLKKRAQEDIEQERKEALNTVKGDVADI 137

Query: 128 SVEIVREIISQKMN 141
           SV+I  ++I Q ++
Sbjct: 138 SVQIAEKLIGQSLD 151


>gi|326387162|ref|ZP_08208772.1| AtpF, ATP synthase F0, B subunit [Novosphingobium nitrogenifigens
          DSM 19370]
 gi|326208343|gb|EGD59150.1| AtpF, ATP synthase F0, B subunit [Novosphingobium nitrogenifigens
          DSM 19370]
          Length = 171

 Score = 41.2 bits (95), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 46/79 (58%)

Query: 8  LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
          +V  S+++ + I+++ ++PS++   LD     IR+ + EA+ LR ++E +   Y  + S 
Sbjct: 21 IVSASMLVLIAIMIWKKVPSLITGGLDKQIVAIREQLDEAKALRAEAEKMRADYAARISN 80

Query: 68 VEEETREIILAAKHRAKIL 86
           E++   ++  A+  A+++
Sbjct: 81 AEKDAEAMLAHARREAELI 99


>gi|295687785|ref|YP_003591478.1| H+transporting two-sector ATPase b/b' subunit [Caulobacter segnis
          ATCC 21756]
 gi|295429688|gb|ADG08860.1| H+transporting two-sector ATPase B/B' subunit [Caulobacter segnis
          ATCC 21756]
          Length = 169

 Score = 41.2 bits (95), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 4  DETFLVFMSLIIFLVIVVYLRI-PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
          +  F V ++L++F  ++  L++ P  L   LD ++ KI+ ++ EA++LRE+++ +L   K
Sbjct: 11 NPEFWVLVALVVFFGLLFALKVLPGALFGALDNYSAKIKAELDEAQQLREEAQALLADVK 70

Query: 63 EKHSKVEEE 71
           +  + E +
Sbjct: 71 AQREEAERQ 79


>gi|227514477|ref|ZP_03944526.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus fermentum
           ATCC 14931]
 gi|227087163|gb|EEI22475.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus fermentum
           ATCC 14931]
          Length = 168

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S +I   +V +     +    +   ADKI +DI  A + RE+++ +  +
Sbjct: 10  LYLGDMLFYLVSFLIMAALVWHFAWKPVT-QMMQKRADKIANDIDSAAQSREEAQKLAAK 68

Query: 61  YKEKHSKVEEETREIILAAK-----HRAKIL--AEEGCQNIEQISALYLKDLEQKIHYMK 113
            +E+     +E   I+  AK      RA+I+  A++  QN++  +    KD EQ     +
Sbjct: 69  RQEELKGSRQEAATIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQ---KDAEQ----AR 121

Query: 114 LEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +A R     IA+ S+EI  ++I +++N D   ++ +  I  +
Sbjct: 122 QDALRGAKKDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164


>gi|35436116|gb|AAO45674.1| AtpB [Streptococcus viridans]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 76/155 (49%), Gaps = 8/155 (5%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKD-LEQKIHYMKLEAKRLLY 121
           +   +E + II      AK  AE+   NI    ++ A  LK+   Q+I   K EA + + 
Sbjct: 71  AGSRKEAKTII----ENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVK 126

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++AD ++ +  +IISQ ++   +  + ++ I  +
Sbjct: 127 GEVADLTISLAGKIISQNLDGHAHKELIDQYIDQL 161


>gi|315498136|ref|YP_004086940.1| h+transporting two-sector atpase b/b' subunit [Asticcacaulis
           excentricus CB 48]
 gi|315416148|gb|ADU12789.1| H+transporting two-sector ATPase B/B' subunit [Asticcacaulis
           excentricus CB 48]
          Length = 168

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 80/154 (51%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           ET+ V + L  F ++++ +++P  L + L    + +R ++ EA R+R++++ +L Q K +
Sbjct: 13  ETW-VRIGLGCFFLLLIVMKVPQKLWASLADTGNAVRAELDEAVRIRQEAQALLNQIKAE 71

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E++ +E+I  A+  A+ L  E    +++         E KI   + +A   + A  
Sbjct: 72  RLEAEQKAKELIAFAEEEAQRLTAEARTKLDESIKRRQAQAEAKIAQAEAKAASEVKAAA 131

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD + +I   I+  +++   +  + ++ I+ + +
Sbjct: 132 ADLATQIAENILISRVDGLKSDPLIDQAITQVAT 165


>gi|331701225|ref|YP_004398184.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
 gi|329128568|gb|AEB73121.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
          Length = 169

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 70/151 (46%), Gaps = 7/151 (4%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TFLV M    +LV +V  + P  +   +   +DKI +DI  A+  R K+  +  + + + 
Sbjct: 22  TFLVLM----WLVKIVAWK-P--ITKMMQDRSDKIVNDIDSAKESRTKAAELAQKRQAEL 74

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K  ++   II  AK   +   E+  ++    ++      E+ I   + EA       +A
Sbjct: 75  DKTRDDANTIINTAKQNGQRQQEQIVEDARNEASNLKSSAEKDIEQERQEALANSRKDVA 134

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             SVEI  +IIS+++N+D    + +  I  +
Sbjct: 135 SLSVEIASKIISKELNEDDQKGLVDSYIEGL 165


>gi|289168152|ref|YP_003446421.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307705151|ref|ZP_07642026.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|322376879|ref|ZP_08051372.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
 gi|288907719|emb|CBJ22556.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307621290|gb|EFO00352.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|321282686|gb|EFX59693.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 77/157 (49%), Gaps = 12/157 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRKEAKTIIENAKETAEKSKASILAD------AKLEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           +  ++AD ++ +  +IISQ ++   +  + ++ I  +
Sbjct: 125 VKGEVADLTISLAGKIISQNLDGHAHKELIDQYIDQL 161


>gi|260663292|ref|ZP_05864183.1| ATP synthase F0, B subunit [Lactobacillus fermentum 28-3-CHN]
 gi|260552144|gb|EEX25196.1| ATP synthase F0, B subunit [Lactobacillus fermentum 28-3-CHN]
          Length = 168

 Score = 40.8 bits (94), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 75/161 (46%), Gaps = 11/161 (6%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S +I   +V +     +    +   ADKI +DI  A + RE+++ +  +
Sbjct: 10  LYLGDMLFYLVSFLIMAALVWHFAWKPVT-QMMQKRADKIANDIDSAAQSREEAQKLAAK 68

Query: 61  YKEKHSKVEEETREIILAAK-----HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE 115
            +E+     +E   I+  AK      RA+I+A    Q+ + +     KD EQ     + +
Sbjct: 69  RQEELKGSRQEAATIVDNAKQAGESQRAEIIA-RAQQDAQNLKNQAQKDAEQ----ARQD 123

Query: 116 AKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           A R     IA+ S+EI  ++I +++N D   ++ +  I  +
Sbjct: 124 ALRGAKEDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164


>gi|307706800|ref|ZP_07643605.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
 gi|307617885|gb|EFN97047.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
          Length = 164

 Score = 40.8 bits (94), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 77/154 (50%), Gaps = 15/154 (9%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH- 65
            L+  S I+ LV++      +I   F +  A+KI  DI  A   R+K+E IL Q +E   
Sbjct: 13  ILIAGSFILLLVLIKKFAWSNITGIF-EERAEKIASDIDRAEEARQKAE-ILAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRKEAKTIIENARETAEKSKASILAD------AKLEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           +  ++AD ++ +  +IISQ ++   +  + ++ I
Sbjct: 125 VKGEVADLTISLAGKIISQNLDGHAHKELIDQYI 158


>gi|210623309|ref|ZP_03293726.1| hypothetical protein CLOHIR_01676 [Clostridium hiranonis DSM
          13275]
 gi|210153710|gb|EEA84716.1| hypothetical protein CLOHIR_01676 [Clostridium hiranonis DSM
          13275]
          Length = 166

 Score = 40.8 bits (94), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 2/78 (2%)

Query: 7  FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
          F +  +++IFL++   L  P  +++ + A  + I  DI E +++RE+ E    +Y+EK  
Sbjct: 15 FQLANAVVIFLILKHLLFKP--VMAVIKAREEDIAMDIQEGKKIREEGEAFKKEYEEKVG 72

Query: 67 KVEEETREIILAAKHRAK 84
          K EEE R II +A   AK
Sbjct: 73 KAEEEGRNIINSAVEAAK 90


>gi|15963433|dbj|BAB69467.1| H+-ATPase b subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 68/133 (51%), Gaps = 12/133 (9%)

Query: 16  FLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           F++++V LR+   + + S   + A KI DDI  A    +++ +++ Q + + +  +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAA 83

Query: 74  EII-----LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
            II      A+++RAK+LA    ++         K  ++ I   + EA   +   +AD S
Sbjct: 84  NIIQVANDTASQNRAKVLATANRRDTS-----LKKRAQEDIEQERKEALNTVKGDVADIS 138

Query: 129 VEIVREIISQKMN 141
           V+I  ++I Q ++
Sbjct: 139 VQIAEKLIGQSLD 151


>gi|294012247|ref|YP_003545707.1| F0F1-type ATP synthase subunit b [Sphingobium japonicum UT26S]
 gi|292675577|dbj|BAI97095.1| F0F1-type ATP synthase subunit b [Sphingobium japonicum UT26S]
          Length = 208

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 55/107 (51%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I++  ++P ++   LD    +I+  + EA +LR ++E +  +Y+
Sbjct: 51  MDATAWVSLAMAVFILILLVKKVPGLIGGALDGRIAQIKAQLEEASKLRAEAEALKAEYE 110

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
            + +    E   +  +A+H A  L E+   N   + +   K  E KI
Sbjct: 111 ARLAAAAGEAETMRKSAEHEAATLLEDAKANAAALVSRRQKMAEDKI 157


>gi|239831260|ref|ZP_04679589.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
 gi|239823527|gb|EEQ95095.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
          Length = 244

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 70/141 (49%), Gaps = 17/141 (12%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +F+  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 103 TFGLFY---LFMSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 155

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISA-----LYLKDLEQKIHYMKLEAKRLL 120
           ++   +   I  AA+ + K     G  N E+ SA       LK+ E++I  +K +A   +
Sbjct: 156 AQARTKAASIAEAAREKGK-----GEANAERASAEAALEGKLKEAEERIAAIKAKAMNDV 210

Query: 121 YAKIADFSVEIVREIISQKMN 141
                + + EIV +++  K +
Sbjct: 211 GNIAEETTAEIVEQLLGTKAD 231


>gi|284046070|ref|YP_003396410.1| ATP synthase F0 B subunit [Conexibacter woesei DSM 14684]
 gi|283950291|gb|ADB53035.1| ATP synthase F0, B subunit [Conexibacter woesei DSM 14684]
          Length = 194

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 76/158 (48%), Gaps = 16/158 (10%)

Query: 8   LVFMSLIIFLVIVVYLR---IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           L+  +L+ F+V ++ LR    P I    LD    +I + I  A R R++++ +L +Y+++
Sbjct: 33  LMIWTLLAFVVALLVLRKYAWPQIT-RILDQRQQQIEESIDAADRTRQEADELLAEYRQR 91

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKD---LEQKIHYMKLEAKRLLY 121
            +    +  EI+  A+   ++   EG      + A  +K    LEQ    ++ E  R + 
Sbjct: 92  LTDARAQADEIVAKAERAGEVAEREG------LDAAKVKREELLEQTRRDIQAETNRAIQ 145

Query: 122 A---KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
               ++AD +V+   ++  + ++ D    + E+ +S +
Sbjct: 146 EIRREVADLTVQATEKVTRKTLSPDDQKRLVEEALSEL 183


>gi|407170|emb|CAA81449.1| Adenosine Triphosphatase [Streptococcus pneumoniae]
 gi|1589420|prf||2211259C F0F1 ATPase:SUBUNIT=b
          Length = 164

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 70/140 (50%), Gaps = 8/140 (5%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKD-LEQKIHYMKLEAKRLLY 121
           +   +E + II      AK  AE+   NI    ++ A  LK+   Q+I   K EA + + 
Sbjct: 71  AGSRKEAKTII----ENAKETAEQSKANILADAKVEAGRLKEKANQEIAQNKAEALQSVK 126

Query: 122 AKIADFSVEIVREIISQKMN 141
            ++AD +V +  +IIS+ ++
Sbjct: 127 GEVADLTVSLAGKIISKNLD 146


>gi|325291358|ref|YP_004267539.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324966759|gb|ADY57538.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 185

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 76/160 (47%), Gaps = 8/160 (5%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + FD T    M   + LV ++       L+  ++     I D++  A   R+++E I  +
Sbjct: 25  IGFDYTLPAQMLSFLILVYILAKFAWRPLMDMMEKRRQFIEDNLSRAENERKEAEKIKKE 84

Query: 61  YKEKHSKVEEETREIILAA----KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
           Y+E+  K  +E +EII  A    + RA  +  E   + E+     L D++++     LE 
Sbjct: 85  YQEEMRKARQEAQEIINKATKISEERASEILAEARIDSEKTKQAALADIQRERDNAVLEV 144

Query: 117 KRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K    A++AD SV +  +I+  K+N +   ++ ++ I  +
Sbjct: 145 K----AQVADMSVAVAEKILRAKLNLEGQETLIDQFIQEV 180


>gi|313891429|ref|ZP_07825045.1| putative ATP synthase F0, B subunit [Dialister microaerophilus UPII
           345-E]
 gi|329121457|ref|ZP_08250081.1| F-type two-sector ATPase, F(1) beta subunit [Dialister
           micraerophilus DSM 19965]
 gi|313120204|gb|EFR43380.1| putative ATP synthase F0, B subunit [Dialister microaerophilus UPII
           345-E]
 gi|327469372|gb|EGF14842.1| F-type two-sector ATPase, F(1) beta subunit [Dialister
           micraerophilus DSM 19965]
          Length = 164

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 81/165 (49%), Gaps = 14/165 (8%)

Query: 1   MHFDETFLV-FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           +  + T L+  ++ II + I+ +      +L  LDA   +I++D+  A   +  +  +  
Sbjct: 2   VELNGTLLIQILNFIILVAILGHFAYKP-MLKVLDARKQRIQNDLDSAAASKADAAKLKD 60

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYL------KDLEQKIHYMK 113
            Y+E+    + + +EI+  A   AK+ AE      EQI A ++      ++  ++I   +
Sbjct: 61  SYEEQLRNAQAKAQEIVTQAVKEAKVKAE------EQIEAAHIAIEQEKENATKQIERER 114

Query: 114 LEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +A   L A++A  S +I  +IIS+ M  + N  I E +I+ + +
Sbjct: 115 KDALDDLKAQVAVLSCDIAAKIISKNMTPEENGRIIEDSITKLGA 159


>gi|21672860|ref|NP_660925.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
 gi|81860150|sp|Q8KGE9|ATPF_CHLTE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21645909|gb|AAM71267.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
          Length = 175

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 75/156 (48%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSI--LLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           L+F + + FL+++V LR  +   +LS L+  A  I+  I  A   ++++E IL + ++  
Sbjct: 20  LIFWTALTFLIVLVILRKTAWGPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRDLL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +K + E  +II  AK  A  L  +  +     S   +   +++I   K  A  +L  ++A
Sbjct: 80  AKADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASAKEEIEQEKRRALDVLRNEVA 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           D +V+   +II   ++ D   ++    I  + +   
Sbjct: 140 DMAVKGAEKIIRTTLDADKQKAVVNDMIKEMAASRN 175


>gi|17987827|ref|NP_540461.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. 16M]
 gi|17983555|gb|AAL52725.1| ATP synthase b' chain [Brucella melitensis bv. 1 str. 16M]
          Length = 180

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 77/155 (49%), Gaps = 11/155 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 36  TFGLFY---LFLSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 88

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A     + + 
Sbjct: 89  AQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKA----MSDVG 144

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + + E +  I+ Q +    + +   + + +I++ +
Sbjct: 145 NIAEETMATIVEQLLGLTADKASVSEAVKAIRASN 179


>gi|227513062|ref|ZP_03943111.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227524277|ref|ZP_03954326.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083637|gb|EEI18949.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227088508|gb|EEI23820.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
          Length = 169

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 65/139 (46%), Gaps = 2/139 (1%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D  F++   LI+  +I +    P  +   +   +DKI +DI  A+  R+K+  +  Q + 
Sbjct: 15  DMIFVMISFLILMFLIKLIAWNP--ITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQA 72

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  K  E+   +I  AK   +   E+  ++    ++      E+ I   + EA       
Sbjct: 73  QLDKTREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRKD 132

Query: 124 IADFSVEIVREIISQKMND 142
           +A  S+EI  +IIS+++N+
Sbjct: 133 VASLSIEIATKIISKELNE 151


>gi|300024394|ref|YP_003757005.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526215|gb|ADJ24684.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 187

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 77/167 (46%), Gaps = 24/167 (14%)

Query: 2   HF-DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           HF  + F + ++ +  L ++  + +P +    L+   D+I+ D+  A RL+++++  L  
Sbjct: 34  HFTGQLFWLVLTFVALLFVMSRIALPRVG-DVLEERRDRIKRDLESAARLKDETDAALAN 92

Query: 61  Y-------KEKHSKVEEETREIILAAKHRAKILAEEGCQN--IEQISALYLKDLEQKIHY 111
           Y       +   S + +ETRE         K+ AE   +   ++   A+ L+D E +I  
Sbjct: 93  YEKALADARSNASGIAKETRE---------KLAAETEAERHRVDAQIAVKLQDAEARIST 143

Query: 112 MKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            K +A     + I + + E  R ++S+ +  DV+    +K +    +
Sbjct: 144 TKSKA----VSAIGEVATETARAVVSKLIGHDVSPEDVKKVLQPAPA 186


>gi|85708924|ref|ZP_01039990.1| ATP synthase subunit B [Erythrobacter sp. NAP1]
 gi|85690458|gb|EAQ30461.1| ATP synthase subunit B [Erythrobacter sp. NAP1]
          Length = 173

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 75/149 (50%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +++ + + +V++ ++P  +   LD    +I+  + EA+ LR ++E +  +Y  K + 
Sbjct: 25  WVSLAMAVLIGVVLWKKVPGAIAGGLDNKIAEIKQQLDEAKSLRAEAEKLRDEYAAKIAG 84

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            E++   ++  A+  A  +  +   + E + A   +  E KI   + EA   + A  A+ 
Sbjct: 85  AEKDAEAMMEGAQREADAILAKAEADSEAMVARRQRMAEDKIAAAEREAVDGVRASAANA 144

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
           +    R II+ K + + + ++ ++ I+S+
Sbjct: 145 AAAASRTIIASKHDAEADKALADEVIASL 173


>gi|319936639|ref|ZP_08011052.1| ATP synthase subunit B [Coprobacillus sp. 29_1]
 gi|319808196|gb|EFW04761.1| ATP synthase subunit B [Coprobacillus sp. 29_1]
          Length = 167

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 72/135 (53%), Gaps = 2/135 (1%)

Query: 22  YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH 81
           +L  P  + ++ +  A+ I   I EA+ + EK++  +++ +E+  +  +E R I+  AK 
Sbjct: 33  FLWTP--MQAYFEKRANFIESTINEAKEMNEKAKTFMVESEEQARESAKEYRGIVERAKA 90

Query: 82  RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN 141
            A  + ++   + ++ ++  LK  E++I   K +AK  +  ++   ++E+  +++S++MN
Sbjct: 91  DALKVRDDIVADAKKEASNKLKQAEREIEAEKQQAKEEMKEEMVGIAIEVAAKVLSKEMN 150

Query: 142 DDVNSSIFEKTISSI 156
              N  + E  +  +
Sbjct: 151 SKENQQMVEDFVEKV 165


>gi|115526765|ref|YP_783676.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
 gi|122294476|sp|Q07H88|ATPX_RHOP5 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|115520712|gb|ABJ08696.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
          Length = 181

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
           + ++ +   +IV  + +P +    LDA   KI DD   A RL+ +S++ L  Y++  ++ 
Sbjct: 36  LLIAFVALYLIVSKVALPKVG-GVLDARQKKIEDDFAAALRLKGESDDALKAYEDALAQA 94

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
               + I    + R    AE   + +EQ  A+ L D E+ I   + +A   +     D +
Sbjct: 95  RARAQAIGTETRERLNAAAEAERKTLEQRLAVKLADAEKTIAATREQAMSNVRGIATDAA 154

Query: 129 VEIVREIIS 137
             IV++++ 
Sbjct: 155 SAIVQQLVG 163


>gi|227510133|ref|ZP_03940182.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227190338|gb|EEI70405.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 169

 Score = 39.7 bits (91), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 63/137 (45%), Gaps = 7/137 (5%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           +FL+ M LI  +         + +   +   +DKI +DI  A+  R+K+  +  Q + + 
Sbjct: 22  SFLILMYLIKLIAW-------NPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQAQL 74

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K  E+   +I  AK   +   E+  ++    ++      E+ I   + EA       +A
Sbjct: 75  DKTREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRKDVA 134

Query: 126 DFSVEIVREIISQKMND 142
             S+EI  +IIS+++N+
Sbjct: 135 SLSIEIATKIISKELNE 151


>gi|23501288|ref|NP_697415.1| F0F1 ATP synthase subunit B' [Brucella suis 1330]
 gi|62289374|ref|YP_221167.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 1 str. 9-941]
 gi|82699299|ref|YP_413873.1| F0F1 ATP synthase subunit B' [Brucella melitensis biovar Abortus
           2308]
 gi|148559980|ref|YP_001258411.1| F0F1 ATP synthase subunit B' [Brucella ovis ATCC 25840]
 gi|161618360|ref|YP_001592247.1| F0F1 ATP synthase subunit B' [Brucella canis ATCC 23365]
 gi|163842668|ref|YP_001627072.1| F0F1 ATP synthase subunit B' [Brucella suis ATCC 23445]
 gi|189023627|ref|YP_001934395.1| F0F1 ATP synthase subunit B' [Brucella abortus S19]
 gi|225626899|ref|ZP_03784938.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237814861|ref|ZP_04593859.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|254688689|ref|ZP_05151943.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 6 str. 870]
 gi|254693172|ref|ZP_05155000.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 3 str. Tulya]
 gi|254696816|ref|ZP_05158644.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701196|ref|ZP_05163024.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 5 str. 513]
 gi|254703741|ref|ZP_05165569.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 3 str. 686]
 gi|254707879|ref|ZP_05169707.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M163/99/10]
 gi|254709537|ref|ZP_05171348.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis B2/94]
 gi|254729723|ref|ZP_05188301.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 4 str. 292]
 gi|256031031|ref|ZP_05444645.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M292/94/1]
 gi|256060523|ref|ZP_05450692.1| F0F1 ATP synthase subunit B' [Brucella neotomae 5K33]
 gi|256159089|ref|ZP_05456915.1| F0F1 ATP synthase subunit B' [Brucella ceti M490/95/1]
 gi|256254434|ref|ZP_05459970.1| F0F1 ATP synthase subunit B' [Brucella ceti B1/94]
 gi|256256936|ref|ZP_05462472.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 9 str. C68]
 gi|256368840|ref|YP_003106346.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260168163|ref|ZP_05754974.1| F0F1 ATP synthase subunit B' [Brucella sp. F5/99]
 gi|260545873|ref|ZP_05821614.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260567004|ref|ZP_05837474.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260754165|ref|ZP_05866513.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757385|ref|ZP_05869733.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761209|ref|ZP_05873552.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883190|ref|ZP_05894804.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213412|ref|ZP_05927693.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|261221602|ref|ZP_05935883.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315370|ref|ZP_05954567.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317063|ref|ZP_05956260.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261324517|ref|ZP_05963714.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751733|ref|ZP_05995442.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261754386|ref|ZP_05998095.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|261757621|ref|ZP_06001330.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265988101|ref|ZP_06100658.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265997566|ref|ZP_06110123.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851767|ref|ZP_06792440.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297247787|ref|ZP_06931505.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
 gi|75505336|sp|Q57EX8|ATPF_BRUAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81753123|sp|Q8G2D9|ATPF1_BRUSU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|123546350|sp|Q2YMC5|ATPF1_BRUA2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694367|sp|B2S9N0|ATPF1_BRUA1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694385|sp|A9M8G0|ATPF1_BRUC2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694387|sp|A5VNW4|ATPF1_BRUO2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694388|sp|B0CK72|ATPF1_BRUSI RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|23347176|gb|AAN29330.1| ATP synthase F0, B subunit, putative [Brucella suis 1330]
 gi|62195506|gb|AAX73806.1| ATP synthase F0, B subunit, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82615400|emb|CAJ10369.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|148371237|gb|ABQ61216.1| putative ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
 gi|161335171|gb|ABX61476.1| ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|163673391|gb|ABY37502.1| ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|189019199|gb|ACD71921.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|225618556|gb|EEH15599.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237789698|gb|EEP63908.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|255998998|gb|ACU47397.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260097280|gb|EEW81155.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260156522|gb|EEW91602.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260667703|gb|EEX54643.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671641|gb|EEX58462.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674273|gb|EEX61094.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872718|gb|EEX79787.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915019|gb|EEX81880.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|260920186|gb|EEX86839.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261296286|gb|EEX99782.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300497|gb|EEY03994.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304396|gb|EEY07893.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737605|gb|EEY25601.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741486|gb|EEY29412.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261744139|gb|EEY32065.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|262552034|gb|EEZ08024.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|264660298|gb|EEZ30559.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|294820356|gb|EFG37355.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297174956|gb|EFH34303.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
          Length = 208

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 76/155 (49%), Gaps = 11/155 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 64  TFGLFY---LFLSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 116

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A     + + 
Sbjct: 117 AQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKA----MSDVG 172

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + + E    I+ Q +    + +   + + +I++ +
Sbjct: 173 NIAEETTATIVEQLLGLTADKASVSEAVKAIRASN 207


>gi|254713046|ref|ZP_05174857.1| F0F1 ATP synthase subunit B' [Brucella ceti M644/93/1]
 gi|254716601|ref|ZP_05178412.1| F0F1 ATP synthase subunit B' [Brucella ceti M13/05/1]
 gi|261218400|ref|ZP_05932681.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261320751|ref|ZP_05959948.1| ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|260923489|gb|EEX90057.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293441|gb|EEX96937.1| ATP synthase subunit B [Brucella ceti M644/93/1]
          Length = 208

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 76/155 (49%), Gaps = 11/155 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 64  TFGLFY---LFLSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIADYEQEL 116

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A     + + 
Sbjct: 117 AQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKA----MSDVG 172

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + + E    I+ Q +    + +   + + +I++ +
Sbjct: 173 NIAEETTATIVEQLLGLTADKASVSEAVKAIRASN 207


>gi|225851924|ref|YP_002732157.1| F0F1 ATP synthase subunit B' [Brucella melitensis ATCC 23457]
 gi|256044106|ref|ZP_05447017.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112904|ref|ZP_05453820.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 3 str. Ether]
 gi|256264564|ref|ZP_05467096.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|260563465|ref|ZP_05833951.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|265990518|ref|ZP_06103075.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994346|ref|ZP_06106903.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|226741364|sp|Q8YFH7|ATPF_BRUME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|2984782|gb|AAC08030.1| ATP synthase subunit B' [Brucella melitensis]
 gi|225640289|gb|ACO00203.1| ATP synthase B' chain [Brucella melitensis ATCC 23457]
 gi|260153481|gb|EEW88573.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|262765459|gb|EEZ11248.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001302|gb|EEZ13877.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094929|gb|EEZ18637.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|326408423|gb|ADZ65488.1| F0F1 ATP synthase subunit B' [Brucella melitensis M28]
 gi|326538137|gb|ADZ86352.1| ATP synthase B' chain [Brucella melitensis M5-90]
          Length = 208

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 77/155 (49%), Gaps = 11/155 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 64  TFGLFY---LFLSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 116

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A     + + 
Sbjct: 117 AQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKA----MSDVG 172

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + + E +  I+ Q +    + +   + + +I++ +
Sbjct: 173 NIAEETMATIVEQLLGLTADKASVSEAVKAIRASN 207


>gi|306842325|ref|ZP_07474984.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
 gi|306845018|ref|ZP_07477599.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306274650|gb|EFM56439.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306287541|gb|EFM59000.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
          Length = 208

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 76/155 (49%), Gaps = 11/155 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 64  TFGLFY---LFLSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 116

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A     + + 
Sbjct: 117 AQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKA----MSDVG 172

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + + E    I+ Q +    + +   + + +I++ +
Sbjct: 173 NIAEETTATIVEQLLGLKADKASVSEAVKAIRASN 207


>gi|220927391|ref|YP_002502693.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
          nodulans ORS 2060]
 gi|219951998|gb|ACL62390.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
          nodulans ORS 2060]
          Length = 162

 Score = 39.3 bits (90), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 37/63 (58%)

Query: 1  MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
          M  +  F V ++ ++F  IV       ++L+ LD   +++R ++ EARRLRE++  +L  
Sbjct: 1  MLMEPEFWVAVAFVVFCGIVWKAGGFDLILNGLDHRGERVRRELEEARRLREEAAAVLAD 60

Query: 61 YKE 63
          Y++
Sbjct: 61 YQK 63


>gi|329113592|ref|ZP_08242372.1| ATP synthase subunit b [Acetobacter pomorum DM001]
 gi|326697114|gb|EGE48775.1| ATP synthase subunit b [Acetobacter pomorum DM001]
          Length = 167

 Score = 39.3 bits (90), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 6  TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           F V +S ++F V+V   +I   + + LD+ A++IR+++ EA RLR ++E +L
Sbjct: 9  GFWVAVSFVLFFVLVGK-KIWGPIATILDSRANRIREELDEAARLRREAEQML 60


>gi|237739743|ref|ZP_04570224.1| ATP synthase subunit B [Fusobacterium sp. 2_1_31]
 gi|262066573|ref|ZP_06026185.1| ATP synthase F0, B subunit [Fusobacterium periodonticum ATCC 33693]
 gi|294783127|ref|ZP_06748451.1| ATP synthase F0, B subunit [Fusobacterium sp. 1_1_41FAA]
 gi|229423351|gb|EEO38398.1| ATP synthase subunit B [Fusobacterium sp. 2_1_31]
 gi|291379708|gb|EFE87226.1| ATP synthase F0, B subunit [Fusobacterium periodonticum ATCC 33693]
 gi|294480005|gb|EFG27782.1| ATP synthase F0, B subunit [Fusobacterium sp. 1_1_41FAA]
          Length = 163

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 87/167 (52%), Gaps = 22/167 (13%)

Query: 1   MHFDETFLVFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEARRLREKSEN 56
           +  D TF  F  +I F V++     Y + P  +   ++    KI  ++ EA + RE++E 
Sbjct: 4   ISIDATF--FWQIINFFVLLFIVKKYFKEP--ISKIINERKQKIEAELVEATKNREEAEK 59

Query: 57  ILMQYKEKHSKV---EEETREIILAAKHRAK----ILAEEGCQNIEQISALYLKDLEQKI 109
           +   +KE  ++V    +E  EI+  A+ +A+    +L +E  +N E I    L+  E ++
Sbjct: 60  L---HKEAEAQVLNSRKEASEIVKNAQRKAEEEAHLLIKEARENRENI----LRATELEV 112

Query: 110 HYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +K + K  L  ++ + + E+  +II +K++D+  +S+ +K I+ +
Sbjct: 113 TKIKNDTKDELGREVKNLAAELAEKIIKEKVDDNQETSLIDKFIAEV 159


>gi|35436123|gb|AAO45677.1| AtpB [Streptococcus viridans]
          Length = 164

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 76/154 (49%), Gaps = 12/154 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRL 119
           +   +E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + 
Sbjct: 71  AGSRKEAKTIIENAKETAEKSKASILAD------AKLEAGRLKEKANQEIAQNKAEALQS 124

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           +  ++AD ++ +  +IIS+ ++   +  + ++ I
Sbjct: 125 VKGEVADLTISLAGKIISENLDGHAHKELIDQYI 158


>gi|85374331|ref|YP_458393.1| AtpF, ATP synthase F0, B subunit [Erythrobacter litoralis HTCC2594]
 gi|122544275|sp|Q2N9P5|ATPF_ERYLH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|84787414|gb|ABC63596.1| AtpF, ATP synthase F0, B subunit [Erythrobacter litoralis HTCC2594]
          Length = 187

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 48/82 (58%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
           V +++++ + I+++ ++PS++   LD    +I+  + EA+ LR ++E +  +Y  K +  
Sbjct: 40  VSVAMLVLIAIMLWKKVPSLVTGGLDNKIAEIKAQLDEAKALRAEAEKLRDEYTAKIANA 99

Query: 69  EEETREIILAAKHRAKILAEEG 90
           E++   ++  A+H A  + E+ 
Sbjct: 100 EKDAEAMMENARHEADAILEKA 121


>gi|258543512|ref|YP_003188945.1| ATP synthase F0 subunit beta' [Acetobacter pasteurianus IFO
          3283-01]
 gi|256634590|dbj|BAI00566.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01]
 gi|256637646|dbj|BAI03615.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-03]
 gi|256640700|dbj|BAI06662.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-07]
 gi|256643755|dbj|BAI09710.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-22]
 gi|256646810|dbj|BAI12758.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-26]
 gi|256649863|dbj|BAI15804.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-32]
 gi|256652853|dbj|BAI18787.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256655907|dbj|BAI21834.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-12]
          Length = 167

 Score = 38.9 bits (89), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 7/55 (12%)

Query: 7  FLVFMSLIIFLVIV---VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
          F V +S ++F V+V   ++L I ++L    D+ A++IR+++ EA RLR ++E +L
Sbjct: 10 FWVAVSFVLFFVLVGKKIWLPITTVL----DSRANRIREELDEAARLRREAEQML 60


>gi|262276821|ref|ZP_06054614.1| H+-transporting two-sector ATPase [alpha proteobacterium HIMB114]
 gi|262223924|gb|EEY74383.1| H+-transporting two-sector ATPase [alpha proteobacterium HIMB114]
          Length = 163

 Score = 38.9 bits (89), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (60%)

Query: 3  FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
          FD +F V ++  +F++++V+ ++P I+L  +D   +++++ I EA  L+  SE +L + K
Sbjct: 2  FDASFWVAIAFFLFVLLLVFKKVPQIVLGQIDNKINELKNKINEAEELKSNSEKLLSEAK 61

Query: 63 EKHSKVEEETREIILAAKH 81
           K  K +EE   I+  A+ 
Sbjct: 62 SKLEKSDEENSNILAKAQK 80


>gi|218439574|ref|YP_002377903.1| ATP synthase F0 subunit beta [Cyanothece sp. PCC 7424]
 gi|218172302|gb|ACK71035.1| ATP synthase F0, B subunit [Cyanothece sp. PCC 7424]
          Length = 179

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 72/154 (46%), Gaps = 9/154 (5%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L I + +++Y    S L   L    +KI  +I EA      +   L Q +EK ++ +
Sbjct: 31  LLNLAILVGVLIYFGRNS-LGKILSERREKIAQEIQEAESRASNAAKALAQEQEKLAQAK 89

Query: 70  EETREIILAAKHRA----KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            E + I+ A+  RA    + +A +  ++IE++ A   +DL  +   +  E    L  ++A
Sbjct: 90  AEAQRILAASNERAEAAKQAIAVQTEKDIERLKATAAQDLSTEQERVITE----LRQRVA 145

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             ++E V   +   ++D     +  KTI+S+   
Sbjct: 146 AMALERVESTLKNTLDDSTQQQLINKTIASLGGS 179


>gi|254718568|ref|ZP_05180379.1| F0F1 ATP synthase subunit B' [Brucella sp. 83/13]
 gi|265983543|ref|ZP_06096278.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306837305|ref|ZP_07470188.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
 gi|264662135|gb|EEZ32396.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306407618|gb|EFM63814.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
          Length = 208

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 75/155 (48%), Gaps = 11/155 (7%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 64  TFGLFY---LFLSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 116

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+    + E +    LK+ E +I  +K +A     + + 
Sbjct: 117 AQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEGRIAAIKAKA----MSDVG 172

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + + E    I+ Q +    + +   + + +I++ +
Sbjct: 173 NIAEETTATIVEQLLGLKADKASVSEAVKAIRASN 207


>gi|153007847|ref|YP_001369062.1| F0F1 ATP synthase subunit B' [Ochrobactrum anthropi ATCC 49188]
 gi|226694372|sp|A6WW79|ATPF1_OCHA4 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|151559735|gb|ABS13233.1| H+transporting two-sector ATPase B/B' subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 205

 Score = 38.5 bits (88), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 67/136 (49%), Gaps = 7/136 (5%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +F+  VV  RI  ++    +   D+I  D+ +A RL++ ++N +  Y+++ 
Sbjct: 64  TFGLFY---LFMSRVVLPRIGGVI----ETRRDRIAQDLEQAARLKQDADNAIAAYEQEL 116

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   +   I  AA+ + K  A+      E      LK+ E++I  +K +A   +     
Sbjct: 117 TQARTKAASIAEAAREKGKGEADAERATAEAALERKLKEAEERIAAIKAKAMNDVGNIAE 176

Query: 126 DFSVEIVREIISQKMN 141
           + + EIV +++  K +
Sbjct: 177 ETTAEIVEQLLGTKAD 192


>gi|313899142|ref|ZP_07832667.1| ATP synthase F0, B subunit [Clostridium sp. HGF2]
 gi|312956082|gb|EFR37725.1| ATP synthase F0, B subunit [Clostridium sp. HGF2]
          Length = 172

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 76/156 (48%), Gaps = 19/156 (12%)

Query: 1   MHFD-ETFLVFMSLIIFLVIVVYLRIPSI--------LLSFLDAHADKIRDDIFEARRLR 51
           M FD   +L    + + +V V  L I +I        +L++LDA    I+ DI    + R
Sbjct: 1   MDFDINAYLRLNPMDMIMVCVSTLIIIAIAKHFFWDKVLAYLDARKAAIQADIDAGMQSR 60

Query: 52  EKSENILMQYKEKHSKVEEETREIILAAKHRA-----KILAEEGCQNIEQISALYLKDLE 106
           E  E    QY+E+ +    E  EI+ +AK  A     +ILA    +  E +     KD+E
Sbjct: 61  EAGEQYKRQYEEQMANARGEAHEILESAKANAVQEKREILAAARGE-AEAVKEKARKDIE 119

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMND 142
           ++    K++A+  +   I D + E  ++I+++++++
Sbjct: 120 RE----KVQARAGMKDAIVDVAFEAAKQIVNKELDE 151


>gi|254471829|ref|ZP_05085230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062]
 gi|211959031|gb|EEA94230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062]
          Length = 184

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 75/147 (51%), Gaps = 15/147 (10%)

Query: 3   FDETFLVFMSLIIFLVI---VVYLRIPSILL----SFLDAHADKIRDDIFEARRLREKSE 55
           FD T   F S +++LV+   V Y  +  ++L      L+   D+I  D+ EA RL+++++
Sbjct: 27  FDST--TFPSQLLWLVLSFGVFYWVMSKVVLPRIGGILEDRRDRIAGDMAEASRLKQETD 84

Query: 56  NILMQYKEKHSKVEEETREIILAAKHRAKILAE-EGCQNI--EQISALYLKDLEQKIHYM 112
             +  Y  + +  +   +   +A   R+K+ AE EG +    EQ++A  L + EQ I  +
Sbjct: 85  EAIASY--ESALADARKKATTMAHDARSKVKAETEGARAAAEEQLAA-KLSESEQSISKI 141

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQK 139
           K E+   +    A+ + E+V+ +I  +
Sbjct: 142 KAESLSHVGEIAAETTGELVKALIGGR 168


>gi|217979916|ref|YP_002364063.1| H+transporting two-sector ATPase B/B' subunit [Methylocella
          silvestris BL2]
 gi|217505292|gb|ACK52701.1| H+transporting two-sector ATPase B/B' subunit [Methylocella
          silvestris BL2]
          Length = 160

 Score = 38.5 bits (88), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 4  DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
          +ETF+ F   ++ + +  YL +   +   LD+  ++I+ ++ EA+RLR ++E +L  + +
Sbjct: 4  EETFVAF-GFLLLVGLFAYLGVHKKIAGALDSRGERIKGELAEAQRLRAEAEAVLASFGK 62

Query: 64 K 64
          +
Sbjct: 63 R 63


>gi|170747145|ref|YP_001753405.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
          radiotolerans JCM 2831]
 gi|226741512|sp|B1LWM0|ATPF_METRJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|170653667|gb|ACB22722.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
          radiotolerans JCM 2831]
          Length = 162

 Score = 38.5 bits (88), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 1  MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
          M  +  F V ++  IF+ I   +   S +   LD  A+++R ++ EA+RLRE++  +L  
Sbjct: 1  MLLEAEFWVAVAFFIFMGIAWKVGAFSAMTKGLDGRANRVRHELDEAKRLREEAAAVLAD 60

Query: 61 Y 61
          Y
Sbjct: 61 Y 61


>gi|114328534|ref|YP_745691.1| ATP synthase B chain [Granulibacter bethesdensis CGDNIH1]
 gi|122326512|sp|Q0BQY4|ATPF2_GRABC RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP
          synthase F(0) sector subunit b 2; AltName: Full=ATPase
          subunit I 2; AltName: Full=F-type ATPase subunit b 2;
          Short=F-ATPase subunit b 2
 gi|114316708|gb|ABI62768.1| ATP synthase B chain [Granulibacter bethesdensis CGDNIH1]
          Length = 171

 Score = 38.5 bits (88), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 6  TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F V ++ ++F V+    +I   L S LD++AD++R ++ EAR+LR ++E +L   + + 
Sbjct: 15 VFWVAVAFVLFFVLFGR-KIWGALTSKLDSYADEVRQNLDEARKLRREAEAMLEDARRRK 73

Query: 66 SKVEEETREII 76
           +   E + ++
Sbjct: 74 EQALAEAKRLL 84


>gi|220932620|ref|YP_002509528.1| ATP synthase F0, B subunit [Halothermothrix orenii H 168]
 gi|219993930|gb|ACL70533.1| ATP synthase F0, B subunit [Halothermothrix orenii H 168]
          Length = 166

 Score = 38.5 bits (88), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 51/88 (57%), Gaps = 4/88 (4%)

Query: 4  DETFLVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
          DE  L    ++ FLV++  L+  +   L  FLD  + KI++++  A R +E+++ +  +Y
Sbjct: 5  DERLL--WQVVNFLVLMWLLKRFLYGPLTEFLDKRSQKIKNELDSAARKKEEADKLKKEY 62

Query: 62 KEKHSKVEEETREIILAAKHRAKILAEE 89
          + K  +  ++ +EII  A+ RA+  AEE
Sbjct: 63 ESKLQQARDKAQEIIEDAEKRAQQRAEE 90


>gi|251771548|gb|EES52125.1| ATP synthase F0, B subunit [Leptospirillum ferrodiazotrophum]
          Length = 168

 Score = 38.1 bits (87), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 48/101 (47%), Gaps = 7/101 (6%)

Query: 2   HFDETFL---VFMSLIIF---LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSE 55
            FD  F    +F SL+ F   L IV     PS L+  LD    K+  D+  AR+ RE++E
Sbjct: 3   QFDSQFFPSTIFWSLVSFALMLFIVGKYLYPS-LIRILDERRTKVSSDMEAARKSREEAE 61

Query: 56  NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ 96
            +L +  E   K   +   +I  A+  A+ L EE  + I Q
Sbjct: 62  KLLAEQHELLEKARAQAENMIRQAEEMARTLREEREKEIAQ 102


>gi|309390209|gb|ADO78089.1| ATP synthase F0, B subunit [Halanaerobium praevalens DSM 2228]
          Length = 166

 Score = 38.1 bits (87), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 71/144 (49%), Gaps = 20/144 (13%)

Query: 9   VFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY----K 62
           +   L+ F V++  LR  + + +   LD  A +I  D+ +A   R+++E +  +Y    K
Sbjct: 8   MLWQLVNFFVLLFLLRKFLYAPIKGMLDQRAAQINGDLDDAEARRKEAEELKAKYEQKLK 67

Query: 63  EKHSKVEE-----ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
           E HS+ +E     ETR     A  +AK +  E  +  E + A  L+++EQ     K EA 
Sbjct: 68  EAHSEAQEIIDNAETR-----ANKKAKEIINEAEEKAENLKAKKLEEIEQ----AKKEAT 118

Query: 118 RLLYAKIADFSVEIVREIISQKMN 141
             L   +AD+++     +I ++++
Sbjct: 119 AELRDSLADYTILAANNLIQEQLD 142


>gi|67458419|ref|YP_246043.1| F0F1 ATP synthase subunit B [Rickettsia felis URRWXCal2]
 gi|75537108|sp|Q4UNI0|ATPF_RICFE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|67003952|gb|AAY60878.1| ATP synthase B chain precursor [Rickettsia felis URRWXCal2]
          Length = 164

 Score = 38.1 bits (87), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 82/168 (48%), Gaps = 6/168 (3%)

Query: 1   MHF-DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M+F DE+F + +S IIF V ++Y      +L+ LDA   ++++ + +A +L+E +  +  
Sbjct: 1   MNFLDESFWLAVSFIIF-VYLIYRPAKKAILNSLDAKILEVQEKVLKAEKLKEDAALLFE 59

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           Q   +  K+E    ++I  +    K + +E  + IE+       D  Q I   K  A + 
Sbjct: 60  QTNAQIQKLETLRSQMIEESNEVTKKIIQEKTKEIEEFLEHKKSDAIQLIQNQKSTATKE 119

Query: 120 LYAKIADFSVEIVREII-SQKMNDDVNSSIFEKTISSIQSCHQMDKNT 166
           L  +  D  +++V E   S K ++   S+I +  +    S H  DK+T
Sbjct: 120 LQDEFCDEVIKLVSEYFQSAKFSE---SNIAKNLMDKSDSSHNNDKST 164


>gi|2984783|gb|AAC08031.1| ATP synthase subunit B [Brucella melitensis]
          Length = 129

 Score = 38.1 bits (87), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 9/114 (7%)

Query: 50  LREKSE-----NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKD 104
           LRE+S      NI+   +    K E+E  +I+ +A+  AK L EE  +  E+  A   K 
Sbjct: 17  LREESPAIAGPNIIASAR----KPEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKL 72

Query: 105 LEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            EQKI   + +A   + A   D +V     I+++K++     ++F   ++ ++S
Sbjct: 73  AEQKIATAETDAINAVRASAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 126


>gi|86356512|ref|YP_468404.1| F0F1 ATP synthase subunit B' [Rhizobium etli CFN 42]
 gi|123512872|sp|Q2KBV9|ATPX_RHIEC RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|86280614|gb|ABC89677.1| ATP synthase protein, subunit B` [Rhizobium etli CFN 42]
          Length = 207

 Score = 38.1 bits (87), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 70/143 (48%), Gaps = 13/143 (9%)

Query: 3   FDETFLVFMSLIIFLVI---VVYLRIPSILL----SFLDAHADKIRDDIFEARRLREKSE 55
           FD T   + S +++LVI   V YL +  ++     + LD    +I  D+ EA RL+ +++
Sbjct: 49  FDST--TYASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHKRISQDLEEAGRLKAEAD 106

Query: 56  NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE 115
             +  Y+ + +    ++  I  AA+  AK+ AEE  + +E   +  +K  E +I  +K +
Sbjct: 107 AAVQTYEGELAAARAKSHAIGSAARDAAKVKAEEDRRTVEASLSEKIKAAEARIADIKAK 166

Query: 116 AKRLLYAKIADFSVEIVREIISQ 138
           A    +A +   + E    ++ Q
Sbjct: 167 A----FADVGTIAEETAAAVVEQ 185


>gi|260586968|ref|ZP_05852881.1| ATP synthase F0, B subunit [Blautia hansenii DSM 20583]
 gi|331083915|ref|ZP_08333024.1| ATP synthase F0 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260542652|gb|EEX23221.1| ATP synthase F0, B subunit [Blautia hansenii DSM 20583]
 gi|330403340|gb|EGG82900.1| ATP synthase F0 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 166

 Score = 38.1 bits (87), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 31/163 (19%), Positives = 82/163 (50%), Gaps = 2/163 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + ++  + +   ++++L++  +L  P  +L  ++     I  ++ EAR  REK+E + +Q
Sbjct: 4   LGWNLVWTIINLIVLYLLMKKFLIGP--VLGIMEKRKACIAKEMEEARVSREKAEELKVQ 61

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y++  +  +EE+ +I+  AK  A+   E   +N    +A  ++  +      +  A +  
Sbjct: 62  YEKSLAMAKEESSQILENAKTDARQARESIVKNANDEAAKIIEAAQNTARQEQENAMQGA 121

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
             +IA  +++  ++++ +K N++ N  +++K ++        D
Sbjct: 122 KKEIAQLAMQAAKKLLLEKSNENSNDMLYDKFLAKAGDADDTD 164


>gi|309775240|ref|ZP_07670250.1| ATP synthase F0, B subunit [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916992|gb|EFP62722.1| ATP synthase F0, B subunit [Erysipelotrichaceae bacterium 3_1_53]
          Length = 172

 Score = 37.7 bits (86), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 71/140 (50%), Gaps = 11/140 (7%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V +S +I + +  +     +L ++LDA    I+ DI    + RE  E    QY+E+ + 
Sbjct: 18  MVCISTLIIVAVAKHFFWDKVL-AYLDARKAAIQADIDAGTQSREAGEQYKRQYEEQMAN 76

Query: 68  VEEETREIILAAKHRA-----KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
              E  EI+ +AK  A     +ILA    +  E +     KD+E++    K++A+  +  
Sbjct: 77  ARGEAHEILESAKANAVQEKREILAAARGE-AEAVKEKARKDIERE----KVQARAEMKD 131

Query: 123 KIADFSVEIVREIISQKMND 142
            I D + E  ++I+++++++
Sbjct: 132 AIVDVAFEAAKQIVNKELDE 151


>gi|295109099|emb|CBL23052.1| ATP synthase F0 subcomplex B subunit [Ruminococcus obeum A2-162]
          Length = 167

 Score = 37.4 bits (85), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 72/139 (51%), Gaps = 7/139 (5%)

Query: 10  FMSLIIFLVIVVYLRIPSILLS----FLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F++ I  L I VYL I   L       LD    K   +I +A + +E+++ +  +Y++  
Sbjct: 14  FIATICNLFIQVYL-IKRFLFKPINEMLDKRKAKADAEIQDAVKAKEEAQAMKAEYEKNM 72

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNI-EQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            + +E   EI++ A+  A + +EE  +    Q++A+  K  E+ I   K +A   +  +I
Sbjct: 73  QEAKERANEIVMTAQKTAAVQSEEMLKEASSQVTAMKEK-AEKDIAQEKRKAVNEIKGEI 131

Query: 125 ADFSVEIVREIISQKMNDD 143
              +VEI  ++I +++N++
Sbjct: 132 GGMAVEIAGKVIEREINEE 150


>gi|319406085|emb|CBI79715.1| ATP synthase subunit b 1 (modular protein) [Bartonella sp. AR 15-3]
          Length = 210

 Score = 37.4 bits (85), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 84/156 (53%), Gaps = 10/156 (6%)

Query: 1   MHFDETFLVF-MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           ++F   FL   +S   F + V  + +P I    ++   D+I  D+ +A R++++++ ++ 
Sbjct: 57  LYFASHFLWLAISFGFFYLFVSRIIVPRIG-GVIETRRDRIVSDLDQAMRIKQETDIVIE 115

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
            Y++K ++   E + +I AA +  K+ AE   + IE +    L+D E KI  ++ +A + 
Sbjct: 116 IYEKKLAEARLEAKNMIQAANNEIKLKAELQRKKIEAVLEKKLEDAEDKIKKIQDKAMQN 175

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           +     + + EI++++I      DV+  I +K+ISS
Sbjct: 176 INLIAEEITFEIIKKLI------DVD--ISKKSISS 203


>gi|231608|sp|P21904|ATPF_PROMO RecName: Full=ATP synthase subunit b, sodium ion specific; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I; AltName: Full=F-type ATPase
           subunit b; Short=F-ATPase subunit b
 gi|581457|emb|CAA37913.1| unnamed protein product [Propionigenium modestum]
          Length = 168

 Score = 37.0 bits (84), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 78/155 (50%), Gaps = 12/155 (7%)

Query: 9   VFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +F  +I FL+++ + +      +   LDA  +KI +D+ +A   +E +     + +    
Sbjct: 15  MFWQIINFLILMFFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVK 74

Query: 67  KVEEETREIILAAKHRA-----KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
             + E  E++L A+ +A      IL E   Q  +      LK  E +I  MK +A++ L 
Sbjct: 75  SAKTEANEMLLRAEKKADERKETILKEANTQREK-----MLKSAEVEIEKMKEQARKELQ 129

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++ D +V++  ++I++K++  + +++ ++ I  +
Sbjct: 130 LEVTDLAVKLAEKMINEKVDAKIGANLLDQFIGEV 164


>gi|45603|emb|CAA46896.1| ATPase b subunit [Propionigenium modestum]
 gi|45610|emb|CAA38580.1| ATPase b subunit [Propionigenium modestum]
 gi|45651|emb|CAA41370.1| F0 subunit [Propionigenium modestum]
          Length = 163

 Score = 37.0 bits (84), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 78/155 (50%), Gaps = 12/155 (7%)

Query: 9   VFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +F  +I FL+++ + +      +   LDA  +KI +D+ +A   +E +     + +    
Sbjct: 10  MFWQIINFLILMFFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVK 69

Query: 67  KVEEETREIILAAKHRA-----KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
             + E  E++L A+ +A      IL E   Q  +      LK  E +I  MK +A++ L 
Sbjct: 70  SAKTEANEMLLRAEKKADERKETILKEANTQREK-----MLKSAEVEIEKMKEQARKELQ 124

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++ D +V++  ++I++K++  + +++ ++ I  +
Sbjct: 125 LEVTDLAVKLAEKMINEKVDAKIGANLLDQFIGEV 159


>gi|304382809|ref|ZP_07365292.1| ATP synthase F0 sector subunit B [Prevotella marshii DSM 16973]
 gi|304335994|gb|EFM02241.1| ATP synthase F0 sector subunit B [Prevotella marshii DSM 16973]
          Length = 170

 Score = 37.0 bits (84), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 72/149 (48%), Gaps = 21/149 (14%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIP-SILLSFLDAHADKIRDDIFEARRLREK-------SE 55
           D   L +M+++  +V+ V  +    +++  ++     I D + +A    EK       SE
Sbjct: 7   DSGLLFWMAIVFIIVLAVLWKWGFPVIIKMVNDRKAYIDDSLRKAHEANEKLTNIQKESE 66

Query: 56  NILMQYKEKHSKV---EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYM 112
           +IL + +EK + +     ETRE I+ A   AK  AE         S+  L + + +I   
Sbjct: 67  SILQEAREKQATILKEAAETREAIVQATQ-AKAQAE---------SSRLLAEAKAEIEGE 116

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQKMN 141
           K  A R +  ++A+ SV+I  +++ QK++
Sbjct: 117 KQNAIRDIRLQVAELSVQIAEKVLRQKLD 145


>gi|323339968|ref|ZP_08080235.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
 gi|323092610|gb|EFZ35215.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
          Length = 174

 Score = 37.0 bits (84), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 8/139 (5%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           FL ++   + L+  V       +   ++  A+KI +DI  A   R+K+E +  Q +E   
Sbjct: 18  FLFYLLTFVVLIAAVKHFAWGPVTEMMEKRANKIANDIDSAEDARKKAEELAAQREEALK 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKDLEQK-IHYMKLEAKRLLYA 122
               E  +II     RAK   E+   +I    Q   + +KD  +K I   + EA   +  
Sbjct: 78  DSHVEASKII----DRAKQNGEQQKASIVDSAQSEVMTMKDNAKKDIEQQRQEAMSGIKN 133

Query: 123 KIADFSVEIVREIISQKMN 141
            +A+ S+EI  +II +++N
Sbjct: 134 DVAELSIEIASKIIQKELN 152


>gi|57642136|ref|YP_184614.1| hypothetical protein TK2201 [Thermococcus kodakarensis KOD1]
 gi|57160460|dbj|BAD86390.1| hypothetical membrane protein [Thermococcus kodakarensis KOD1]
          Length = 523

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 6/89 (6%)

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
           E E +E +L    R +++  E  +   ++ ALY    +   H++ +   R LY   AD S
Sbjct: 440 EREVKEFLL----RGEVVQAE--EITGEVKALYSYIKDGNTHWILVVGNRTLYISAADLS 493

Query: 129 VEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            E++ +++S K  D+V   I E  I  I+
Sbjct: 494 EELILKLLSIKQGDNVTVVISEGRIVDIK 522


>gi|332992892|gb|AEF02947.1| ATP synthase F0, B subunit [Alteromonas sp. SN2]
          Length = 288

 Score = 37.0 bits (84), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 5  ETFLVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
          + F V   +I FL++V  L+  +   +L  +DA   KI   +  A   ++ +EN+  QYK
Sbjct: 4  DWFTVIAQIINFLILVWLLKRFLYRPILDGIDAREHKIASVLSNAETQKKHAENLEAQYK 63

Query: 63 EKHSKVEEETREIILAAK---HRAKILA 87
          EK + ++ E   II  AK   H+A + A
Sbjct: 64 EKLTNIDAERSTIIELAKAEAHKATLAA 91


>gi|163761009|ref|ZP_02168087.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
 gi|162281790|gb|EDQ32083.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
          Length = 203

 Score = 37.0 bits (84), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 17/125 (13%)

Query: 3   FDETFLVFMSLIIFLVI-----------VVYLRIPSILLSFLDAHADKIRDDIFEARRLR 51
           FD++   F S +++L I           VV  RI  IL    +   D+I  D+ EA RL+
Sbjct: 46  FDQS--TFASQLLWLAITFGLFYLLMSRVVVPRIGGIL----EHRRDRIAQDLDEANRLK 99

Query: 52  EKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHY 111
           E+++  +  Y+++ ++  +++  I  AA+ +AK  A+      E   +  + D E+ I  
Sbjct: 100 EEADAAIAAYEQELAEARKKSSAIAEAAREKAKSAADAERAATEAELSAKMADAEKSIAA 159

Query: 112 MKLEA 116
           +K +A
Sbjct: 160 IKAKA 164


>gi|266620421|ref|ZP_06113356.1| ATP synthase F0, B subunit [Clostridium hathewayi DSM 13479]
 gi|288867998|gb|EFD00297.1| ATP synthase F0, B subunit [Clostridium hathewayi DSM 13479]
          Length = 166

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/160 (18%), Positives = 76/160 (47%), Gaps = 2/160 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + F+  + +   ++++L++  +L  P  ++  ++     +   I  AR    ++  +  Q
Sbjct: 4   LDFNLVWNIVNVIVLYLLLKHFLIKP--VMDIMNKRQAMVDQSITNARESESQASELKSQ 61

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+EK +   EE + ++  AK  AK + E   +   + +   +++  +  +  + +A R  
Sbjct: 62  YEEKLAASAEEGKRLVEEAKAEAKTVQERMIKEAGEQADRIIENAHKTANADQEKAMREA 121

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            A+IA   +    +++  +MND  N +++++ I+     H
Sbjct: 122 EAQIAGLVLAAAAKVVQGEMNDRKNQALYDQYIAEAGDSH 161


>gi|67920480|ref|ZP_00514000.1| H+-transporting two-sector ATPase, B/B' subunit [Crocosphaera
           watsonii WH 8501]
 gi|67857964|gb|EAM53203.1| H+-transporting two-sector ATPase, B/B' subunit [Crocosphaera
           watsonii WH 8501]
          Length = 143

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 66/138 (47%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD T  +     I L I++       L   LD  AD IR      ++   +++ +  QY+
Sbjct: 4   FDATLPLMALQFILLAIILNAIFYKPLNKALDERADYIRQKQSGGQKELAEAKELAAQYE 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++  ++++EI+  A+  AK LA E     ++ +    +   Q+I   + EA + L  
Sbjct: 64  QQLAEARKQSQEIVAQAQSEAKQLASEAVAEAQREAIAKKEAAAQEIEQQRQEALKTLEQ 123

Query: 123 KIADFSVEIVREIISQKM 140
           ++   S +I+ +++  ++
Sbjct: 124 QVDTLSRQILEKLLGPEL 141


>gi|166367754|ref|YP_001660027.1| F0F1 ATP synthase subunit B' [Microcystis aeruginosa NIES-843]
 gi|226737877|sp|B0JWU8|ATPX_MICAN RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|166090127|dbj|BAG04835.1| ATP synthase subunit b' [Microcystis aeruginosa NIES-843]
          Length = 143

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 66/138 (47%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD T  V     I L +++       L   LD  A+ IR     A+    K+E ++ +Y+
Sbjct: 4   FDATLPVMALQFILLAVILNAVFYKPLSKVLDERAEYIRQTESGAKEQLAKTEALVQEYE 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            + S   ++++EII  A+  A+ LA E     ++ +    + +  +I   K EA R L  
Sbjct: 64  LQLSSARKQSQEIIAQAQAEAQKLASERVAAAQKEAIARKEAVAAEIAQQKEEAFRSLEG 123

Query: 123 KIADFSVEIVREIISQKM 140
           ++A  S +I+ +++  ++
Sbjct: 124 QVASLSRQILEKLLGPEL 141


>gi|257061160|ref|YP_003139048.1| F0F1 ATP synthase subunit B [Cyanothece sp. PCC 8802]
 gi|256591326|gb|ACV02213.1| ATP synthase F0, B subunit [Cyanothece sp. PCC 8802]
          Length = 178

 Score = 36.2 bits (82), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 78/160 (48%), Gaps = 11/160 (6%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  ET L+ +++++ L +V Y     +L + L     +I + I EA   + K+   L  
Sbjct: 24  LNLLETNLINLAILVGL-LVFY--GGKVLGNILTERRSQIAEAIQEAEERQRKAAEALAT 80

Query: 61  YKEKHSKVEEETREIILAAKHRAKIL----AEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
            +EK ++ + E   I  AAK RA  L    AE+  Q++E++      DL  +   +  + 
Sbjct: 81  EQEKLTQAQAEAERIRQAAKERAATLSAEIAEKSRQDVERLRETAASDLSSEQERVIAQL 140

Query: 117 KRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K+    +IA  +VE     +  +++D +   + +++I+ +
Sbjct: 141 KK----QIAQMAVEKAETQLKARIDDGIQERLIDRSIAQL 176


>gi|239948439|ref|ZP_04700192.1| ATP synthase B chain [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239922715|gb|EER22739.1| ATP synthase B chain [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 164

 Score = 36.2 bits (82), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 69/135 (51%), Gaps = 2/135 (1%)

Query: 1   MHF-DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M+F DE+F + +S +IF V ++Y      +L+ LDA   ++++ + +A++L+E +  +  
Sbjct: 1   MNFLDESFWLAVSFVIF-VYLIYRPAKKAILNSLDAKILEVQEKVLKAKKLKEDAALLFE 59

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           Q   +  K+E    ++I  +    K + +E  + IE+       D  Q I   KL A + 
Sbjct: 60  QTNVQIKKLETLRSQMIEESNEVTKKIIQEKTKEIEEFLEHKKFDAIQLIQNQKLTASKE 119

Query: 120 LYAKIADFSVEIVRE 134
           L  +  D  +++V E
Sbjct: 120 LQDEFCDKVIKLVSE 134


>gi|148543698|ref|YP_001271068.1| ATP synthase F0, B subunit [Lactobacillus reuteri DSM 20016]
 gi|184153108|ref|YP_001841449.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194468261|ref|ZP_03074247.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227363323|ref|ZP_03847452.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227544497|ref|ZP_03974546.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300909315|ref|ZP_07126776.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|325682069|ref|ZP_08161587.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
 gi|226741494|sp|A5VIQ7|ATPF_LACRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741495|sp|B2G687|ATPF_LACRJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148530732|gb|ABQ82731.1| ATP synthase F0 subcomplex B subunit [Lactobacillus reuteri DSM
           20016]
 gi|154705566|gb|ABS84209.1| ATP synthase F0 B subunit [Lactobacillus reuteri]
 gi|183224452|dbj|BAG24969.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194453114|gb|EDX42012.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227071630|gb|EEI09924.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227185520|gb|EEI65591.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300893180|gb|EFK86539.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|324978713|gb|EGC15662.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
          Length = 172

 Score = 36.2 bits (82), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 8   LVF--MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           LVF  ++ II +++V +     +    +   ADKI +DI  A R RE +E +  + + + 
Sbjct: 18  LVFYIVTFIILMLLVKHFAWKPVT-DMMKKRADKIANDIDNAARSRESAEKMAAKRQAEL 76

Query: 66  SKVEEETREIILAAK-----HRAKIL--AEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
               +E  EI+  AK      RA+I+  A++  Q ++Q +    KD EQ     + +A  
Sbjct: 77  QSSRQEAAEIVSNAKKSGETQRAQIVETAQKDAQALKQQAQ---KDAEQ----ARRDALN 129

Query: 119 LLYAKIADFSVEIVREIISQKMNDD 143
                +A+ S+EI  ++I +++  D
Sbjct: 130 SAKDDVANLSIEIASKLIQKELKAD 154


>gi|237736346|ref|ZP_04566827.1| ATP synthase subunit B [Fusobacterium mortiferum ATCC 9817]
 gi|229421388|gb|EEO36435.1| ATP synthase subunit B [Fusobacterium mortiferum ATCC 9817]
          Length = 163

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 82/164 (50%), Gaps = 30/164 (18%)

Query: 9   VFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEAR-------RLREKSENI 57
           +F  +I F ++V     Y + P  L   LD+  +KI  D+ EA        +L+++SE I
Sbjct: 10  MFWQIINFFILVFVFNKYFKKP--LGKMLDSRKEKITSDLREADENKKAAIKLQKESEEI 67

Query: 58  LMQYKEKHSKVEEETREIILAAKHRA-----KILAEEGCQNIEQISALYLKDLEQKIHYM 112
           L     + +K+  E  EI+  A+ +A      IL E   Q  E+I    +K  E +   M
Sbjct: 68  L-----RKAKI--EANEILKTAEKKADERRESILNEAKTQR-EKI----IKTAEMEALKM 115

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K +AK +L  ++   +V++  ++I +++N  + S++ ++ I  +
Sbjct: 116 KTDAKEILQEEVKVLAVKLAEKLIEERINPKIESTLIDEFIEGV 159


>gi|296283436|ref|ZP_06861434.1| AtpF, ATP synthase F0, B subunit [Citromicrobium bathyomarinum
           JL354]
          Length = 189

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 74/144 (51%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           L++ LV ++ L+    + + LD+    IR+++ EA+RLR ++E +  +Y  K +  E + 
Sbjct: 46  LLLILVAILRLKAHKSITAGLDSRIAAIREELDEAKRLRAEAETLRDEYAAKIANAESDA 105

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
             ++  A+  A+ + E   ++ +++     +  + KI   + EA   + AK A  +    
Sbjct: 106 EAMLDNARAEAESILERAEEDSKELVERRKRMAQDKISAAEREAVAEVRAKAAAAAAAAS 165

Query: 133 REIISQKMNDDVNSSIFEKTISSI 156
           R +I +K++ D +  + +  I+ I
Sbjct: 166 RSLIGEKLDADADRKLADDMIAGI 189


>gi|319784763|ref|YP_004144239.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170651|gb|ADV14189.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 199

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 64/136 (47%), Gaps = 7/136 (5%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF +F    +FL  VV  R+  I+    D   D+I  D+ +A RL+ +++  +  Y+++ 
Sbjct: 58  TFGLFY---LFLKRVVMPRVGGII----DVRNDRITQDLDQAARLKGEADAAVAAYEQEL 110

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ + +   I   A   AK  A+   + +E      L + E +I  +K  A + + +   
Sbjct: 111 AEAKTKANAIGQQANDAAKAEADTARKKVEAALDAKLGEAEARISSIKANAMKEVGSIAE 170

Query: 126 DFSVEIVREIISQKMN 141
           D +  IV  ++  K +
Sbjct: 171 DTASAIVEALVGGKAS 186


>gi|330824555|ref|YP_004387858.1| integrase family protein [Alicycliphilus denitrificans K601]
 gi|329309927|gb|AEB84342.1| integrase family protein [Alicycliphilus denitrificans K601]
          Length = 640

 Score = 35.8 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 12/72 (16%)

Query: 46  EARRLREKSENILMQYKEKHSKVEEETREIILAAKH-----------RAKILAEEGCQ-N 93
           EAR LR+++ N+L +    HS+ + +   I+LA +H             ++  EEG Q +
Sbjct: 62  EARELRDEARNLLAKGVNPHSERKRKRHAIVLAGEHTFQAVYDQWLAHRRLSLEEGRQTS 121

Query: 94  IEQISALYLKDL 105
           +EQI+ ++ KD+
Sbjct: 122 LEQIARVFKKDV 133


>gi|71795625|ref|NP_001025208.1| calpain-7 [Rattus norvegicus]
 gi|71122393|gb|AAH99770.1| Calpain 7 [Rattus norvegicus]
          Length = 813

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E IS+ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLERIQEKISEYLERVQALHSAVQSKSTDPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|325115734|emb|CBZ51289.1| conserved hypothetical protein [Neospora caninum Liverpool]
          Length = 2069

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 36  HADKIRDDIFE-ARRLREKSENILMQYKEKHSKVEEETR--EIILAAKHRAKILAEEGCQ 92
           HA +  D+I E ++RLR +  ++ +Q  E  S   E     E  +A+  R +  AE+  Q
Sbjct: 579 HAQREADEIAEISKRLRHEIASVNLQKAEAESAARERVSALETQVASLQRQRGEAEQEMQ 638

Query: 93  NIEQISALYLKDLEQ 107
              QI  L LKD+E+
Sbjct: 639 RRTQIEDLVLKDVEE 653


>gi|302346241|ref|YP_003814539.1| ATP synthase F0, B subunit [Prevotella melaninogenica ATCC 25845]
 gi|302150336|gb|ADK96597.1| ATP synthase F0, B subunit [Prevotella melaninogenica ATCC 25845]
          Length = 170

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 73/153 (47%), Gaps = 23/153 (15%)

Query: 4   DETFLVFMSLIIFLVIVVYLR--IPSILL------SFLDAHADKIRDDIFEARRLREKSE 55
           D   L +M+L+  +V  +  +   PSI+        ++D    K  +       ++++ E
Sbjct: 7   DSGLLFWMTLVFLVVFFILWKWGFPSIIKMVNERKEYIDESLAKAEEANLRLANIQKQGE 66

Query: 56  NILMQYKEKHSKV---EEETREIILA-AKHRAKILAEEGCQNIEQISALYLKDLEQKIHY 111
            +LM+ +EK +++     ETRE I+  A+ +A+             SA  L + + +I  
Sbjct: 67  ELLMEAREKQAQILREASETRETIVGQAQEKAR-----------DESARILSEAKAEIES 115

Query: 112 MKLEAKRLLYAKIADFSVEIVREIISQKMNDDV 144
            K  A R + +++A+ SV+I  +I+ ++++   
Sbjct: 116 QKQAAIRDIRSQVAELSVQIAEKILHKELSGSA 148


>gi|159027208|emb|CAO89302.1| atpG [Microcystis aeruginosa PCC 7806]
          Length = 143

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 66/138 (47%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD T  V     I L +++       L   LD  A+ IR     A+    K+E ++ +Y+
Sbjct: 4   FDATLPVMALQFILLAVILNAVFYKPLSKVLDERAEYIRQTEGGAKEQLAKTEALVQEYE 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            + +   ++++EII  A+  A+ LA E     ++ +    + +  +I   K EA R L  
Sbjct: 64  LQLTSARKQSQEIIAQAQAEAQKLASERVAAAQKEAIARKEAVAAEIAQQKEEAFRSLEG 123

Query: 123 KIADFSVEIVREIISQKM 140
           ++A  S +I+ +++  ++
Sbjct: 124 QVASLSRQILEKLLGPEL 141


>gi|284051762|ref|ZP_06381972.1| F0F1 ATP synthase subunit B' [Arthrospira platensis str. Paraca]
          Length = 161

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 69/138 (50%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD T  +     + L  ++       L + +D+ AD IR +   A+    K+E++  QY+
Sbjct: 22  FDATLPLMAVQFLILAAILNQIFYKPLGNAIDSRADYIRQNKLSAKERLSKAESLAKQYE 81

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            + ++  +E++++I+ A+  A+ +A       +Q +    +   Q+I   K+EA++ L  
Sbjct: 82  LELAETRKESQQLIINAQAEAQKIAAREMAAAQQEAQKIREAAYQEIEQNKIEARKGLEQ 141

Query: 123 KIADFSVEIVREIISQKM 140
           ++   S +I+ +++   M
Sbjct: 142 QVDSISRQILDKLLGAGM 159


>gi|253582458|ref|ZP_04859680.1| ATP synthase, B chain [Fusobacterium varium ATCC 27725]
 gi|251835603|gb|EES64142.1| ATP synthase, B chain [Fusobacterium varium ATCC 27725]
          Length = 168

 Score = 35.4 bits (80), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 73/152 (48%), Gaps = 6/152 (3%)

Query: 9   VFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +F  +I F ++V     Y + P  L   L+A   KI  D+ EA   +E +  +  + ++ 
Sbjct: 15  MFWQIINFFILVFVFNKYFKKP--LGKMLEARKTKITSDLNEANANKEAAMKLQKEAEDI 72

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             K + +  EI+  A+H+A    E      ++     +K  E +   MK + ++ L  ++
Sbjct: 73  LKKAKYQANEILKTAEHKADERRENILNEAKEQRDKIIKTAELEAVKMKSDVRKELQDEV 132

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            D +V +  ++I +K+N  + S++ ++ I  +
Sbjct: 133 KDLAVRLAEKLIEEKINPKLESTLIDEFIEEV 164


>gi|261328111|emb|CBH11088.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 663

 Score = 35.4 bits (80), Expect = 3.2,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 36/59 (61%)

Query: 40  IRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQIS 98
           IR+   E  RLRE++  ++++  E++ K++EET E+++      + L EE  + I ++S
Sbjct: 246 IRELNGENERLREETAEVVVKLSEENKKLKEETSEVVVKLSEENERLREETAEVIYKLS 304


>gi|260590645|ref|ZP_05856103.1| ATP synthase F0, B subunit [Prevotella veroralis F0319]
 gi|260537386|gb|EEX20003.1| ATP synthase F0, B subunit [Prevotella veroralis F0319]
          Length = 170

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 73/146 (50%), Gaps = 15/146 (10%)

Query: 4   DETFLVFMSLIIFLVIVVYLR--IPSILL------SFLDAHADKIRDDIFEARRLREKSE 55
           D   L +M+++  +V  +  R   PSI+       +++D    K  +       ++++ E
Sbjct: 7   DGGLLFWMTIVFLVVFFILWRWGFPSIIKMVNERKNYIDESLAKAEEANLRLANIQKQGE 66

Query: 56  NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE 115
            +LM+ +EK +++  E      A++ R  I+ E+  +   + SA  L + + +I   K  
Sbjct: 67  ELLMEAREKQAQILRE------ASQTRDSIV-EQAQEKAHEESARILSEAKAEIESQKQA 119

Query: 116 AKRLLYAKIADFSVEIVREIISQKMN 141
           A R + +++A+ SV+I  +I+ +++ 
Sbjct: 120 AIRDIRSQVAELSVQIAEKILRKQLT 145


>gi|325297716|ref|YP_004257633.1| anti-sigma H sporulation factor, LonB [Bacteroides salanitronis DSM
           18170]
 gi|324317269|gb|ADY35160.1| anti-sigma H sporulation factor, LonB [Bacteroides salanitronis DSM
           18170]
          Length = 839

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 29/45 (64%), Gaps = 7/45 (15%)

Query: 73  REIILAAKHRAKI----LAEEGCQNIEQISALYLKDLEQKIHYMK 113
           RE ILAAK RA I    L EE  ++IE+I  LYLK LE   HY+K
Sbjct: 754 REKILAAK-RAGITDIILCEENRKDIEEIQPLYLKGLE--FHYVK 795


>gi|206603290|gb|EDZ39770.1| ATP synthase F0, subunit B [Leptospirillum sp. Group II '5-way
          CG']
          Length = 175

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 2  HFDETFL------VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSE 55
           FD  F         +S ++ L IV  + +PS L+  L+    ++  D+  AR+ RE+S 
Sbjct: 3  QFDSRFFSSLGMWTVLSFLLMLAIVWKILLPS-LVKVLEERKMRVVSDLEAARKNREESA 61

Query: 56 NILMQYKEKHSKVEEETREIILAAKHRAKILAEE 89
          +IL + K   SK   +  EI+  A+   +++ EE
Sbjct: 62 SILEEQKMLLSKARAQAEEILRQAEEMGRVVREE 95


>gi|218247504|ref|YP_002372875.1| F0F1 ATP synthase subunit B [Cyanothece sp. PCC 8801]
 gi|218167982|gb|ACK66719.1| ATP synthase F0, B subunit [Cyanothece sp. PCC 8801]
          Length = 178

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 77/160 (48%), Gaps = 11/160 (6%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  ET L+ +++++ L++        +L + L     +I + I EA   + K+   L  
Sbjct: 24  LNLLETNLINLAILVGLLVFYG---GKVLGNILTERRSQIAEAIQEAEERQRKAAEALAT 80

Query: 61  YKEKHSKVEEETREIILAAKHRAKIL----AEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
            +EK ++ + E   I  AAK RA  L    AE+  Q++E++      DL  +   +  + 
Sbjct: 81  EQEKLTQAQAEAERIRQAAKERAANLSAEIAEKSRQDVERLRETAASDLSSEQERVIAQL 140

Query: 117 KRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           K+    +IA  +VE     +  +++D +   + +++I+ +
Sbjct: 141 KK----QIAQMAVEKAETQLKARIDDGIQERLIDRSIAQL 176


>gi|154245920|ref|YP_001416878.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
 gi|226694401|sp|A7IGS8|ATPF2_XANP2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|154160005|gb|ABS67221.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
          Length = 207

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 13/158 (8%)

Query: 3   FDETFLVFMSLIIFLVI---VVYLRIPSILLS----FLDAHADKIRDDIFEARRLREKSE 55
           FD T   F S +++LV+   ++YL +  + L      L+   D+I DD+ EA + + +SE
Sbjct: 46  FDAT--TFASQLLWLVLSFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESE 103

Query: 56  NILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLE 115
                Y++  ++   +   I    ++R    +E   +++E   A+ L   EQ I   K E
Sbjct: 104 AAQASYEKALAEARAKANAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTE 163

Query: 116 AKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           A       +   +V+    I+S  +      S  EK +
Sbjct: 164 A----LTHVRGIAVDATHAIVSTLIGSSPAQSDVEKAV 197


>gi|124516449|gb|EAY57957.1| ATP synthase F0, subunit B [Leptospirillum rubarum]
          Length = 175

 Score = 35.0 bits (79), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 2  HFDETFL------VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSE 55
           FD  F         +S ++ L IV  + +PS L+  L+    ++  D+  AR+ RE+S 
Sbjct: 3  QFDSRFFSSLGMWTVLSFLLMLAIVWKILLPS-LVKVLEERKMRVVSDLEAARKNREESA 61

Query: 56 NILMQYKEKHSKVEEETREIILAAKHRAKILAEE 89
          +IL + K   SK   +  EI+  A+   +++ EE
Sbjct: 62 SILEEQKMLLSKARAQAEEILRQAEEMGRVVREE 95


>gi|189183292|ref|YP_001937077.1| ATP synthase B chain precursor [Orientia tsutsugamushi str. Ikeda]
 gi|189180063|dbj|BAG39843.1| ATP synthase B chain precursor [Orientia tsutsugamushi str. Ikeda]
          Length = 154

 Score = 35.0 bits (79), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 63/136 (46%), Gaps = 4/136 (2%)

Query: 15  IFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE 74
           I  +I+ Y    + L++ LD     IR  I ++  +   +E +L++ K+K   +E + R+
Sbjct: 6   ILFIIICYRPFKNFLINTLDCKIKNIRSKIDQSISISNNAEEMLIEAKKK--LIEAQNRK 63

Query: 75  I--ILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
           I  +  A+  A  + E     +E     Y     ++I Y K +AK  +++   DFS  I 
Sbjct: 64  ITTVTQAQKIANNITESRLNELEIRIKEYELHAHERIEYEKYKAKERIFSHFFDFSSNIA 123

Query: 133 REIISQKMNDDVNSSI 148
            + I+  + +   + I
Sbjct: 124 LKYINNTLQNPTTNMI 139


>gi|332188714|ref|ZP_08390428.1| ATP synthase B/B' CF family protein [Sphingomonas sp. S17]
 gi|332011278|gb|EGI53369.1| ATP synthase B/B' CF family protein [Sphingomonas sp. S17]
          Length = 211

 Score = 35.0 bits (79), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 34/57 (59%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENI 57
           + FD T  V ++ ++ L+ ++  ++P+++   LD     IR  + EA +LR+++E +
Sbjct: 52  LGFDSTGWVALAALVVLIGMLVKKVPAMIGRSLDQKIAGIRAQLDEATKLRQEAEAL 108


>gi|170077360|ref|YP_001733998.1| ATP synthase B chain (subunit II) [Synechococcus sp. PCC 7002]
 gi|226698823|sp|B1XHZ1|ATPX_SYNP2 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|169885029|gb|ACA98742.1| ATP synthase B chain (Subunit II) [Synechococcus sp. PCC 7002]
          Length = 161

 Score = 35.0 bits (79), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 5/90 (5%)

Query: 3   FDETFLVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           FD T  V    I FLV+   L       +   +D  +D IR ++ +A+  ++K+E++  Q
Sbjct: 24  FDATLPVMA--IQFLVLAALLNKLFYKPIGQAIDDRSDYIRTNLVDAKERQQKAEDLAAQ 81

Query: 61  YKEKHSKVEEETREIILAAKHRA-KILAEE 89
           Y+++   V  E +++I  A+  A K++A+E
Sbjct: 82  YEQELRDVRREAQDVIAKAQAEAQKVVADE 111


>gi|319404578|emb|CBI78184.1| ATP synthase subunit b 1 [Bartonella rochalimae ATCC BAA-1498]
          Length = 210

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 80/154 (51%), Gaps = 12/154 (7%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HF    + F    +F+  V+  RI S++    +   D+I  D+ +A R++++++ ++   
Sbjct: 62  HFLWLAISFGFFYLFISRVIVPRIGSVI----ETRRDRIVSDLDQAMRMKQEADTVIEIC 117

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           ++K ++   E + II  A +  K+ AE   + IE      L+D E KI  ++ +A + + 
Sbjct: 118 EKKLAEARLEAKTIIQVANNEIKLKAELQREKIEAALEKELEDAENKIKKIQNKAMQNVN 177

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
               + + EI++++I      DV+  I +K+ISS
Sbjct: 178 LIAEEIAFEIIKKLI------DVD--ISKKSISS 203


>gi|160938929|ref|ZP_02086280.1| hypothetical protein CLOBOL_03823 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437892|gb|EDP15652.1| hypothetical protein CLOBOL_03823 [Clostridium bolteae ATCC
           BAA-613]
          Length = 163

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 74/155 (47%), Gaps = 8/155 (5%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           ++  F V   L+++L +  +L  P  + S LD     I  D+ EA+    ++  +  QY+
Sbjct: 7   WNVAFTVINLLVLYLFMKHFLIGP--VRSILDERKQMIEHDLDEAKNRETEARQMKEQYQ 64

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL--- 119
                 +EE   II  A++RA   A E  + + Q  A   K +E+    + LE ++    
Sbjct: 65  ASIGNADEEASRIIEEARNRA---AAEYEKVLAQARADAAKKMEEADRTIALEREKAMND 121

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
           L A +A  ++    ++IS++   D + +++ + ++
Sbjct: 122 LKAGVAGLAMTAAAKLISEQSAPDGDRNLYNRFLA 156


>gi|83591198|ref|YP_431207.1| ATP synthase F0, B subunit [Moorella thermoacetica ATCC 39073]
 gi|123523801|sp|Q2RFX5|ATPF_MOOTA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|1929509|gb|AAB51462.1| ATP synthase subunit b [Moorella thermoacetica]
 gi|83574112|gb|ABC20664.1| ATP synthase F0 subcomplex B subunit [Moorella thermoacetica ATCC
          39073]
          Length = 168

 Score = 34.7 bits (78), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 49/90 (54%), Gaps = 5/90 (5%)

Query: 1  MHFDETFLVFMSLIIFLVI-VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
          ++F+    +F +L + +V+ ++Y+ +   L   L     +I  ++ +A   REK+ENIL 
Sbjct: 8  LNFNPWTFLFQTLNLLVVMGLLYVFLYKPLGKVLADREARIEGNLNDAAAAREKAENILA 67

Query: 60 QYKEKHSKVEEETREIILAAKHRAKILAEE 89
          +Y+++     +E + I+     RA  +AEE
Sbjct: 68 EYRQQLQGARQEAQAIL----DRATKMAEE 93


>gi|330917370|ref|XP_003297788.1| hypothetical protein PTT_08307 [Pyrenophora teres f. teres 0-1]
 gi|311329344|gb|EFQ94117.1| hypothetical protein PTT_08307 [Pyrenophora teres f. teres 0-1]
          Length = 893

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 49  RLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQK 108
           RLREK E  + Q KEK   +E   +++ + AK     L +E  Q  E+ S   L+    K
Sbjct: 265 RLREKVEEQMRQQKEKEGHLERREKDLRVEAKRMG--LQKEKLQEQEKHSQEALQRANVK 322

Query: 109 IHYMKLEAKRLLYAKIADFSVEIVRE 134
               K + K L  A     + EI R+
Sbjct: 323 TEEAKQQIKELQDAAAKQSAEEIARQ 348


>gi|195030120|ref|XP_001987916.1| GH10879 [Drosophila grimshawi]
 gi|193903916|gb|EDW02783.1| GH10879 [Drosophila grimshawi]
          Length = 884

 Score = 34.7 bits (78), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 50  LREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISA----LYLKDL 105
           L  K ENI  QY+E+  +  EETRE+I     +  IL+  G +N     A     Y+  +
Sbjct: 71  LTSKDENISQQYQERWHQFPEETRELI-----KNNILSALGTENTRPSCAAQCVAYVAVI 125

Query: 106 EQKIHYMKLEAKRLLYAKIADFSVEIVRE 134
           E  I+   +  + L+   +++ S E+ RE
Sbjct: 126 ELPINRWGILIQTLVNKVVSEGSSEMHRE 154


>gi|158321584|ref|YP_001514091.1| ATP synthase F0, B subunit [Alkaliphilus oremlandii OhILAs]
 gi|226694436|sp|A8MJW3|ATPF_ALKOO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158141783|gb|ABW20095.1| ATP synthase F0, B subunit [Alkaliphilus oremlandii OhILAs]
          Length = 167

 Score = 34.7 bits (78), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 76/163 (46%), Gaps = 28/163 (17%)

Query: 3   FDETFLVFM--SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           FD TF   +  +LI+FL++  +L  P  +  F+D     I + I EA    ++S  +  Q
Sbjct: 7   FDATFFFQLANTLIMFLILKHFLFQP--VTEFMDKRTKAIEESIAEAELKNKESNELKAQ 64

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K +++++E  +II           +E  +N +       K  ++ +    +EA+R  
Sbjct: 65  YESKLTEIKKERTQII-----------DEAVRNAQ-------KRGDEIVSAAGVEARRT- 105

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
              I   + EI RE   QKM +++   I +  I++ Q   + D
Sbjct: 106 ---IEKATAEIERE--KQKMMNELKGEISQLAIAAAQKVIEKD 143


>gi|153809941|ref|ZP_01962609.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174]
 gi|149834119|gb|EDM89199.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174]
          Length = 167

 Score = 34.7 bits (78), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 75/139 (53%), Gaps = 7/139 (5%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRD----DIFEARRLREKSENILMQYKEKH 65
           F++ I  L I VYL I   L   ++   +K R     +I +A + +E++E +  +Y++  
Sbjct: 14  FIATICNLFIQVYL-IKRFLFKPVNEMLEKRRAKADAEIQDAVKAKEEAEVMKAEYEKNM 72

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNI-EQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            + +E+  +I+L A+  A + +EE  +    Q++A+  K  E+ I   + +A   +  +I
Sbjct: 73  QEAKEKANDIVLTAQKTAAVQSEEMLKEASSQVTAMKEK-AEKDIAQERRKAVNEIKGEI 131

Query: 125 ADFSVEIVREIISQKMNDD 143
              +VEI  ++I +++N++
Sbjct: 132 GGMAVEIAGKVIEREINEE 150


>gi|254467843|ref|ZP_05081249.1| ATP synthase F0, B subunit [beta proteobacterium KB13]
 gi|207086653|gb|EDZ63936.1| ATP synthase F0, B subunit [beta proteobacterium KB13]
          Length = 156

 Score = 34.7 bits (78), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 78/155 (50%), Gaps = 26/155 (16%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLR-------EKSENILMQ 60
           + F  LI F V  V+   P  LL+ ++    +I D +  AR  +       +K+  +L  
Sbjct: 12  MTFAILIWFTVKFVW---PP-LLNAIENRQKEIADGLAAAREGKASLEMAEKKTTEVLDG 67

Query: 61  YKEKHSKV----EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
            KEK S++    E+   EI+  AK  AKI       + ++I A    +++Q+++    +A
Sbjct: 68  AKEKSSEIVSQAEKRASEIVEEAKQNAKI-------DADRIIANAKSEIDQEVN----KA 116

Query: 117 KRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEK 151
           K  L A++A  +VE  ++I+ ++++   +S++  K
Sbjct: 117 KEELRAQVASLAVEGAQKILEKEIDAKAHSAMLAK 151


>gi|329888297|ref|ZP_08266895.1| ATP synthase B chain [Brevundimonas diminuta ATCC 11568]
 gi|328846853|gb|EGF96415.1| ATP synthase B chain [Brevundimonas diminuta ATCC 11568]
          Length = 171

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 86/161 (53%), Gaps = 4/161 (2%)

Query: 2   HF----DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENI 57
           HF    +    V + L+IF+ IVV   +P ++ + LDA A KI+ ++ EA RLR ++E +
Sbjct: 8   HFYDVANPELWVAIGLLIFIAIVVMAGVPKLVATSLDAKAAKIQSELDEAARLRAEAEAM 67

Query: 58  LMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAK 117
           L Q +++ ++ E +  +++  A+  AK L  +    IE+ +A      E++I   + EA 
Sbjct: 68  LAQIRQEKAEAEAQAADLLATAEADAKRLEADAKARIEESTARRQALAERRIAQAEAEAT 127

Query: 118 RLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + + A  AD + +   +I++ ++      ++ ++ I+ I  
Sbjct: 128 QEVKAAAADLAAKAAHQILAARIAGAKTDALIDQAIAQIGG 168


>gi|116333892|ref|YP_795419.1| F0F1 ATP synthase subunit B [Lactobacillus brevis ATCC 367]
 gi|122269421|sp|Q03QY4|ATPF_LACBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116099239|gb|ABJ64388.1| F0F1-type ATP synthase, subunit b [Lactobacillus brevis ATCC 367]
          Length = 171

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 74/167 (44%), Gaps = 16/167 (9%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           + D  F     L++  +I V    P  +   +   ADKI +DI  A + R  +  ++ + 
Sbjct: 13  YGDSIFYAVCFLLLMWIIKVLAWKP--VTKMMQDRADKISNDIDSAEKSRNDAAELVQKR 70

Query: 62  KEKHSKVEEETREIILAAK-----HRAKIL--AEEGCQNIEQISALYLKDLEQKIHYMKL 114
           +   +    E + I+  AK      R +I+  A+   Q ++Q +    KD+EQ+      
Sbjct: 71  QAALASSRSEAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQ---KDIEQERQDALS 127

Query: 115 EAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A+      +AD S+EI  +II +++  D   ++ +  I  +   H+
Sbjct: 128 NARNY----VADLSIEIASKIIQRELKADDQKALIDSYIEGLGKQHE 170


>gi|167648335|ref|YP_001685998.1| F0F1 ATP synthase subunit B [Caulobacter sp. K31]
 gi|226741354|sp|B0T010|ATPF_CAUSK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|167350765|gb|ABZ73500.1| H+transporting two-sector ATPase B/B' subunit [Caulobacter sp.
          K31]
          Length = 171

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 7  FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDI 44
            V + LI+F+ IV++ + P+++   LD  A KI+ D+
Sbjct: 17 LWVGVGLILFIAIVIWAKAPAMIAGKLDETAAKIQTDL 54


>gi|167628986|ref|YP_001679485.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1]
 gi|226741468|sp|B0TI54|ATPF_HELMI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167591726|gb|ABZ83474.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1]
          Length = 169

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 19/113 (16%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSI--LLSFLDAHADKIR-------DDIFEARRLR 51
           +H +ETFL    LI FL++V  L+  +   +L  LD    K+        +D+ EA R+R
Sbjct: 9   LHLNETFLAM--LISFLILVFILQQVAFKPILKALDERRQKVEESISRAENDLEEANRMR 66

Query: 52  -EKSENILMQYKEKH------SKV-EEETREIILAAKHRAKILAEEGCQNIEQ 96
            E +  +    +E H      +KV EE+ +EI+ AA+  A  L E+   +I++
Sbjct: 67  AENAAELAKARQEAHDLIARATKVGEEKAQEIVAAAQAEANRLKEKAVADIQR 119


>gi|146318830|ref|YP_001198542.1| F0F1-type ATP synthase subunit B [Streptococcus suis 05ZYH33]
 gi|146321039|ref|YP_001200750.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223932792|ref|ZP_03624789.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|253751916|ref|YP_003025057.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|253753739|ref|YP_003026880.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|253755383|ref|YP_003028523.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|330832981|ref|YP_004401806.1| F0F1-type ATP synthase subunit b [Streptococcus suis ST3]
 gi|226696181|sp|A4W1W1|ATPF_STRS2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696183|sp|A4VVK3|ATPF_STRSY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145689636|gb|ABP90142.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 05ZYH33]
 gi|145691845|gb|ABP92350.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223898501|gb|EEF64865.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|251816205|emb|CAZ51832.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|251817847|emb|CAZ55600.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|251819985|emb|CAR46135.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|292558491|gb|ADE31492.1| ATP synthase F0, subunit B [Streptococcus suis GZ1]
 gi|319758277|gb|ADV70219.1| F0F1-type ATP synthase, subunit b [Streptococcus suis JS14]
 gi|329307204|gb|AEB81620.1| F0F1-type ATP synthase, subunit b [Streptococcus suis ST3]
          Length = 168

 Score = 34.3 bits (77), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 78/146 (53%), Gaps = 12/146 (8%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
           F  LII + +  + +I  I     +  A+KI +DI  A      + N++ Q +++  +  
Sbjct: 23  FAVLIILIRVFAWDKITGIF----EERANKIANDIDAAEEKLTAAANLVQQREDELVQGR 78

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQK----IHYMKLEAKRLLYAKIA 125
            E+++II  A  RAK+   E  + +EQ + + ++ L+QK    I   K EA+  L  ++A
Sbjct: 79  IESQKIIQDAVERAKL---EKKRILEQ-ADVEIQGLKQKAQLEIEAEKREAQENLRVQVA 134

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEK 151
           + +V++  +II + ++   +S++ ++
Sbjct: 135 ELAVDLASKIILEDLDQQAHSNLIDR 160


>gi|255533513|ref|YP_003093885.1| Two component regulator three Y domain-containing protein
           [Pedobacter heparinus DSM 2366]
 gi|255346497|gb|ACU05823.1| Two component regulator three Y domain protein [Pedobacter
           heparinus DSM 2366]
          Length = 966

 Score = 34.3 bits (77), Expect = 6.2,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 10/121 (8%)

Query: 48  RRLREKSENI---LMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIE----QISAL 100
           R+LR+    I   L   KE   K E E  E  +      K+ AE   +N E     +S +
Sbjct: 779 RKLRKDQRAISDKLQAEKEAFLKKEAEATEKQIIKLQTEKLQAELAGKNRELANSAMSLV 838

Query: 101 YLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           Y  +L QK+    L+ K      +A+  +  ++++I + MND+ + ++FE   SS    H
Sbjct: 839 YKNELLQKLSQEILKLKDESGKPLAEDQLRKIQKVIDEGMNDERDWNLFE---SSFNEAH 895

Query: 161 Q 161
           +
Sbjct: 896 E 896


>gi|170017979|ref|YP_001728898.1| ATP synthase F0, B subunit [Leuconostoc citreum KM20]
 gi|226741501|sp|B1MW89|ATPF_LEUCK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
          F(0) sector subunit b; AltName: Full=ATPase subunit I;
          AltName: Full=F-type ATPase subunit b; Short=F-ATPase
          subunit b
 gi|169804836|gb|ACA83454.1| ATP synthase F0, B subunit [Leuconostoc citreum KM20]
          Length = 169

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 13 LIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
          +I FLV++V L+      L   LD  A+KI  DI  A   R+++EN+  Q + + +   +
Sbjct: 21 IISFLVLMVILKKVAYGPLTKVLDERAEKISTDIDGAESARQEAENLAAQRQSELADTRQ 80

Query: 71 ETREIILAAKHRAK 84
          +  +++  AK  A+
Sbjct: 81 QATKVVADAKASAQ 94


>gi|148692859|gb|EDL24806.1| calpain 7 [Mus musculus]
          Length = 862

 Score = 34.3 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 77  EAVFYYKEAAQALIYAEMAGSSLERIQEKINEYLERVQALHSAVQSKSTDPLKSKHQLDL 136

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 137 ERAHFLVTQ 145


>gi|297286933|ref|XP_001082446.2| PREDICTED: calpain-7 [Macaca mulatta]
          Length = 869

 Score = 34.3 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|325105222|ref|YP_004274876.1| ATP synthase F0 subcomplex B subunit [Pedobacter saltans DSM 12145]
 gi|324974070|gb|ADY53054.1| ATP synthase F0 subcomplex B subunit [Pedobacter saltans DSM 12145]
          Length = 164

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 76/148 (51%), Gaps = 24/148 (16%)

Query: 8   LVFMSLIIFLVIVVYLRIPSI--LLSFLDAHADKIRDDIFEAR-------RLREKSENIL 58
           LVF +L+ F+++++ LR+ +   +L+ +      I D + +A        RL  ++E +L
Sbjct: 10  LVFWTLVSFVILLIILRVAAWKPILAAIRERESSIEDALNKAELAKQEMARLSNENEALL 69

Query: 59  MQYKEKHSKVEEETR----EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKL 114
            Q + +  ++ +E +    +I+  AK +A++   EG + IE            +I+  KL
Sbjct: 70  KQARAERDEILKEAKSLKDKIVNEAKTQAQV---EGAKLIEAAKV--------EINNQKL 118

Query: 115 EAKRLLYAKIADFSVEIVREIISQKMND 142
            A   + +++A+ S+EI  +++ Q+  D
Sbjct: 119 AALAEVKSQVANLSLEIAEKVLRQEFAD 146


>gi|288925058|ref|ZP_06418994.1| ATP synthase F0, B subunit [Prevotella buccae D17]
 gi|288338248|gb|EFC76598.1| ATP synthase F0, B subunit [Prevotella buccae D17]
          Length = 169

 Score = 34.3 bits (77), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 72/145 (49%), Gaps = 16/145 (11%)

Query: 8   LVFMSLIIFLVIVVYL---RIPSIL------LSFLDAHADKIRDDIFEARRLREKSENIL 58
           L+F  L+ FLV+   L     P+I+        ++D    K  +       ++++ E++L
Sbjct: 11  LLFWMLLAFLVVFGVLAKFGFPAIINMVEERKKYIDESLRKAHEASERLENIKQEGESML 70

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            + +EK +++ +E      AA  R  I+ E   +   + SA  L D +++I   K  A R
Sbjct: 71  KEAREKQAQIMKE------AAGTRDAIV-ENAQEKAREESARLLSDAKRQIESEKQNAIR 123

Query: 119 LLYAKIADFSVEIVREIISQKMNDD 143
            +  ++A+ SV+I  +I+ +K++ D
Sbjct: 124 DIRMQVAELSVQIAEKILREKLSSD 148


>gi|315608097|ref|ZP_07883090.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
 gi|315250566|gb|EFU30562.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
          Length = 172

 Score = 34.3 bits (77), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 72/145 (49%), Gaps = 16/145 (11%)

Query: 8   LVFMSLIIFLVIVVYL---RIPSIL------LSFLDAHADKIRDDIFEARRLREKSENIL 58
           L+F  L+ FLV+   L     P+I+        ++D    K  +       ++++ E++L
Sbjct: 14  LLFWMLLAFLVVFGVLAKFGFPAIINMVEERKKYIDESLRKAHEASERLENIKQEGESML 73

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            + +EK +++ +E      AA  R  I+ E   +   + SA  L D +++I   K  A R
Sbjct: 74  KEAREKQAQIMKE------AAGTRDAIV-ENAQEKAREESARLLSDAKRQIESEKQNAIR 126

Query: 119 LLYAKIADFSVEIVREIISQKMNDD 143
            +  ++A+ SV+I  +I+ +K++ D
Sbjct: 127 DIRMQVAELSVQIAEKILREKLSSD 151


>gi|255067397|ref|ZP_05319252.1| P-type DNA transfer ATPase VirB11 [Neisseria sicca ATCC 29256]
 gi|255048367|gb|EET43831.1| P-type DNA transfer ATPase VirB11 [Neisseria sicca ATCC 29256]
          Length = 365

 Score = 34.3 bits (77), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 32/86 (37%), Gaps = 9/86 (10%)

Query: 17  LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLR---------EKSENILMQYKEKHSK 67
           L +  YL  P +   F++   +   +D    RR+          EK  N L  Y +KH  
Sbjct: 16  LKLTEYLNTPGVTEVFINRPGEVFLEDADGCRRIERPDLPLPVLEKLANTLCTYNKKHIS 75

Query: 68  VEEETREIILAAKHRAKILAEEGCQN 93
            E     + L    R  I+    C+N
Sbjct: 76  YESPIHSVTLPDGERGHIMMSPSCEN 101


>gi|332995864|gb|AEF05919.1| F0F1 ATP synthase subunit B [Alteromonas sp. SN2]
          Length = 156

 Score = 34.3 bits (77), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 78/164 (47%), Gaps = 16/164 (9%)

Query: 1   MHFDETFLVFMSLIIFLVIVV----YLRIPSILLSFLDAHADKIRDDIFEARRLREKSEN 56
           M+F+ TF+    LI F V VV    Y+  P  L++ ++    KI D +  + R  +  E 
Sbjct: 1   MNFNATFI--GQLIAFAVFVVFCMKYVWPP--LMAAIEERQKKIADGLEASERAEKDLEL 56

Query: 57  ILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNI----EQISALYLKDLEQKIHYM 112
              +  E+    + +  EII  AK RA  L +E  Q      E+I A    ++E + +  
Sbjct: 57  AQAKATEQMKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYTEIEAERNR- 115

Query: 113 KLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              AK  L  +++  +V   ++I+ ++++ +  + I EK ++ +
Sbjct: 116 ---AKEDLRKQVSALAVAGAQQILQREIDANAQNDIVEKLVAEL 156


>gi|332232499|ref|XP_003265442.1| PREDICTED: calpain-7 [Nomascus leucogenys]
          Length = 813

 Score = 34.3 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|189054391|dbj|BAG36919.1| unnamed protein product [Homo sapiens]
          Length = 813

 Score = 34.3 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|118590787|ref|ZP_01548188.1| F0F1 ATP synthase subunit B' [Stappia aggregata IAM 12614]
 gi|118436763|gb|EAV43403.1| F0F1 ATP synthase subunit B' [Stappia aggregata IAM 12614]
          Length = 175

 Score = 34.3 bits (77), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 29/168 (17%)

Query: 3   FDETFLVFMSLIIFLVI---VVY-----LRIPSILLSFLDAHADKIRDDIFEARRLREKS 54
           FD T   F S +++L I   V Y     + +P I    L+   D+I  DI EA RL+E++
Sbjct: 19  FDST--TFASQLLWLAITFGVFYWIMKNVAVPRIA-GILEDRRDRIAGDISEANRLKEET 75

Query: 55  -------ENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQ 107
                  E  L + + K   +  ETR   L A H A+       + +E      LK+ E 
Sbjct: 76  DAAIAAYEQALAEARNKAHGIAHETR-TKLKADHEAR------REKVEAELNGKLKEAEA 128

Query: 108 KIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           +I   K +A     ++I D + E    ++ Q +      +   K + S
Sbjct: 129 QIAATKTDA----LSQIGDIAGETASALVEQLIGKAPTKTDLTKALKS 172


>gi|110277409|gb|ABG57236.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 34.3 bits (77), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 9/133 (6%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            L+  S I+ LV++      +I   F +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 13  ILITGSFILLLVLIKKFAWSNITGIF-EERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKD-LEQKIHYMKLEAKRLLYA 122
              +E + II      AK  AE+   NI    ++ A  LK+   Q+I   K EA + +  
Sbjct: 72  GSRKEAKTII----ENAKDTAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKG 127

Query: 123 KIADFSVEIVREI 135
           ++AD ++ +  +I
Sbjct: 128 EVADLTISLAGKI 140


>gi|114585560|ref|XP_001158948.1| PREDICTED: calpain-7 isoform 1 [Pan troglodytes]
          Length = 813

 Score = 34.3 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|114585558|ref|XP_516307.2| PREDICTED: calpain 7 isoform 2 [Pan troglodytes]
          Length = 829

 Score = 34.3 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|33440539|gb|AAH56202.1| Calpain 7 [Homo sapiens]
 gi|325464557|gb|ADZ16049.1| calpain 7 [synthetic construct]
          Length = 813

 Score = 34.3 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|7656959|ref|NP_055111.1| calpain-7 [Homo sapiens]
 gi|33112239|sp|Q9Y6W3|CAN7_HUMAN RecName: Full=Calpain-7; AltName: Full=PalB homolog; Short=PalBH
 gi|5102944|dbj|BAA78730.1| PalBH [Homo sapiens]
 gi|119584627|gb|EAW64223.1| calpain 7, isoform CRA_a [Homo sapiens]
          Length = 813

 Score = 34.3 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|328954795|ref|YP_004372128.1| ATP synthase F0, B subunit [Coriobacterium glomerans PW2]
 gi|328455119|gb|AEB06313.1| ATP synthase F0, B subunit [Coriobacterium glomerans PW2]
          Length = 200

 Score = 34.3 bits (77), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 69/148 (46%), Gaps = 26/148 (17%)

Query: 10  FMSLIIFLVIVVYLR---IPSILLSFLDAHADKIRDDIFEARRLREK-------SENILM 59
           F SL +FLVI + L     P IL S ++    +I+  + EA + ++K       S+++++
Sbjct: 45  FASLFVFLVIWIALAKFAWPKIL-SMMEERGARIKASLDEAEKTKQKAIADRKTSDDLVV 103

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
             + + + +  E R    A   RA+I A+   +          +D+  K H    E +  
Sbjct: 104 DARRQAADIVLEARRD--AEAERARIQAQAHAEA---------QDIIAKAHANAEEERGA 152

Query: 120 LYAKIAD----FSVEIVREIISQKMNDD 143
           LYA  AD     SV +  +I+ + +++D
Sbjct: 153 LYASAADSIAELSVSVASKIVGRTLDED 180


>gi|291165815|gb|EFE27863.1| ATP synthase F0, B subunit [Filifactor alocis ATCC 35896]
          Length = 172

 Score = 34.3 bits (77), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 7  FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
          F +  + I++L +  +L  P  +   +D    +I + +  A+R  E +     QY+EK  
Sbjct: 18 FTILNTFILYLGLKHFLFEP--VKKMMDERTAEIEEQLDSAKRTEELANETYEQYQEKMR 75

Query: 67 KVEEETREIILAAKHRAK 84
            +EE  ++IL A+H A+
Sbjct: 76 NAKEEGMKLILEARHNAQ 93


>gi|261879473|ref|ZP_06005900.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
 gi|270333898|gb|EFA44684.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
          Length = 173

 Score = 34.3 bits (77), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 75/150 (50%), Gaps = 26/150 (17%)

Query: 8   LVFMSLIIFLVIVVYL---RIPSILLSFLDAHADKIRDDIFEA-------RRLREKSENI 57
           L+F  L+ FLV+   L     P+I  + ++     I D + +A         +R++ E++
Sbjct: 14  LLFWMLLAFLVVFGVLAKFGFPAIT-NMVEDRKKYIDDSLRKAHEASERLENIRQEGESM 72

Query: 58  LMQYKEKHS---KVEEETREIIL-AAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMK 113
           L + +EK +   K   ETR++I+  A+ +AK    EG +         L D + +I   K
Sbjct: 73  LQEAREKQAQLLKEATETRDVIVEKAQEKAKA---EGTR--------LLSDAKAQIEAEK 121

Query: 114 LEAKRLLYAKIADFSVEIVREIISQKMNDD 143
             A R + +++A+ SV+I   I+ Q+++ +
Sbjct: 122 QNAIRDIRSQVAELSVKIAERIVKQQLSSN 151


>gi|154484977|ref|ZP_02027425.1| hypothetical protein EUBVEN_02695 [Eubacterium ventriosum ATCC
           27560]
 gi|149733930|gb|EDM50049.1| hypothetical protein EUBVEN_02695 [Eubacterium ventriosum ATCC
           27560]
          Length = 168

 Score = 34.3 bits (77), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 27/163 (16%), Positives = 78/163 (47%), Gaps = 2/163 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + ++  F +   ++++L +  +L  P  + + ++     I  DI +AR+ ++K+ ++  Q
Sbjct: 6   IDWNVVFTIINLIVLYLALRKFLIKP--VTNIMEQRKQMIEGDIADARKEKDKAYDLKAQ 63

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y++K ++  +E+ EII  A+  A+             +   +KD  + +   + +  + L
Sbjct: 64  YEDKLTQAHKESSEIIEKARKSAQTEYNNKVSVASAEADRIIKDAHKAVELDREKTVQDL 123

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
            ++IA  +V    +++ +    + N  ++++ ++     +  D
Sbjct: 124 QSEIAGLAVAAAEKVLGESGTKESNQLMYDQFLAKAGGVNDTD 166


>gi|296228124|ref|XP_002759673.1| PREDICTED: calpain-7 [Callithrix jacchus]
          Length = 813

 Score = 34.3 bits (77), Expect = 7.3,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLERIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|6753258|ref|NP_033926.1| calpain-7 [Mus musculus]
 gi|33112238|sp|Q9R1S8|CAN7_MOUSE RecName: Full=Calpain-7; AltName: Full=PalB homolog; Short=PalBH
 gi|5102946|dbj|BAA78731.1| PalBH [Mus musculus]
          Length = 813

 Score = 33.9 bits (76), Expect = 7.4,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLERIQEKINEYLERVQALHSAVQSKSTDPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|288803184|ref|ZP_06408619.1| ATP synthase F0, B subunit [Prevotella melaninogenica D18]
 gi|288334445|gb|EFC72885.1| ATP synthase F0, B subunit [Prevotella melaninogenica D18]
          Length = 170

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 73/149 (48%), Gaps = 23/149 (15%)

Query: 4   DETFLVFMSLIIFLVIVVYLR--IPSILL------SFLDAHADKIRDDIFEARRLREKSE 55
           D   L +M+L+  +V  +  +   PSI+        ++D    K  +       ++++ E
Sbjct: 7   DSGLLFWMTLVFLVVFFILWKWGFPSIIKMVNERKEYIDESLAKAEEANLRLANIQKQGE 66

Query: 56  NILMQYKEKHSKV---EEETREIILA-AKHRAKILAEEGCQNIEQISALYLKDLEQKIHY 111
           ++LM+ +EK +++     ETR+ I+  A+ +A+             SA  L + + +I  
Sbjct: 67  DLLMEAREKQAQILREASETRDTIVGQAQEKAR-----------DESARILSEAKAEIES 115

Query: 112 MKLEAKRLLYAKIADFSVEIVREIISQKM 140
            K  A R + +++A+ SV+I  +I+ +++
Sbjct: 116 QKQAAIRDIRSQVAELSVQIAEKILHKEL 144


>gi|32476313|ref|NP_869307.1| protein ATP synthase B chain [Rhodopirellula baltica SH 1]
 gi|32446858|emb|CAD78764.1| probable protein ATP synthase B chain [Rhodopirellula baltica SH 1]
          Length = 261

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 71/154 (46%), Gaps = 22/154 (14%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLR---IPSILLSFLDAHADKIRDDIFEARRLREKSENI 57
           + FD    ++ +LIIFL ++  L     P++L   L A  +KIR+D+  A +   +++ +
Sbjct: 101 LSFDGGSAIW-NLIIFLCVLAILSKFVWPAVL-GGLQAREEKIREDLESAEKASAEAKQM 158

Query: 58  LMQYK----EKHSKV-----------EEETREIILAAKHRAKILAEEGCQNIEQISALYL 102
           L  Y+    E  S+V           E   ++I+ AAK  A    E    +IE    + +
Sbjct: 159 LSDYQLKLDEAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAM 218

Query: 103 KDLEQKIHYMKLEAKRLLYAK--IADFSVEIVRE 134
            ++  +   + ++  R +  +   AD   +++R+
Sbjct: 219 AEMAGQTSKLAMQVARSVVGRELSADDHADLIRQ 252


>gi|296536542|ref|ZP_06898629.1| ATP synthase F0 sector subunit B [Roseomonas cervicalis ATCC
          49957]
 gi|296263138|gb|EFH09676.1| ATP synthase F0 sector subunit B [Roseomonas cervicalis ATCC
          49957]
          Length = 168

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 2  HF--DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENI 57
          HF  D  F V +S +IF+V++    + +     LDA A+KIR ++ EA RLR ++E +
Sbjct: 6  HFWLDPKFWVAISFVIFVVLLGRT-MWAKATEALDARANKIRAELDEAGRLRAEAEAM 62


>gi|302023930|ref|ZP_07249141.1| F0F1 ATP synthase subunit B [Streptococcus suis 05HAS68]
          Length = 168

 Score = 33.9 bits (76), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 77/146 (52%), Gaps = 12/146 (8%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
           F  LII + +  + +I  I     +  A+KI +DI  A      + N++ Q +++  +  
Sbjct: 23  FAVLIILIRVFAWDKITGIF----EERANKIANDIDAAEEKLTAAANLVQQREDELVQGR 78

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQK----IHYMKLEAKRLLYAKIA 125
            E+ +II  A  RAK+   E  + +EQ + + ++ L+QK    I   K EA+  L  ++A
Sbjct: 79  IESPQIIQDAVERAKL---EKKRILEQ-ADVEIQGLKQKAQLEIEAEKREAQENLRVQVA 134

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEK 151
           + +V++  +II + ++   +S++ ++
Sbjct: 135 ELAVDLASKIILEDLDQQAHSNLIDR 160


>gi|254500907|ref|ZP_05113058.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
 gi|222436978|gb|EEE43657.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
          Length = 181

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 74/161 (45%), Gaps = 15/161 (9%)

Query: 3   FDETF----LVFMSLII--FLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSEN 56
           FD T     L+++++    F  I+  + +P I    L+   D+I  D+ EA RL+++++ 
Sbjct: 25  FDATTYSSQLLWLAITFGFFYWIMKNVAVPRIA-GILEDRKDRIAGDLGEANRLKDETDA 83

Query: 57  ILMQYKEKHSKVEEETREIILAAKHRAKILAEEGC--QNIEQISALYLKDLEQKIHYMKL 114
            +  Y++  ++   +   I  A+  RAK+ A++    +  E   A  LK  E  I  +K 
Sbjct: 84  AIAAYEQALAEARNKAHGI--ASDTRAKLKADQEARREKAEADIAEKLKAAEAHIAGIKT 141

Query: 115 EAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           EA     ++I D + +    ++ Q M      +   K + S
Sbjct: 142 EA----LSQIGDIAGDTTSALVEQLMGKAPTKTDLTKALKS 178


>gi|110277394|gb|ABG57224.1| AtpB [Streptococcus mitis]
 gi|110277414|gb|ABG57240.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 9/133 (6%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            L+  S I+ LV++      +I   F +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 13  ILITGSFILLLVLIKKFAWSNITGIF-EERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNI---EQISALYLKD-LEQKIHYMKLEAKRLLYA 122
              +E + II      AK  AE+   NI    ++ A  LK+   Q+I   K EA + +  
Sbjct: 72  GSRKEAKTII----ENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKG 127

Query: 123 KIADFSVEIVREI 135
           ++AD ++ +  +I
Sbjct: 128 EVADLTISLAGKI 140


>gi|291399647|ref|XP_002716291.1| PREDICTED: calpain 7 [Oryctolagus cuniculus]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.2,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|110277399|gb|ABG57228.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 33.9 bits (76), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 67/135 (49%), Gaps = 13/135 (9%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            L+  S I+ LV++      +I   F +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 13  ILITGSFILLLVLIKKFAWSNITGIF-EERAEKIATDIDSAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREII-----LAAKHRAKILAEEGCQNIEQISALYLKD-LEQKIHYMKLEAKRLL 120
              +E + II      A K +A ILA+       ++ A  LK+   Q+I   K EA + +
Sbjct: 72  GSRKEAKAIIENAKQTAEKSKASILAD------AKLEAGRLKEKANQEIAQNKAEALQSV 125

Query: 121 YAKIADFSVEIVREI 135
             ++AD ++ +  +I
Sbjct: 126 KGEVADLTISLAGKI 140


>gi|78187938|ref|YP_375981.1| ATP synthase F0, subunit B [Chlorobium luteolum DSM 273]
 gi|123582422|sp|Q3B143|ATPF2_PELLD RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|78167840|gb|ABB24938.1| ATP synthase F0 subcomplex B subunit [Chlorobium luteolum DSM 273]
          Length = 175

 Score = 33.9 bits (76), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 73/167 (43%), Gaps = 24/167 (14%)

Query: 5   ETFLVFMSLIIFLVIVVYLR--IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           E  L+F + I F+++++ L+      ++S L+     I+  I  A   +E+SE IL Q +
Sbjct: 17  EPGLIFWTTITFVLVLIILKKIAWGPIISALEEREKGIQSSIDRAHGAKEESEAILRQNR 76

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYM--------KL 114
           E  +K + E   +I            EG +  E+I A   +   Q+   M        + 
Sbjct: 77  ELLAKADAEADRVI-----------REGREYAEKIRAEITEKAHQESQKMISAAKEEIEQ 125

Query: 115 EAKRLLYA---KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           E +R L     ++AD +V    +II   ++ DV   + +  I  + +
Sbjct: 126 EKRRALAELRNEVADLAVRGAEKIIRGVLDADVQKKVVDSMIQDLST 172


>gi|257790795|ref|YP_003181401.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|317488493|ref|ZP_07947044.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
 gi|257474692|gb|ACV55012.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|316912425|gb|EFV33983.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
          Length = 206

 Score = 33.9 bits (76), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 31/152 (20%), Positives = 66/152 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+  + + I L IV+         + L+     I+D + ++ + R +SE +L +YK +  
Sbjct: 51  FIPMLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKSEQARVESERVLEEYKRQLE 110

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + +  +I+  AK   + +  +     +  +   ++     I   K  A   L   +AD
Sbjct: 111 DAKAQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHNAIEAEKKAAISELQGSVAD 170

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV +   +I + +ND  +  I E+ ++   S
Sbjct: 171 LSVSVASRLIGEDLNDAEHRKIIERYVNEAGS 202


>gi|73990034|ref|XP_851263.1| PREDICTED: similar to calpain 7 isoform 3 [Canis familiaris]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.5,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|303246334|ref|ZP_07332614.1| multi-sensor signal transduction histidine kinase [Desulfovibrio
           fructosovorans JJ]
 gi|302492397|gb|EFL52269.1| multi-sensor signal transduction histidine kinase [Desulfovibrio
           fructosovorans JJ]
          Length = 651

 Score = 33.9 bits (76), Expect = 8.5,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 11/118 (9%)

Query: 33  LDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQ 92
           LDA   +I + +   R LR+ ++N+    +EK S+V E  R+  LAA      +AE  CQ
Sbjct: 110 LDAALKRIDEKLALRRELRQYTQNLEKLVREKSSRVVELERQ--LAAGQ----MAETMCQ 163

Query: 93  NIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFE 150
            I  +SA    DL +   Y   E    +    A   V +  ++  +++ D V    +E
Sbjct: 164 AISGLSA----DLGEGAGYFN-EMPCFVAVHNASLEVVVTNQLYKERLGDMVGHHSWE 216


>gi|188997523|ref|YP_001931774.1| H+transporting two-sector ATPase B/B' subunit [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|226696186|sp|B2V6N8|ATPF_SULSY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|188932590|gb|ACD67220.1| H+transporting two-sector ATPase B/B' subunit [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 180

 Score = 33.9 bits (76), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 78/160 (48%), Gaps = 8/160 (5%)

Query: 4   DETFLVF---MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +E+ ++F   ++ +I L +V Y     I   FL+   + + + + EA+++RE S+  L  
Sbjct: 24  NESMILFWKAVNTVILLGLVYYFGGKHIK-KFLNGRRENVANMVLEAQKMREDSQKALED 82

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIH--YMKLEAKR 118
            K K  + + +  E I  +K  A+   E       +I+       ++ I+    K EAK 
Sbjct: 83  AKRKLEEAKYKLEESIKISKETAEREREHAIMQANEIAERIKMQAKETINIEIRKAEAKL 142

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             YA  A+ ++E+ + +I   +N   ++ + +KTI  +++
Sbjct: 143 KKYA--AEKALEVSKSLIESSINPQTSNELIKKTIKGLEA 180


>gi|329744617|ref|NP_001180110.1| calpain-7 [Bos taurus]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|147901821|ref|NP_001090912.1| calpain-7 [Sus scrofa]
 gi|122056069|sp|A0FKG7|CAN7_PIG RecName: Full=Calpain-7
 gi|116734359|gb|ABK20170.1| calpain 7 [Sus scrofa domesticus]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 109 IHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDKNT 166
           + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D   
Sbjct: 30  VFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDLER 89

Query: 167 TETLGSQ 173
              L +Q
Sbjct: 90  AHLLVTQ 96


>gi|297471460|ref|XP_002685222.1| PREDICTED: calpain 7-like [Bos taurus]
 gi|296490804|gb|DAA32917.1| calpain 7-like [Bos taurus]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|301759075|ref|XP_002915387.1| PREDICTED: calpain-7-like [Ailuropoda melanoleuca]
 gi|281345874|gb|EFB21458.1| hypothetical protein PANDA_003363 [Ailuropoda melanoleuca]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|163963292|gb|ABY50566.1| calpain 7 [Sus scrofa ussuricus]
          Length = 813

 Score = 33.9 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|73990038|ref|XP_534258.2| PREDICTED: similar to calpain 7 isoform 1 [Canis familiaris]
          Length = 829

 Score = 33.9 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 107 QKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN--DDVNSSIFEKTISSIQSCHQMDK 164
           + + Y K  A+ L+YA++A  S+E ++E I++ +     ++S++  K+   ++S HQ+D 
Sbjct: 28  EAVFYYKEAAQALIYAEMAGSSLEHIQEKINEYLERVQALHSAVQSKSADPLKSKHQLDL 87

Query: 165 NTTETLGSQ 173
                L +Q
Sbjct: 88  ERAHFLVTQ 96


>gi|160893777|ref|ZP_02074561.1| hypothetical protein CLOL250_01331 [Clostridium sp. L2-50]
 gi|156864762|gb|EDO58193.1| hypothetical protein CLOL250_01331 [Clostridium sp. L2-50]
          Length = 167

 Score = 33.5 bits (75), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 68/131 (51%), Gaps = 10/131 (7%)

Query: 35  AHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNI 94
           A+A++ +DD   A +L+++ E+ L   +++   + +++R+   A     +I+A+ G    
Sbjct: 47  ANANQTKDD---AMKLKQQYEDTLAGVQDECDTMRDKSRQ--AAQNEYNRIVADAG---- 97

Query: 95  EQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
            + S   +KD E+ I   + +A   + +++A+ ++    +I+ +  ND  N S++++ I 
Sbjct: 98  -EKSNRMIKDAEKTIEVQREKALSDMESQVAELAMSAAAKILGEDSNDAKNQSLYDEFIE 156

Query: 155 SIQSCHQMDKN 165
                H  + N
Sbjct: 157 KAGEAHDTESN 167


Searching..................................................done


Results from round 2




>gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040762|gb|ACT57558.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 173

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ
Sbjct: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL
Sbjct: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ 173
           YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
Sbjct: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ 173


>gi|319408195|emb|CBI81848.1| ATP synthase, B chain [Bartonella schoenbuchensis R1]
          Length = 164

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/153 (27%), Positives = 87/153 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++VY ++P+++   LD    +I D++ EA RLRE+++ IL + +
Sbjct: 1   MTDTFWAFIGLVLFLALLVYFKVPTMVARSLDMRTKRITDELDEALRLREEAQEILAECQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+  +EII +AK+   ++  E     E+      K +EQKI   + +A R++  
Sbjct: 61  RKCVEAEKNAQEIIASAKNEVSVIVAEARTKTEEYVKNRKKMVEQKIAQAEADAIRVVSL 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              D ++   R +I+++++   +  + EK+++ 
Sbjct: 121 SAIDLAISSSRTLINKELDFKESKDLIEKSLTK 153


>gi|153007848|ref|YP_001369063.1| F0F1 ATP synthase subunit B [Ochrobactrum anthropi ATCC 49188]
 gi|226694417|sp|A6WW80|ATPF2_OCHA4 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|151559736|gb|ABS13234.1| ATP synthase F0, B subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 159

 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V    +I++ K++  V  ++F+  +S ++S
Sbjct: 121 SAVDLAVAAAGKIVADKVDTKVAGNLFKDALSQVKS 156


>gi|163744747|ref|ZP_02152107.1| ATP synthase F0, B subunit [Oceanibulbus indolifex HEL-45]
 gi|161381565|gb|EDQ05974.1| ATP synthase F0, B subunit [Oceanibulbus indolifex HEL-45]
          Length = 190

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 90/155 (58%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P++L+  LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 33  NTDFIVLLAFLLFIGILIYFKVPTLLIGMLDKRADGIKTELEEARALREEAQTLLASYER 92

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           KH +V+++   I+ +AK  A++ AE+   ++ +     +   + +I   +  A + +  +
Sbjct: 93  KHKEVQDQADRIVSSAKEDARLAAEQARADMAKSLDRRMAAAKDQISSAEAAAVKEVRDQ 152

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V   R++I+++M     + + +  I+ +++
Sbjct: 153 AVTIAVAAARDVIAKQMTAAQGNKLIDDGIAQVEA 187


>gi|121602072|ref|YP_988698.1| F0F1 ATP synthase subunit B [Bartonella bacilliformis KC583]
 gi|226741307|sp|A1URU5|ATPF_BARBK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120614249|gb|ABM44850.1| ATP synthase F0, B subunit family protein [Bartonella bacilliformis
           KC583]
          Length = 159

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ LI+FL ++ Y ++P++ L  LD  A +I  ++ EA RLRE+++ IL +Y+
Sbjct: 1   MTDTFWAFIGLILFLALLFYFKVPAMALRSLDERAKRIAGELDEALRLREEAQGILAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +K + +E++ +EII AAKH A+I+  E     E+      K +EQKI   + +A + + +
Sbjct: 61  QKCAGIEQDVQEIITAAKHEAEIIVAEARVKTEEYVKNRNKLVEQKIAQAESDAIQEISS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              + ++    +II+ ++     + + +++I  +++
Sbjct: 121 SAVNLAISSASKIINNELGAKKANDLIKESIIKVKT 156


>gi|239831261|ref|ZP_04679590.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301]
 gi|239823528|gb|EEQ95096.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301]
          Length = 159

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 93/156 (59%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEASDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V    +I+++K++  V  ++F+  +S +++
Sbjct: 121 SAVDLAVAAAGKIVAEKVDAKVAGNLFKDALSQVKT 156


>gi|23501289|ref|NP_697416.1| F0F1 ATP synthase subunit B [Brucella suis 1330]
 gi|161618361|ref|YP_001592248.1| F0F1 ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|254703742|ref|ZP_05165570.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|260567003|ref|ZP_05837473.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|261754387|ref|ZP_05998096.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|81753122|sp|Q8G2D8|ATPF2_BRUSU RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|226694383|sp|A9M8G1|ATPF2_BRUC2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|23347177|gb|AAN29331.1| ATP synthase F0, B subunit [Brucella suis 1330]
 gi|161335172|gb|ABX61477.1| ATP synthase F0, B subunit [Brucella canis ATCC 23365]
 gi|260156521|gb|EEW91601.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|261744140|gb|EEY32066.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
          Length = 159

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+VIVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVVIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|49475212|ref|YP_033253.1| F0F1 ATP synthase subunit B [Bartonella henselae str. Houston-1]
 gi|81696226|sp|Q6G5K9|ATPF2_BARHE RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|49238017|emb|CAF27223.1| ATP synthase B chain [Bartonella henselae str. Houston-1]
          Length = 164

 Score =  144 bits (364), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 45/153 (29%), Positives = 89/153 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++VY  +P ++L  LD  A +I+D++ EA RLRE+++ +L +Y+
Sbjct: 1   MTDTFWAFVGLVLFLALLVYFEVPEMVLRHLDTRAKRIKDELDEALRLREEAQEVLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH++ E++ +EII AAK   + +  E     E+      K  EQKI   + +A R++ +
Sbjct: 61  RKHAEAEKDAQEIIAAAKREVEAVISEARIKAEEYVKNRNKLAEQKIAQAEADAIRMVSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              D +V   R +I ++++    + + ++++  
Sbjct: 121 SAIDLAVSAARVLIEKELDSHKANELIKESLVQ 153


>gi|148559545|ref|YP_001258412.1| F0F1 ATP synthase subunit B [Brucella ovis ATCC 25840]
 gi|226694384|sp|A5VNW5|ATPF2_BRUO2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|148370802|gb|ABQ60781.1| ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
          Length = 159

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKCKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|62289375|ref|YP_221168.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 1 str. 9-941]
 gi|82699300|ref|YP_413874.1| F0F1 ATP synthase subunit B [Brucella melitensis biovar Abortus
           2308]
 gi|189023628|ref|YP_001934396.1| F0F1 ATP synthase subunit B [Brucella abortus S19]
 gi|237814862|ref|ZP_04593860.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A]
 gi|254688690|ref|ZP_05151944.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|254693173|ref|ZP_05155001.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|254696817|ref|ZP_05158645.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|254729724|ref|ZP_05188302.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|256256937|ref|ZP_05462473.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260545872|ref|ZP_05821613.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260754166|ref|ZP_05866514.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757386|ref|ZP_05869734.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761210|ref|ZP_05873553.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883191|ref|ZP_05894805.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213413|ref|ZP_05927694.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|297247788|ref|ZP_06931506.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196]
 gi|123546349|sp|Q2YMC4|ATPF2_BRUA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|226694382|sp|B2S9N1|ATPF2_BRUA1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|62195507|gb|AAX73807.1| AtpF, ATP synthase F0, B subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615401|emb|CAJ10370.1| H+-transporting two-sector ATPase, B/B' subunit:ATP synthase F0,
           subunit B [Brucella melitensis biovar Abortus 2308]
 gi|189019200|gb|ACD71922.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|237789699|gb|EEP63909.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A]
 gi|260097279|gb|EEW81154.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260667704|gb|EEX54644.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671642|gb|EEX58463.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674274|gb|EEX61095.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872719|gb|EEX79788.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915020|gb|EEX81881.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|297174957|gb|EFH34304.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196]
          Length = 159

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++   + ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKADGNLFNDALAQVKS 156


>gi|319406086|emb|CBI79716.1| ATP synthase subunit b 2 [Bartonella sp. AR 15-3]
          Length = 164

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 88/153 (57%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL +++Y  +P++++  LD  A  I+D++ EA  LRE+++ +L +Y+
Sbjct: 1   MTDTFWAFIGLVLFLALLIYFEVPNVIIRKLDTRAKHIKDELNEALHLREEAQKVLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH ++E+ET+EII  AK + + +  E     E+      +  EQKI   +    R++ +
Sbjct: 61  RKHLEIEKETQEIIADAKCKVEAIIAETRIKTEEYIKDRSRLAEQKIAQAEANVVRMVSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              D ++     ++++++  +  +S+ +K++  
Sbjct: 121 SAIDLAISAANRLLTKELGAEQANSLIKKSLVQ 153


>gi|319407570|emb|CBI81220.1| ATP synthase subunit b 2 [Bartonella sp. 1-1C]
          Length = 164

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/151 (29%), Positives = 91/151 (60%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++VY  +P+ ++  LD  A  I+D++ EA RLRE+++ +L +Y+
Sbjct: 1   MTDTFWAFIGLVLFLALLVYFEVPNAIIRKLDTRAKHIKDELDEALRLREEAQKVLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH ++E+ET+EII  AK + + +  E     E+    + +  EQKI   +  A R+L +
Sbjct: 61  RKHLEIEKETQEIIADAKDKVEAMLSETRIKTEEYIKNHSRLAEQKIAQAEENAIRMLSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
              D ++  V  ++++++N +  +S+ ++ +
Sbjct: 121 TAVDLAISAVNRLLTKELNAEQANSLIKEPL 151


>gi|110633056|ref|YP_673264.1| F0F1 ATP synthase subunit B [Mesorhizobium sp. BNC1]
 gi|123058179|sp|Q11KH6|ATPF2_MESSB RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|110284040|gb|ABG62099.1| ATP synthase F0, B subunit [Chelativorans sp. BNC1]
          Length = 159

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 96/156 (61%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   ++LIIF+ I++Y+++P +L   LDA A++I++++ EARRLRE+++ +L +Y+
Sbjct: 1   MDATFWALVALIIFVGILLYMKVPGMLAGSLDARAERIKNELEEARRLREEAQQLLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E +E++ AAK  AK++  +     E+  +      EQKI   + +A   + +
Sbjct: 61  RKRREAEQEAKELVDAAKREAKLIVSDAKVKTEEYVSRRTALAEQKIAQAERDAVNEVRS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  D +V    +++++K++    S +F+ ++  +++
Sbjct: 121 RAVDVAVAAAGKLLAEKIDTKTGSELFKASLQDVKT 156


>gi|240850062|ref|YP_002971455.1| ATP synthase subunit B [Bartonella grahamii as4aup]
 gi|240267185|gb|ACS50773.1| ATP synthase subunit B [Bartonella grahamii as4aup]
          Length = 164

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 47/153 (30%), Positives = 92/153 (60%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++VY +IP  ++  LDA A +I+D++ EA RLRE+++ IL +Y+
Sbjct: 1   MTDTFWAFVGLVLFLALLVYFQIPQRVIHHLDARAKRIKDELDEALRLREEAQEILAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH++ E++ +EII AAKH  + +  E     E+      K  EQKI   + +A R++ +
Sbjct: 61  RKHAEAEKDAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              D ++   R +I+++++ +    + ++++  
Sbjct: 121 SAIDLAISTARILIAKELDSNKADELIKESLEK 153


>gi|300024395|ref|YP_003757006.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526216|gb|ADJ24685.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 163

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 84/154 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F V ++ + F+ +V+Y R+P+++   LD  AD IR ++ EAR+LRE ++ +L  Y+ 
Sbjct: 6   NPLFWVLLAFLTFIALVLYYRVPALIGKMLDDRADAIRKELDEARKLREDAQALLADYQR 65

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  + E E R II  AK  A+ LA +  +++ +      K  E+KI   + +A   + A 
Sbjct: 66  KAREAENEARSIIDQAKREAEALAVDARKSLAESLERRSKIAEEKIARAETQALSEVRAT 125

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
             D ++    E++  + +  V  S+  ++IS ++
Sbjct: 126 AVDTAISAAHELLKTRASGSVGDSLITQSISDLR 159


>gi|161511127|ref|NP_540460.2| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|163842669|ref|YP_001627073.1| F0F1 ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|225626900|ref|ZP_03784939.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo]
 gi|225851925|ref|YP_002732158.1| F0F1 ATP synthase subunit B [Brucella melitensis ATCC 23457]
 gi|254701197|ref|ZP_05163025.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|254707878|ref|ZP_05169706.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|254709538|ref|ZP_05171349.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|254713045|ref|ZP_05174856.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|254716602|ref|ZP_05178413.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|254718569|ref|ZP_05180380.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|256031032|ref|ZP_05444646.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|256044107|ref|ZP_05447018.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060524|ref|ZP_05450693.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|256112905|ref|ZP_05453821.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|256159090|ref|ZP_05456916.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|256254435|ref|ZP_05459971.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|256264563|ref|ZP_05467095.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368841|ref|YP_003106347.1| ATP synthase subunit B [Brucella microti CCM 4915]
 gi|260168164|ref|ZP_05754975.1| F0F1 ATP synthase subunit B [Brucella sp. F5/99]
 gi|260563466|ref|ZP_05833952.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|261218401|ref|ZP_05932682.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261221603|ref|ZP_05935884.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315369|ref|ZP_05954566.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317064|ref|ZP_05956261.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261320750|ref|ZP_05959947.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|261324518|ref|ZP_05963715.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751734|ref|ZP_05995443.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261757622|ref|ZP_06001331.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265983544|ref|ZP_06096279.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|265988102|ref|ZP_06100659.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265990519|ref|ZP_06103076.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994347|ref|ZP_06106904.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|265997567|ref|ZP_06110124.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851768|ref|ZP_06792441.1| ATP synthase F0 [Brucella sp. NVSL 07-0026]
 gi|306837306|ref|ZP_07470189.1| ATP synthase F0, B subunit [Brucella sp. NF 2653]
 gi|226694369|sp|B0CK73|ATPF2_BRUSI RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|163673392|gb|ABY37503.1| ATP synthase F0, B subunit [Brucella suis ATCC 23445]
 gi|225618557|gb|EEH15600.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo]
 gi|225640290|gb|ACO00204.1| ATP synthase F0, B subunit [Brucella melitensis ATCC 23457]
 gi|255998999|gb|ACU47398.1| ATP synthase subunit B [Brucella microti CCM 4915]
 gi|260153482|gb|EEW88574.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|260920187|gb|EEX86840.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|260923490|gb|EEX90058.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293440|gb|EEX96936.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|261296287|gb|EEX99783.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300498|gb|EEY03995.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304395|gb|EEY07892.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737606|gb|EEY25602.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741487|gb|EEY29413.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|262552035|gb|EEZ08025.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|262765460|gb|EEZ11249.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001303|gb|EEZ13878.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094928|gb|EEZ18636.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660299|gb|EEZ30560.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|264662136|gb|EEZ32397.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|294820357|gb|EFG37356.1| ATP synthase F0 [Brucella sp. NVSL 07-0026]
 gi|306407619|gb|EFM63815.1| ATP synthase F0, B subunit [Brucella sp. NF 2653]
 gi|326408424|gb|ADZ65489.1| F0F1 ATP synthase subunit B [Brucella melitensis M28]
 gi|326538138|gb|ADZ86353.1| ATP synthase F0, B subunit [Brucella melitensis M5-90]
          Length = 159

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|306842324|ref|ZP_07474983.1| ATP synthase F0, B subunit [Brucella sp. BO2]
 gi|306287540|gb|EFM58999.1| ATP synthase F0, B subunit [Brucella sp. BO2]
          Length = 159

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMVGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|319404579|emb|CBI78185.1| ATP synthase subunit b 2 [Bartonella rochalimae ATCC BAA-1498]
          Length = 164

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/151 (28%), Positives = 90/151 (59%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++VY  +P+ ++  LD  A  I+D++ EA RLRE+++ +L +Y+
Sbjct: 1   MTDTFWAFIGLVLFLALLVYFEVPNAIIRKLDTRAKHIKDELDEALRLREEAQKVLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH ++E+ET+EII  AK + + +  E     E+    + + +EQKI   +  A R L +
Sbjct: 61  RKHLEIEKETQEIIADAKDKVEAMLSETRIKTEEYIKNHSRLVEQKIAQAEANAIRTLSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
              D ++  +  ++ ++++ +  +S+ ++ +
Sbjct: 121 TAVDLAISAINRLLMKELDAEQANSLIKEPL 151


>gi|304391258|ref|ZP_07373202.1| ATP synthase B chain [Ahrensia sp. R2A130]
 gi|303296614|gb|EFL90970.1| ATP synthase B chain [Ahrensia sp. R2A130]
          Length = 161

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 90/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD +F   ++LI+F  ++VYL++P ++   LD  ADKI+ D+ EAR+LRE+++ +L +
Sbjct: 1   MSFDASFWALVALILFFALLVYLKVPGVVSKALDGRADKIKSDLEEARKLREEAQQLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E  EI+ AAK  A  L EE                EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEASEIVAAAKREADALREEAELKTADYVTRRTAQAEQKIAQAESQAMAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +   D +++  R+IIS K+    ++ +F+++++ +++
Sbjct: 121 KSTAVDLAMDAARDIISSKVTGKASTDMFKQSLAEVKA 158


>gi|163867854|ref|YP_001609058.1| F0F1 ATP synthase subunit B [Bartonella tribocorum CIP 105476]
 gi|226694380|sp|A9IQI8|ATPF2_BART1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|161017505|emb|CAK01063.1| ATP synthase, B chain [Bartonella tribocorum CIP 105476]
          Length = 164

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 48/153 (31%), Positives = 92/153 (60%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++VY +IP  ++  LDA A +I+D++ EA RLRE+++ IL +Y+
Sbjct: 1   MSDTFWAFVGLVLFLALLVYFQIPQKIIHHLDARAKRIKDELDEALRLREEAQEILAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH++ E++ +EII AAKH  + +  E     E+      K  EQKI   + +A R++ +
Sbjct: 61  RKHAEAEKDAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              D ++   R +I+++++ +    + ++ +S 
Sbjct: 121 SAIDLAISTARVLIAKELDSNRADELVKEALSK 153


>gi|315122435|ref|YP_004062924.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495837|gb|ADR52436.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 161

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 86/157 (54%), Positives = 131/157 (83%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVF SL+ F+++++YLR+P+ +L FLDA AD+IRD++FEARRLRE++EN+L+Q
Sbjct: 1   MHFDETFLVFTSLVAFILLLIYLRVPAKVLYFLDARADRIRDELFEARRLREEAENVLVQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEK+SK+  + REII+ A+ +AK++ ++ C+NIE++S L+L+++++ IH M+LEAKRL 
Sbjct: 61  YKEKYSKIGTDVREIIVVAEQKAKLIKDDNCKNIEKLSDLHLENVKRTIHCMELEAKRLF 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           Y K+A FS+E  +EIISQK++DD++  IF+  I  I+
Sbjct: 121 YIKLAYFSIEYAKEIISQKIDDDISCHIFQDAIREIE 157


>gi|254510893|ref|ZP_05122960.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
 gi|221534604|gb|EEE37592.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
          Length = 186

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 81/155 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  I+F+ I+ Y ++P ++   LD  A+ I+ ++ EAR L E++ ++L  Y+ 
Sbjct: 29  NTDFVVLLGFIVFIAILFYFKVPGMIGGALDKRAEGIQSELDEARALHEEARSLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ AAK  A + AE+   ++E+  A  L   + +I   +  A + +  +
Sbjct: 89  KQREVQTQADAIVAAAKEDAALAAEQAKADLEKSIARRLAAAQDQIASAEASAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V     +++++M     + + + +I+ +  
Sbjct: 149 AITVAVSAANAVLAKQMTATQANKLIDASIADVGE 183


>gi|49473962|ref|YP_032004.1| F0F1 ATP synthase subunit B [Bartonella quintana str. Toulouse]
 gi|81696061|sp|Q6G0H0|ATPF2_BARQU RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|49239465|emb|CAF25816.1| ATP synthase B chain [Bartonella quintana str. Toulouse]
          Length = 164

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 45/153 (29%), Positives = 91/153 (59%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL ++ Y ++P +++  LDA A +I+D++ EA RLRE+++ +L +Y+
Sbjct: 1   MTDTFWAFVGLVLFLALLAYFKVPEMIVHRLDARAKRIKDELDEALRLREEAQEVLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH++ E++ +EII AAK   + +  E     E+      K  EQKI   + +A R++ +
Sbjct: 61  RKHAEAEKDAQEIIAAAKREVEAVVSEARTKAEEYVKNRNKLAEQKIAQAEADAIRVVSS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              D +V   R +I Q+++ +  + + ++++  
Sbjct: 121 SAVDLAVSAARVLIEQELDSNKANELIKESLFE 153


>gi|319899221|ref|YP_004159314.1| ATP synthase, B chain [Bartonella clarridgeiae 73]
 gi|319403185|emb|CBI76744.1| ATP synthase, B chain [Bartonella clarridgeiae 73]
          Length = 164

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 45/151 (29%), Positives = 91/151 (60%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
             +TF  F+ L++FL +++Y  +P++L   LDA A +I+D++ EA RLRE+++ IL +Y+
Sbjct: 1   MTDTFWAFIGLVLFLALLIYFEVPAMLTRKLDARAKRIKDELDEALRLREEAQEILAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            KH ++E+ET+EII  A+   + +  E     ++      K  EQKI   +  A R++ +
Sbjct: 61  RKHLEIEKETQEIIAEAQREIEAVLIETRVKTDEYIKSRNKLAEQKIAQAEANAVRMVAS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
              D +V     +I+++++ +  +S+ ++++
Sbjct: 121 SAIDLAVSAANTLITKELDAEQANSLIKESL 151


>gi|306845019|ref|ZP_07477600.1| ATP synthase F0, B subunit [Brucella sp. BO1]
 gi|306274651|gb|EFM56440.1| ATP synthase F0, B subunit [Brucella sp. BO1]
          Length = 159

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 49/156 (31%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMVGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              + +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVELAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|84500334|ref|ZP_00998600.1| ATP synthase F0, B subunit [Oceanicola batsensis HTCC2597]
 gi|84392268|gb|EAQ04536.1| ATP synthase F0, B subunit [Oceanicola batsensis HTCC2597]
          Length = 185

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 81/154 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ +++Y  +P +L+  LD  AD+IR ++ EA+ LRE+++ +L  Y+ 
Sbjct: 28  NTDFIVLLGFLLFIAVLIYFGVPGMLMGMLDKRADQIRSELDEAKSLREEAQALLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+  A+  A   A +   ++E      L   E +I   +  A + +  +
Sbjct: 88  KQKEVQAQADRIVETARKEASDSAAQAKLDLEASIQRRLAAAEDQIASAEASAVKEVKDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               ++   RE+I+ ++     + + + +I +++
Sbjct: 148 AVAVAIAAAREVIAGQVKAADANKMIDDSIDTVE 181


>gi|149915445|ref|ZP_01903972.1| ATP synthase F0, B subunit [Roseobacter sp. AzwK-3b]
 gi|149810734|gb|EDM70575.1| ATP synthase F0, B subunit [Roseobacter sp. AzwK-3b]
          Length = 184

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ I++Y ++PS+L   LD  A+ I+ ++ EAR LR++++ +L  Y+ 
Sbjct: 27  NTDFVVTLGFLVFIGILLYFKVPSLLGGLLDKRAEGIKSELDEARALRDEAQTLLAGYER 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E++  II AAK  A   AE+  Q+++      LK  E +I   +  A R +  +
Sbjct: 87  KQKEVQEQSERIIAAAKQEAAEAAEQAKQDLKASIKRRLKAAEDQIASAEANAIRDVRNE 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++I++ M     + + +  I  + +
Sbjct: 147 AIRIAVAAATDVIAKNMTAADGNKLIDDAIGQVDA 181


>gi|307941609|ref|ZP_07656964.1| ATP synthase B chain [Roseibium sp. TrichSKD4]
 gi|307775217|gb|EFO34423.1| ATP synthase B chain [Roseibium sp. TrichSKD4]
          Length = 159

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/156 (30%), Positives = 88/156 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + L++F  +++YL++P  + S LD  AD I+D++ +ARRLRE+++ +L  Y+
Sbjct: 1   MDASFWALVGLVLFFALIIYLKVPGKITSGLDKRADDIKDELEKARRLREEAQALLSDYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + EEE   I+  A   A+ L  E  + +E++ +   K  E KI   + +A   + +
Sbjct: 61  RKRHEAEEEATAIVAEANAEAERLTAETNRALEEVISRRSKAAEDKIAQAETQAIAEVRS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           K AD +V+    +++ K+ D V   I   +IS +++
Sbjct: 121 KAADIAVQAAEGMLTAKVKDKVADDILSDSISQVKA 156


>gi|222147704|ref|YP_002548661.1| F0F1 ATP synthase subunit B [Agrobacterium vitis S4]
 gi|221734692|gb|ACM35655.1| ATP synthase F0 B subunit [Agrobacterium vitis S4]
          Length = 161

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 90/157 (57%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M +D TF  F+ L++FL ++ YL++P ++   LDA AD IRD++ EA+RLRE+++ +L +
Sbjct: 1   MQYDATFFAFVGLVLFLALIAYLKVPGMMAKSLDARADNIRDELAEAKRLREEAQQLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  + E E + I+ AA+  A  L EE  Q  E+         EQKI   + +A   +
Sbjct: 61  YRAKRKQAEAEAQAIVTAAEREAAALTEEARQKTEEFVQRRNALSEQKIKQAETDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +   D ++     ++ QK++  + S +F  ++S ++
Sbjct: 121 RSAAVDLAISAAETLLKQKVDAQLQSGLFNSSVSEVK 157


>gi|254461067|ref|ZP_05074483.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2083]
 gi|206677656|gb|EDZ42143.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium HTCC2083]
          Length = 186

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 87/155 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ +++Y +IP++L   LD  A+ IRD++ EA+ LRE+++ +L  Y+ 
Sbjct: 29  NTDFVVLLGFLLFIGVLLYFKIPALLGGLLDKRAEGIRDELDEAKALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ AA+  A + A++  ++++   A  L   + ++   +  A + +   
Sbjct: 89  KQKEVQEQADRIVEAARKDAVLAADQAKEDLKASIARRLAAAQDQLASAEAGAVKEVRDT 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++    ++I+++M     +++ +  IS + S
Sbjct: 149 AVTVAIAAANDVIAKQMTAKNGAALIDDAISEVSS 183


>gi|319784762|ref|YP_004144238.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170650|gb|ADV14188.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 163

 Score =  137 bits (346), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 89/154 (57%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    ++LIIFL + VY+++P ++   LDA A +I +++ EARRLRE+++ +L QY+ K
Sbjct: 7   ATLWATIALIIFLGVAVYIKVPGMIAKALDARAARISNELDEARRLREEAQQLLGQYQRK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E  +I+ AAK  A +LA +  +  E          EQKI   + +A   + A  
Sbjct: 67  RKEAEQEAADIVAAAKREADMLAADAHKKTEDYVVRRTALAEQKIGQAERDAISEVRASA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D +VE  R +++ K++    + +F+ +++ ++S
Sbjct: 127 VDIAVEAARALLAGKIDAKAGADLFKASLADVKS 160


>gi|83855051|ref|ZP_00948581.1| ATP synthase F0, B subunit [Sulfitobacter sp. NAS-14.1]
 gi|83842894|gb|EAP82061.1| ATP synthase F0, B subunit [Sulfitobacter sp. NAS-14.1]
          Length = 186

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 90/155 (58%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++Y ++P ++ S LD+ A+ I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTDFIVLLAFLLFVGVLIYFKVPKMMGSMLDSRAEGIKSELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +AK  A   A++   ++E+  A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVKEQADRIVTSAKAEANEAADQARADLEKSIARRMAAAEEQIDSAQAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++   +++I++KM     +++ +  I+ + +
Sbjct: 149 AVVVAIAAAKDVIAKKMTAAEGNALIDSAIAEVDT 183


>gi|304320006|ref|YP_003853649.1| ATP synthase F0 subunit B [Parvularcula bermudensis HTCC2503]
 gi|303298909|gb|ADM08508.1| ATP synthase F0, B subunit [Parvularcula bermudensis HTCC2503]
          Length = 194

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/155 (27%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D  F V ++ +I + I ++  +P ++ SFL A A+ ++  + EAR LRE+++  L  +++
Sbjct: 37  DTNFWVLLAFLIVVGIFLWQGVPKMIGSFLSARAEGVQRQLDEARTLREEAQRTLADFQK 96

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  + E E   II  AK  AK +A E    +++  A   K  E +I   + +A   +  +
Sbjct: 97  RQREAETEAEAIIEQAKADAKSVATEARAKLDEQIARRRKAAEDRIARAEAQAIAEIRGR 156

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            AD ++   REII+ +M+D     + ++ I+ + +
Sbjct: 157 TADMAIAAAREIIANRMDDRSQGQLIDRAINEVGT 191


>gi|83941574|ref|ZP_00954036.1| ATP synthase F0, B subunit [Sulfitobacter sp. EE-36]
 gi|83847394|gb|EAP85269.1| ATP synthase F0, B subunit [Sulfitobacter sp. EE-36]
          Length = 186

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 90/155 (58%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++Y ++P ++ S LD+ A+ I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTDFIVLLAFLLFVGVLIYFKVPKMMGSMLDSRAEGIKSELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +AK  A   A++   ++E+  A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVKEQADRIVTSAKAEANEAADQARADLEKSIARRMAAAEEQIDSAQAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++   +++I++KM     +++ +  I+ + +
Sbjct: 149 AVVVAIAAAKDVIAKKMTAAEGNALIDSAIAEVDA 183


>gi|86356513|ref|YP_468405.1| F0F1 ATP synthase subunit B [Rhizobium etli CFN 42]
 gi|123512871|sp|Q2KBV8|ATPF_RHIEC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86280615|gb|ABC89678.1| ATP synthase protein, subunit B [Rhizobium etli CFN 42]
          Length = 163

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 50/157 (31%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD TF  F+ LI+FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HFDATFFAFVGLILFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   + +A + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEADAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     ++++K +  V S +F   +  +++
Sbjct: 124 SAAVDLAIAAAETVLAKKADGKVQSELFGNAVGQVKT 160


>gi|56698065|ref|YP_168436.1| F0F1 ATP synthase subunit B [Ruegeria pomeroyi DSS-3]
 gi|81349060|sp|Q5LNH2|ATPF_SILPO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56679802|gb|AAV96468.1| ATP synthase F0, B subunit [Ruegeria pomeroyi DSS-3]
          Length = 190

 Score =  135 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ ++ Y ++PS++   LD  A+ I+ D+ EAR+LRE+++++L  ++ 
Sbjct: 33  NTDFVVTIAFLVFIAVLFYFKVPSMIGGALDKRAEGIQSDLDEARKLREEAQSLLASFER 92

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +++ +   I+ AAK  A+  AE+   ++E   A  L   + +I   +  A + +  +
Sbjct: 93  KQKEMQGQADAIVAAAKEEAQRSAEQAKVDLEASIARRLAAAQDQIASAEAAAVKDVRDR 152

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++I+  M     + + +  I+   +
Sbjct: 153 AIAIAVAAAGDVIASSMTAAEANKLIDAGIADAGA 187


>gi|86137237|ref|ZP_01055815.1| ATP synthase F0, B subunit [Roseobacter sp. MED193]
 gi|85826561|gb|EAQ46758.1| ATP synthase F0, B subunit [Roseobacter sp. MED193]
          Length = 186

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ I++++++PS+L   LDA A+ I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTNFVVLLGFLLFVGILLFVKVPSLLGGQLDARAEGIQKELDEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   AEE    +EQ  A  L   E++I   +  A + +  +
Sbjct: 89  KQQEVQAQADRIVASAREDAAAAAEEAKSELEQSIARRLAAAEEQIASAEASAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++I+++M     + + +  I+ +  
Sbjct: 149 AISIAVAAADQVIAKQMTATEANKLIDAAITDVND 183


>gi|209548121|ref|YP_002280038.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226694453|sp|B5ZS19|ATPF_RHILW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209533877|gb|ACI53812.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 163

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 49/157 (31%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     ++ ++ +  V S +F   +  +++
Sbjct: 124 SAAVDLAIAAAETVLGKQADAKVQSELFGNAVGQVKT 160


>gi|163733901|ref|ZP_02141343.1| ATP synthase F0, B subunit [Roseobacter litoralis Och 149]
 gi|161393012|gb|EDQ17339.1| ATP synthase F0, B subunit [Roseobacter litoralis Och 149]
          Length = 191

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 42/155 (27%), Positives = 88/155 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+VF+ L++F+ I+VY ++P ++   LD  A+ I  ++ EAR LRE+++ +L  Y+ 
Sbjct: 34  NTDFVVFLGLVVFIGILVYFKVPGMIGKMLDGRAEGIEGELNEARALREEAQTLLASYER 93

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           KH +V+E+   I+ AAK  A I AE+   ++E   A  +   E +I   +  A + +  +
Sbjct: 94  KHREVQEQADRIVEAAKEEATIAAEQARADLEVSLARRVAAAEDQIASAQAAAIKDVRDQ 153

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++   RE+I++++     + + +  I+ +++
Sbjct: 154 SVSVAIAAAREVIAKQLTAADANQLIDGAIAEVEA 188


>gi|254454347|ref|ZP_05067784.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
 gi|198268753|gb|EDY93023.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
          Length = 190

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 39/159 (24%), Positives = 81/159 (50%), Gaps = 1/159 (0%)

Query: 1   MHFDET-FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
            H D T  +V ++ IIF+ +++  ++P +L   LD  A+ I+ DI EA+ LRE+++ +L 
Sbjct: 29  WHLDNTDLIVLIAFIIFIGVLLKYKVPGMLTGLLDKRAEGIKSDIDEAKALREEAQTLLA 88

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
            Y+ K  +V+ +   I+  AK  A +  E+  ++I+      L   E +I   K  A R 
Sbjct: 89  SYERKQREVQAQADRIVANAKEEATLAGEQAKEDIKSSIVRRLAAAEDQIASAKASAIRE 148

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +    +V   +++I+ +      + + +  I+ + +
Sbjct: 149 VRNQAVKVAVAAAQDVIAAQTTPADANKLIDDAIAEVGA 187


>gi|254487002|ref|ZP_05100207.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
 gi|214043871|gb|EEB84509.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
          Length = 186

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 37/156 (23%), Positives = 86/156 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +  F+V ++ I+F+ ++ Y ++PS++   LD  A  I+ ++ EAR LRE+++ +L  Y+
Sbjct: 28  HNTDFVVLLAFILFIGVLFYFKVPSLIAGMLDKRATGIKSELEEARALREEAQTLLASYE 87

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  +V+++   I+ AAK  A   A++   ++E+  A  +   + +I   +  A + +  
Sbjct: 88  RKQQEVKDQADRIVTAAKAEAHEAADQARADLEKSIARRVATAQDQIESAQAAAVKEVRD 147

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +    +V   +++I++KM     +++ +  I+ + S
Sbjct: 148 QAIIIAVAAAKDVIAKKMTAAEGNALIDSAIADVDS 183


>gi|126734941|ref|ZP_01750687.1| ATP synthase F0, B subunit [Roseobacter sp. CCS2]
 gi|126715496|gb|EBA12361.1| ATP synthase F0, B subunit [Roseobacter sp. CCS2]
          Length = 170

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 87/153 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P ++   LD  AD I+ ++ EA+ LRE+++++L  Y+ 
Sbjct: 13  NTDFVVLIAFVIFIGILLYFKVPGLVGGMLDKRADSIKAELDEAKALREEAQSLLASYER 72

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E++  I+ AAK  A   A     +I +     L   E++I   +  A + +  +
Sbjct: 73  KQKEVQEQSARIVAAAKEEATNAATAAKDDIAKSITRRLAAAEEQIASAEASAVKEVRDQ 132

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
               +V   +++I+++M+     ++ + +I+++
Sbjct: 133 AIAVAVGAAKDVIAKQMDAKSAGALIDDSIATV 165


>gi|328544975|ref|YP_004305084.1| ATP synthase B/B' CF(0) superfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326414717|gb|ADZ71780.1| ATP synthase B/B' CF(0) superfamily [Polymorphum gilvum
           SL003B-26A1]
          Length = 159

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/157 (29%), Positives = 87/157 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F+ L++F V++ ++++P  + + LD  AD IR+++ EAR+LRE+++ +L +Y+
Sbjct: 1   MDATFWAFVGLVLFFVVMFWVKVPGKIGAALDKRADTIRNELDEARKLREEAQALLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+  A+  A+ L  E  + +E + A   +  E KI   +  A   + A
Sbjct: 61  RKRHEAESEAEAIVAEARAEAERLTVETNKALEDMIARRTRAAEDKIAQAETAAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           + AD +V    +I+  K+ D V   I  ++I  +++ 
Sbjct: 121 RAADIAVAAAEQILKAKVQDKVADDIMARSIDQVKAS 157


>gi|114769967|ref|ZP_01447577.1| ATP synthase F0, B subunit [alpha proteobacterium HTCC2255]
 gi|114549672|gb|EAU52554.1| ATP synthase F0, B subunit [alpha proteobacterium HTCC2255]
          Length = 185

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/152 (26%), Positives = 80/152 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++YL++P  L   LD  A+ I+ ++ EAR LRE++++IL +Y+ 
Sbjct: 28  NTNFVVLIAFLLFVGLLIYLKVPGKLSGMLDERANGIQSELDEARSLREEAQSILAEYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +  +IIL AK  AK  A     N++      L   E +I   +  A + +   
Sbjct: 88  KQKEVQNQADQIILHAKEEAKNAAAAAKDNLKASIKRRLASAEDQILSAQTAAVKEVKDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
               ++   +++IS  MN    + + E  I  
Sbjct: 148 AVIVAIAAAKDVISSGMNASHANELIETAIKD 179


>gi|126732371|ref|ZP_01748171.1| ATP synthase F0, B subunit [Sagittula stellata E-37]
 gi|126707240|gb|EBA06306.1| ATP synthase F0, B subunit [Sagittula stellata E-37]
          Length = 185

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 86/156 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +  F+V ++ ++FLV++VY  +P++L   LD  A+ I+ ++ EARR+RE+++ +L  Y+
Sbjct: 27  HNTNFIVLIAFLLFLVVLVYFNVPAMLGKLLDKRAEDIQSELDEARRIREEAQTLLASYE 86

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K   V+++   I+  A+  A++ AEE    + +     L   E +I   +  A + +  
Sbjct: 87  RKQRDVQDQADRIVAHARQEAELAAEEAKAKLAESIKRRLAAAESQIASAEAAAVKEVRD 146

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             A  ++   RE+++++M+      + + +IS + +
Sbjct: 147 TAATVAIAAAREVVAEQMDAAKAGQMIDASISEVGA 182


>gi|84684306|ref|ZP_01012208.1| ATP synthase F0, B subunit [Maritimibacter alkaliphilus HTCC2654]
 gi|84668059|gb|EAQ14527.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2654]
          Length = 185

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ I+F++++VY ++P ++   LD  AD I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 28  NTDFIVLLAFILFVLVLVYFKVPGMIGGMLDKRADTIKAELEEARALREEAQTILASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+++  +I+  AK  A   AE+    I +     L   E++I   +  A + +   
Sbjct: 88  KQQEVKDQAAQIVEHAKTEAAEAAEQAKIQIAESIKRRLAGAEEQIKSAEAAAIKEIRDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++   +E+I++KM     + + + +I  +++
Sbjct: 148 AIAAAIGASKEVIAKKMTATEANKLIDASIGEVEA 182


>gi|260432718|ref|ZP_05786689.1| ATP synthase B chain [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416546|gb|EEX09805.1| ATP synthase B chain [Silicibacter lacuscaerulensis ITI-1157]
          Length = 186

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 78/154 (50%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  I+F+ ++ Y ++P ++   LD  A  I+ ++ EAR L E++  +L  Y+ 
Sbjct: 29  NTDFVVSLGFIVFIAVLFYFKVPGMIGGALDNRAQGIQAELDEARALHEEARALLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ AAK  A + AE+   ++E+  A  L   + +I   +  A + +  +
Sbjct: 89  KQREVQAQADAIVAAAKEDAVLAAEQAKADLEKSIARRLAAAQDQIASAEAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               +V   + +++Q+M     + + +  I  + 
Sbjct: 149 AVAAAVAAAKSVLAQQMTAAQANKLIDDAIGEVG 182


>gi|110678647|ref|YP_681654.1| F0F1 ATP synthase subunit B [Roseobacter denitrificans OCh 114]
 gi|123172761|sp|Q16AM5|ATPF_ROSDO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|109454763|gb|ABG30968.1| ATP synthase F0, B subunit [Roseobacter denitrificans OCh 114]
          Length = 188

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 89/155 (57%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V + L++F+ I+VY ++P ++   LD+ A+ I  ++ EAR LRE+++++L  Y+ 
Sbjct: 31  NTDFVVLLGLLVFIGILVYFKVPGMIGKMLDSRAEGIEAELNEARALREEAQSLLASYER 90

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ AAK  A I AE+   ++E   A  +   E +I   +  A + +  +
Sbjct: 91  KQREVQEQADRIVEAAKEEATIAAEQARADLEVSLARRMAAAEDQIASAQAAAIKEVRDQ 150

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++   +++I++++     +++ +  I+ +++
Sbjct: 151 SVSIAIAAAQDVIAKQLTAADANALIDGAITEVEA 185


>gi|150395675|ref|YP_001326142.1| F0F1 ATP synthase subunit B [Sinorhizobium medicae WSM419]
 gi|226695843|sp|A6U6M7|ATPF_SINMW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150027190|gb|ABR59307.1| ATP synthase F0, B subunit [Sinorhizobium medicae WSM419]
          Length = 161

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 89/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+F V++ YL++P ++   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAASIVAAAQREAEMLTAEAKQKTEEFVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A   D ++    ++I+ K +     ++F+K +  ++S
Sbjct: 121 RAAAVDLAISAAEKVIASKADASAQETLFQKALGEVKS 158


>gi|255264092|ref|ZP_05343434.1| ATP synthase B chain (Subunit I) [Thalassiobium sp. R2A62]
 gi|255106427|gb|EET49101.1| ATP synthase B chain (Subunit I) [Thalassiobium sp. R2A62]
          Length = 185

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ ++ Y ++PS+L   LD  A  I+ D+ EA+ LRE+++ +L  Y+ 
Sbjct: 28  NTDFVVLLAFLLFIGVLFYFKVPSLLSGMLDGRATGIQADLDEAKALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ AAK  A   A++  ++I+   A  L   E +I   +  A + +   
Sbjct: 88  KQKEVQAQADRIVEAAKADASAAADQAREDIKTSVARRLSAAEDQIASAQASAVKEVRDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++    ++I+++      +S+ ++ I+++ +
Sbjct: 148 AVTVAIAAATDVIAKQTTAADQNSLIDEAIATVGA 182


>gi|254503348|ref|ZP_05115499.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
 gi|222439419|gb|EEE46098.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
          Length = 159

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 88/156 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + L++F V++ YL++P ++   LD  AD I+ ++ EAR++RE+++ +L +Y+
Sbjct: 1   MDASFWALVGLVLFFVLIAYLKVPGMIGGALDKRADDIKKELEEARKMREEAQELLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+  A   A+ L  E  Q +E++ A   K  E+KI   + +A   + A
Sbjct: 61  RKRHEAESEAEAIVAEANAEAERLTVETNQALEEMIARRSKAAEEKIAQAETQAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           K AD +V    EI+S K+ D V   I  K+I+ ++ 
Sbjct: 121 KAADIAVAAAEEILSAKVKDKVADDILAKSITQVKD 156


>gi|222085045|ref|YP_002543574.1| ATP synthase F0, B subunit [Agrobacterium radiobacter K84]
 gi|221722493|gb|ACM25649.1| ATP synthase F0, B subunit [Agrobacterium radiobacter K84]
          Length = 163

 Score =  130 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 47/157 (29%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
             DETF  F++L++F+ +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   ALDETFFAFVALLLFIGLVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E +   I+ AA+  A++L  E  +  E+  A      EQKI   + +A + + 
Sbjct: 64  QRKRKEAEADAANIVAAAEREAEMLTTEARKKTEEFVANRTALSEQKIKQAEADAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     ++++K    V S +F   +S +++
Sbjct: 124 SAAVDLAIAAAESVLAKKAGGKVQSELFSNAVSEVKT 160


>gi|119385601|ref|YP_916656.1| F0F1 ATP synthase subunit B [Paracoccus denitrificans PD1222]
 gi|226694341|sp|A1B616|ATPF_PARDP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119376196|gb|ABL70960.1| H+-transporting two-sector ATPase, B/B' subunit [Paracoccus
           denitrificans PD1222]
          Length = 184

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/153 (28%), Positives = 84/153 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I+VY R+P I+   LD  A+ IR+D+ EARRLRE+++ I   Y+ 
Sbjct: 27  NTDFIVTLAFLLFVGILVYFRVPQIVGGLLDKRAEGIRNDLAEARRLREEAQEIYASYER 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  +V+ +  +I+  AK  A   AE+  + ++      LK  E++I   + EA R +  +
Sbjct: 87  RQREVKSQADDIVANAKREAVAEAEKAKKALQLSIERRLKAAEEQIAGAEAEAVRAVRDR 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
               ++    EI+ ++ +    S+  +K I  +
Sbjct: 147 AIQTAIAAATEILGKQASPAERSAGIDKAIDEV 179


>gi|218679067|ref|ZP_03526964.1| F0F1 ATP synthase subunit B [Rhizobium etli CIAT 894]
          Length = 157

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 49/153 (32%), Positives = 89/153 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 5   HLDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 64

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   + EA + + 
Sbjct: 65  QRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRTALSEQKIKQAEAEAMKAVR 124

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
           +   D ++     +++++ +  V S +F   I 
Sbjct: 125 SAAVDLAIAAAETVLAKQADGKVQSELFGNAIG 157


>gi|15964591|ref|NP_384944.1| F0F1 ATP synthase subunit B [Sinorhizobium meliloti 1021]
 gi|307309337|ref|ZP_07589000.1| ATP synthase F0, B subunit [Sinorhizobium meliloti BL225C]
 gi|307320073|ref|ZP_07599494.1| ATP synthase F0, B subunit [Sinorhizobium meliloti AK83]
 gi|81635005|sp|Q92RM5|ATPF_RHIME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15073769|emb|CAC45410.1| Probable ATP synthase B chain transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306894288|gb|EFN25053.1| ATP synthase F0, B subunit [Sinorhizobium meliloti AK83]
 gi|306900206|gb|EFN30824.1| ATP synthase F0, B subunit [Sinorhizobium meliloti BL225C]
          Length = 161

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 89/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+F V++ YL++P ++   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAASIVAAAQREAEMLTAEAKQKTEEYVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A   D ++    ++++ K +     ++F+K I  +++
Sbjct: 121 RAAAVDLAISAAEKVLASKADAGAQETLFKKAIGEVKA 158


>gi|163761010|ref|ZP_02168088.1| F0F1 ATP synthase subunit B [Hoeflea phototrophica DFL-43]
 gi|162281791|gb|EDQ32084.1| F0F1 ATP synthase subunit B [Hoeflea phototrophica DFL-43]
          Length = 159

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/156 (28%), Positives = 90/156 (57%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + LIIFL I+ Y+++P+++ S LD  AD+IR+++ +A++LRE+++ +L +Y+
Sbjct: 1   MDASFWALVGLIIFLGIMAYIKVPAMMGSALDKRADQIRNELEQAKKLREEAQQLLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+ AA+  A IL +E     E+  +      EQKI   + +A   + A
Sbjct: 61  RKRKEAEAEAAGILSAAEKEAAILRDEAKAKTEEYVSRRTAMAEQKIQQAEADAINEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     +I +K++   + ++F+ ++  +++
Sbjct: 121 AAVDLAVVAAENLIGKKVDSKASDALFKASLGDLKT 156


>gi|190890578|ref|YP_001977120.1| ATP synthase, subunit B [Rhizobium etli CIAT 652]
 gi|218509939|ref|ZP_03507817.1| F0F1 ATP synthase subunit B [Rhizobium etli Brasil 5]
 gi|226694451|sp|B3PRF9|ATPF_RHIE6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190695857|gb|ACE89942.1| ATP synthase protein, subunit B [Rhizobium etli CIAT 652]
 gi|327190881|gb|EGE57940.1| ATP synthase protein, subunit B [Rhizobium etli CNPAF512]
          Length = 163

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 48/157 (30%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HLDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  +  +  E+  A      EQKI   + EA + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAEMLTADAKKKTEEFVANRTALSEQKILQAEAEAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     +++++ +  V S +F   +S +++
Sbjct: 124 SAAVDLAIAAAETVLAKQADAKVQSELFGNAVSQVKT 160


>gi|116250702|ref|YP_766540.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226694452|sp|Q1MKS9|ATPF_RHIL3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|115255350|emb|CAK06425.1| putative ATP synthase sub unit b [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 162

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 47/157 (29%), Positives = 93/157 (59%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
             D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L++Y
Sbjct: 3   FLDATFFAFVGLVLFLALVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLVEY 62

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + 
Sbjct: 63  QRKRKEAEAEAAHIVAAAEREAEMLTAEAMKKTEEFVANRTALSEQKIKQAEVEAMKAVR 122

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +   D ++     +++++ +  V S +F   +  +++
Sbjct: 123 SAAVDLAIAAAETVLAKRADAKVQSELFGNAVGQVKT 159


>gi|260460366|ref|ZP_05808618.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259034011|gb|EEW35270.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 163

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 47/154 (30%), Positives = 88/154 (57%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    ++L+IFL I VY+++P ++   LDA A +I  ++ EAR+LRE+++ +L QY+ K
Sbjct: 7   ATLWATIALVIFLAIAVYIKVPGLIAKALDARAMRISSELDEARKLREEAQQLLGQYQRK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E  +I+ AAK  A +LA E  +  E          EQKI   + +A   + A  
Sbjct: 67  RKEAEQEAADIVAAAKREADLLAAEAHKKTEDYVTRRTALAEQKIGQAERDAISEVRASA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D +VE  R +++ K++    + +F+ +++ +++
Sbjct: 127 VDIAVEAARALLAAKVDVKAGADLFKASLADVKA 160


>gi|118590788|ref|ZP_01548189.1| F0F1 ATP synthase subunit B [Stappia aggregata IAM 12614]
 gi|118436764|gb|EAV43404.1| F0F1 ATP synthase subunit B [Stappia aggregata IAM 12614]
          Length = 159

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/156 (31%), Positives = 87/156 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LI+F V++ Y+++P+ +   LD  A+ IR ++ +AR++RE+++ +L +Y+
Sbjct: 1   MDATFWALIGLILFFVVIFYVKVPAKINGSLDDRAETIRKELEDARKMREEAQALLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   II  A   A+ L  E  Q ++++ A   K  E KI   + +A   + A
Sbjct: 61  RKRHEAEGEAEAIIAEANSEAERLTLETSQALDEMIARRTKAAEDKIAQAESQAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           K AD +V    EI++ K+ D V   I  K+I+ ++ 
Sbjct: 121 KAADIAVAAAEEILAAKVKDKVADDILTKSIAQVKE 156


>gi|254455815|ref|ZP_05069244.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082817|gb|EDZ60243.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 165

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 40/158 (25%), Positives = 75/158 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S IIF   ++YL+IP  +   L+     I+++I E+ +LR  ++ +L  
Sbjct: 1   MAIDATFWVAVSFIIFFGALIYLKIPQKITEILNKMISDIKNEIDESEKLRTDAKTLLDN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + EI+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 61  AQNKLDTAQSVSSEILEEAKKDSDKLIIELNDKFHKSSEIKKNLAENKISQMKEAAIKEI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
                  +V+ V++II+  ++     ++F+K +   + 
Sbjct: 121 KDASIKIAVDSVKKIITTSVDKSKLDAVFQKNLDETKE 158


>gi|294676301|ref|YP_003576916.1| ATP synthase F0 subunit B [Rhodobacter capsulatus SB 1003]
 gi|75498234|sp|O05333|ATPF_RHOCA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|1934978|emb|CAA72984.1| FoF1 ATP synthase, subunit B [Rhodobacter capsulatus]
 gi|294475121|gb|ADE84509.1| ATP synthase F0, B subunit [Rhodobacter capsulatus SB 1003]
          Length = 185

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 90/155 (58%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F++ ++ +IF+ +++  ++PS+LL  LD  A+ I+ D+ EA+ LR++++ IL  Y+ 
Sbjct: 28  NAHFVILVAFLIFVGVLIKFKVPSMLLGMLDKRAEGIKADLDEAKALRDEAQKILASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +  EI+ AAK  A++ AE+   ++++  A  LK  E +I   +  A + +  +
Sbjct: 88  KAREVQGQADEIVAAAKRDAQLAAEQAKADLKEAIARRLKGAEDRIASAEAAALKDVKDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    E+++ +M+    S + +  I+ +++
Sbjct: 148 AVQVAVAAAAEVLANQMSASDKSGMIDAAITEVET 182


>gi|90426284|ref|YP_534654.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
 gi|122474863|sp|Q20X01|ATPF_RHOPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|90108298|gb|ABD90335.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
          Length = 164

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 77/155 (49%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +    V ++ +I + +  Y  +   +L  LD   D+I+ ++ EA RL+E++  +L +YK 
Sbjct: 7   EPETWVAVAFVILMGVFAYFGVHRTVLKSLDNRRDRIKAELDEAARLKEEAAALLAEYKA 66

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + +  E E +EII  AK  A+ +A E    +E   A   K  E KI   + +A   + + 
Sbjct: 67  RRASAEREAQEIIAGAKDEAERIAAEAKAKLEDFVARRTKTAEGKIALAEAQAVADVRSA 126

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A+ +V     I+SQ +   V   + ++ I  ++S
Sbjct: 127 AANAAVAAASTILSQSVKGQVAEGLLQRGIEEVRS 161


>gi|13476166|ref|NP_107736.1| F0F1 ATP synthase subunit B [Mesorhizobium loti MAFF303099]
 gi|81776791|sp|Q986D1|ATPF2_RHILO RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|14026926|dbj|BAB53522.1| Fo ATP synthase B chain [Mesorhizobium loti MAFF303099]
          Length = 163

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/154 (29%), Positives = 90/154 (58%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    ++LIIFL + +Y+++P ++   LDA A +I  ++ EAR+LR++++ +L QYK+K
Sbjct: 7   ATLWATIALIIFLGVAIYIKVPGLIAKALDARAARISSELDEARKLRDEAQQLLGQYKKK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E  +I+ AAK  A++LA E  +  E          EQKI   + +A   + A  
Sbjct: 67  RKEAEQEAADIVAAAKREAEMLATEAHKKTEDYVIRRTALAEQKIGQAERDAVAEVRASA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D +VE  R +++ K++    + +F+ +++ +++
Sbjct: 127 VDIAVEAARALLAAKVDVKAGADLFKASLADVKA 160


>gi|126738037|ref|ZP_01753758.1| ATP synthase F0, B subunit [Roseobacter sp. SK209-2-6]
 gi|126720534|gb|EBA17239.1| ATP synthase F0, B subunit [Roseobacter sp. SK209-2-6]
          Length = 185

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +   +V +  ++F+ I++++++PS+L   LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTNLVVALGFLLFVGILLFVKVPSLLGKQLDNRADGIQKELDEARALREEAQTVLADYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   AEE    +E+  A  L   E++I   +  A + +  +
Sbjct: 88  KQQEVQAQADSIVASAREDAARAAEEAKAELEKSIARRLAAAEEQIDSAEASAVKEVRDQ 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++I+++M     + + +  I+ + +
Sbjct: 148 AITIAVAAADQVIAKQMTAAEANKLIDAAIADVDA 182


>gi|154251150|ref|YP_001411974.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|226694373|sp|A7HQY4|ATPF1_PARL1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|154155100|gb|ABS62317.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 161

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 80/158 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F +   L+ F  I+ Y ++   L + LD  A  I  ++ EARRLRE+++ +L  
Sbjct: 1   MFATAEFWILACLVAFFAILGYFKVHRTLAATLDKRAADIAAELDEARRLREEAQQLLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  +  +E  +I+  AK  A+ LA+E   N+E       K  E KI   + +A   +
Sbjct: 61  YQRKQREAMKEAEDIVAQAKVEAEQLAKETRANMEIQVERRTKLAEDKIAQAETQALNDV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  A+ +V   R +I+ K++   ++   EK+IS + S
Sbjct: 121 RATAAEVAVGAARRVIAAKVDAGKDAEFVEKSISELTS 158


>gi|91762750|ref|ZP_01264715.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718552|gb|EAS85202.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 168

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 77/159 (48%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S +IF+  +VYL+IP  +   L+     I+++I E+ +LR++++ +L  
Sbjct: 4   MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN 63

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + +I+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 64  AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEI 123

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
                  +V+ V++II+  ++      +FEK +   +  
Sbjct: 124 KDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIA 162


>gi|146276249|ref|YP_001166408.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides ATCC 17025]
 gi|226694456|sp|A4WNY9|ATPF_RHOS5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145554490|gb|ABP69103.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 184

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I+VY ++P  +L  LD  A +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILVYAKVPGRILGMLDRRAVQIRSELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   +++   A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLKASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++++++M     S+  +++I  +++
Sbjct: 147 AISVAVAAASDVLARQMTPAATSASIDESIKEVEA 181


>gi|254465155|ref|ZP_05078566.1| ATP synthase B chain [Rhodobacterales bacterium Y4I]
 gi|206686063|gb|EDZ46545.1| ATP synthase B chain [Rhodobacterales bacterium Y4I]
          Length = 186

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++  ++P +L + LD  A+ I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTDFVVLLAFLLFVGILLLAKVPGLLGNQLDNRAEAIQKELDEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +  +I+ AA+  A   AE    ++E   A  L   +++I   +  A R +  +
Sbjct: 89  KQQEVQAQADQIVAAARDEAARAAEVAKADLETSIARRLAAAQEQIASAEASAVREVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    E+IS++M     + + +  I+ + +
Sbjct: 149 AISIAVAAADEVISKQMTAAEANKLIDAAIADVDA 183


>gi|227821029|ref|YP_002824999.1| F0F1 ATP synthase subunit B [Sinorhizobium fredii NGR234]
 gi|227340028|gb|ACP24246.1| Fo ATP synthase B chain [Sinorhizobium fredii NGR234]
          Length = 161

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 85/157 (54%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+FL ++ YL++P  +   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFLALIAYLKVPGKIAEALDARADKIGNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E   A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAANIVAAAQREAEMLTAEAKQKTEDYVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
                D ++    ++++ K +     ++F++ +  ++
Sbjct: 121 RTAAVDLAISAAEKVLATKADATAQETLFKQALGEVK 157


>gi|254471717|ref|ZP_05085118.1| ATP synthase protein, subunit B [Pseudovibrio sp. JE062]
 gi|211958919|gb|EEA94118.1| ATP synthase protein, subunit B [Pseudovibrio sp. JE062]
          Length = 161

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 84/158 (53%), Gaps = 1/158 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD +    + LI+F V++ YL++P  + + LD  AD I+ ++  AR+LRE+++ ++ +Y+
Sbjct: 2   FDASLWALVGLILFFVLLWYLKVPGKIGAMLDQQADNIKQELEGARKLREEAQALMAEYQ 61

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E  +I+  AK  A  LA+E    +E++ A   K  E KI   +  A   + +
Sbjct: 62  RKRKEAEAEAEQIVADAKVEADRLADEAKAALEEMIARRTKAAEAKIAQAEANAIAEVRS 121

Query: 123 KIADFSVEIVREIISQK-MNDDVNSSIFEKTISSIQSC 159
           + AD +V+    I++      +V   + +++I  +   
Sbjct: 122 RAADVAVQAAETIVASSAAKAEVQDKVLKQSIKQVSDS 159


>gi|71082827|ref|YP_265546.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71061940|gb|AAZ20943.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 165

 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/159 (25%), Positives = 77/159 (48%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S +IF+  +VYL+IP  +   L+     I+++I E+ +LR++++ +L  
Sbjct: 1   MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + +I+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 61  AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
                  +V+ V++II+  ++      +FEK +   +  
Sbjct: 121 KDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIA 159


>gi|148252426|ref|YP_001237011.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
 gi|226741346|sp|A5EAB1|ATPF_BRASB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146404599|gb|ABQ33105.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
          Length = 163

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 80/157 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  D    V ++ +I + +  YL +   +L  LD  A++IR+++ EA+RL++++  +L  
Sbjct: 3   LLADPETWVAIAFVILMGLFAYLGVHRTVLKALDHRAERIRNELEEAKRLKQEAAKVLAD 62

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + +  E E  EI+ +AK  A+ +A +    +E   A   K  E KI   + +A   +
Sbjct: 63  YKARRASAEREAEEIVTSAKAEAERIAADAKAKMEDFVARRTKAAESKIALAEAQALADV 122

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +  AD +V+    ++SQ +   +   +  K I+ + 
Sbjct: 123 RSAAADAAVQAAATVLSQSVKGSLGEDLVAKGIAEVG 159


>gi|126724950|ref|ZP_01740793.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2150]
 gi|126706114|gb|EBA05204.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2150]
          Length = 185

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/156 (26%), Positives = 85/156 (54%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F+  F+V+++ I F+ ++VYL++P  L   LDA A+ IR ++ EA+ LRE+++ +L  Y+
Sbjct: 27  FNTNFVVWLAFIAFIAVLVYLKVPGKLGGALDARANDIRSELDEAKALREEAQTLLASYE 86

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  +V E++  II+ AK  A + A +    ++      L   E +I   + +A + +  
Sbjct: 87  RKQREVAEQSERIIVTAKEEAAVAAAKAKDELKTSIERRLAAAEDQITSAEAKAIQQVRD 146

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
                ++    + I+ KM    ++++ ++ I++  S
Sbjct: 147 SAVSVAIGAAGDAIAAKMTAADSNALIDEAIANAGS 182


>gi|83951212|ref|ZP_00959945.1| ATP synthase F0, B subunit [Roseovarius nubinhibens ISM]
 gi|83839111|gb|EAP78407.1| ATP synthase F0, B subunit [Roseovarius nubinhibens ISM]
          Length = 185

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +S ++F+ ++V L++P  +   LD  A  I+ D+ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTNFVVLISFLLFVGLIVALKVPGKIGEMLDKRAAGIKSDLDEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+++   I+  AK  A   A++  ++++   A  L+  E++I   +  A + +  +
Sbjct: 88  KQKEVQDQAARIVEHAKAEAAAAADKAKEDLKGTIARRLQAAEEQIASAEAGAVKEVRDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++   R++I+++M     + + ++ I+ +  
Sbjct: 148 AVAVAIAAARDVIAKQMTAADGNKLIDEAIAEVGD 182


>gi|330813669|ref|YP_004357908.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486764|gb|AEA81169.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 162

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 88/160 (55%), Gaps = 4/160 (2%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF V +S  +F++++VY ++P I+ + L+    +I++ + +A  L+++S ++L +Y+
Sbjct: 1   MDSTFWVGISFCLFVLLLVYKKVPGIINNVLEGKIKEIKNKLEDAENLKKESNHLLGKYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + ++E  EI+  A    +  +    + +  + AL  K++ +K++  K  A + +  
Sbjct: 61  KQLDESKKECEEILQRASKINESESSTMKEKMNSMMALKEKNINEKVNQAKNGAIKEMKK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSI----FEKTISSIQS 158
                +VE  ++II+Q ++ +   SI     ++ + S++ 
Sbjct: 121 IATIIAVESAKKIITQTIDKEKIDSINYTSIQENLESLKK 160


>gi|83945330|ref|ZP_00957678.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
 gi|83851164|gb|EAP89021.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
          Length = 164

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/155 (27%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D +F  F+ LI+F V+++++  P ++   LD  AD IR ++ EARRLRE+++ ++  Y+ 
Sbjct: 7   DTSFWAFVGLILFFVVIIFVGAPKMIGKALDDRADLIRKELDEARRLREEAQELMATYER 66

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K ++   E   II  AK  A  L +     I Q         EQ+I   + +A + + + 
Sbjct: 67  KQTEAAAEAEAIIKQAKAEADYLRDNAKTEISQRIERRTAMAEQRIAQAEAQAAKEVKSL 126

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            AD +VE   +++S+K+     +++ +   ++++ 
Sbjct: 127 AADLAVEAAEQLLSKKLTKTQRNALLKADTAALKD 161


>gi|77464616|ref|YP_354120.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides 2.4.1]
 gi|123590921|sp|Q3IZ15|ATPF_RHOS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77389034|gb|ABA80219.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides 2.4.1]
          Length = 187

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 30  NTNFIVTLAFLLFMGILLYAKVPGRILGMLDKRSVQIRTELEEARALREEARTILASYDR 89

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 90  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 149

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 150 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 184


>gi|99082431|ref|YP_614585.1| F0F1 ATP synthase subunit B [Ruegeria sp. TM1040]
 gi|123378663|sp|Q1GDE3|ATPF_SILST RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|99038711|gb|ABF65323.1| H+-transporting two-sector ATPase B/B' subunit [Ruegeria sp.
           TM1040]
          Length = 185

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++  ++PS++   LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTDFVVILAFLLFIGILLAAKVPSLIGKQLDNRADSIKSELEEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+  A+  A   AE+   ++    A  L   E++I   +  A + +  +
Sbjct: 88  KQQDVQAQAERIVANARDEAAAAAEQAKADLAASIARRLTAAEEQIASAEASAVKEVRDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +VE+  ++IS++M     + + +  I  +++
Sbjct: 148 AITIAVEVADQVISKQMTAADANKLIDAAIQDVEA 182


>gi|254475959|ref|ZP_05089345.1| ATP synthase B chain [Ruegeria sp. R11]
 gi|214030202|gb|EEB71037.1| ATP synthase B chain [Ruegeria sp. R11]
          Length = 185

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 86/155 (55%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++PS+L   LD+ A+ I+ D+ EAR LRE+++ IL  Y+ 
Sbjct: 28  NTDFVVTLAFLLFIGILLYAKVPSLLGGQLDSRAEGIKKDLEEARALREEAQTILASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   AE+   +++   A  +   E++I   +  A + +  +
Sbjct: 88  KQQEVQAQADRIVASAREDAAQAAEQAKADLQTSIARRMAAAEEQIAAAQNSAVKEVRDQ 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +++    +IS++M     + + +  I+ + +
Sbjct: 148 AIVVAIQAADAVISKQMTATEANKLIDAAIADVDA 182


>gi|254437689|ref|ZP_05051183.1| ATP synthase B/B' CF(0) family [Octadecabacter antarcticus 307]
 gi|198253135|gb|EDY77449.1| ATP synthase B/B' CF(0) family [Octadecabacter antarcticus 307]
          Length = 194

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 77/155 (49%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +   +V ++ +IF+ +++  +IP++L+  LD  A  I+ +I EA+ LRE ++ +L  Y+ 
Sbjct: 37  NTDLIVLIAFVIFVGVLIKYKIPAMLMGLLDKRAADIKSEIDEAKALREDAQTLLASYER 96

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+  AK  A    E+  ++I+      L   + +I   +  A R +  +
Sbjct: 97  KQRDVQVQADRIVENAKEEATRAGEQAKEDIKSSIVRRLAAAQDQIASAQASAIREVRNQ 156

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V   +++I+++        + +  I+ + +
Sbjct: 157 AVKVAVAAAQDVIAKQTTAADADRMIDDAIAVVGA 191


>gi|299134065|ref|ZP_07027258.1| H+transporting two-sector ATPase B/B' subunit [Afipia sp. 1NLS2]
 gi|298590812|gb|EFI51014.1| H+transporting two-sector ATPase B/B' subunit [Afipia sp. 1NLS2]
          Length = 161

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 83/158 (52%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F V ++ ++ L I  Y  +   + + LD  + +IR ++ +ARRL+E++++++ +
Sbjct: 1   MLHEAEFWVAVAFVLMLAIFGYFGVHRTIAAALDNRSARIRKELDDARRLKEEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ +    E E +EI+ AAK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 61  YRARRQSAEREAQEIVAAAKADAERIAVEAKAKMEDFVARRTKSAENKIAQAETQAVADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  A+ +      ++SQ +  DV + + EK+I  + S
Sbjct: 121 RAAAAEAAATAAASVLSQTVKGDVANGLIEKSIKELGS 158


>gi|221640528|ref|YP_002526790.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides KD131]
 gi|221161309|gb|ACM02289.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides KD131]
          Length = 184

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILLYAKVPGRILGMLDKRSVQIRTELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 147 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 181


>gi|260574859|ref|ZP_05842861.1| H+transporting two-sector ATPase B/B' subunit [Rhodobacter sp. SW2]
 gi|259022864|gb|EEW26158.1| H+transporting two-sector ATPase B/B' subunit [Rhodobacter sp. SW2]
          Length = 184

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/156 (24%), Positives = 82/156 (52%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +  F+V +  +IFL  +VY ++P IL   LD  A +I+ D+ EAR LR++++ IL  Y+
Sbjct: 26  HNTNFVVLVGFLIFLAALVYFKVPGILGGLLDKRAVQIKSDLEEARALRDEAKEILASYE 85

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  +V+ ++  I+ +A+  A   A +   ++ +  A  L   E +I   +  A R +  
Sbjct: 86  RKQREVQAQSDRIVASAREEAVAAATQAKADLAEAIARRLAAAEDRITSAETAAVREVRE 145

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +    ++    ++++++M  D  ++  +  I  +++
Sbjct: 146 RAIAVAIAAAGDLLTKQMTADAAAASIDAAIVQVEA 181


>gi|126463456|ref|YP_001044570.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides ATCC 17029]
 gi|332559509|ref|ZP_08413831.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
 gi|226694455|sp|A3PN82|ATPF_RHOS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|126105120|gb|ABN77798.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332277221|gb|EGJ22536.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
          Length = 184

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILLYAKVPGRVLGMLDKRSVQIRTELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 147 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 181


>gi|154245919|ref|YP_001416877.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
 gi|226694371|sp|A7IGS7|ATPF1_XANP2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|154160004|gb|ABS67220.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
          Length = 163

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 75/154 (48%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
               V ++ ++F+ I++Y+     + S LD+   +I  ++ EARRL+E+++ ++ ++K K
Sbjct: 7   AELWVAVAFLLFVGILIYVGAHRAIGSALDSRGQRIAAELEEARRLKEEAQKLVAEFKRK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E E   I+ AAK  A+ LA E    +E       K  E KI   +L+A   + A  
Sbjct: 67  QREAEAEAESIVTAAKAEAERLASEAKAKLEDFVTRRTKMAEDKIAQAELQAVADVKAIA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD + +    ++      DV   +    I  +++
Sbjct: 127 ADAAAKAAEVLLGSAARGDVGDRLISNAIGEVKT 160


>gi|163743800|ref|ZP_02151173.1| ATP synthase F0, B subunit [Phaeobacter gallaeciensis 2.10]
 gi|161382949|gb|EDQ07345.1| ATP synthase F0, B subunit [Phaeobacter gallaeciensis 2.10]
          Length = 186

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P +L   LDA A+ I+ D+ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTDFVVTLAFLLFVGILLYAKVPGLLGGQLDARAEGIKKDLEEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   A++   ++E   A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVQAQADRIVASAREDAAKAADQAKADLEISIARRMTAAEEQITAAQDSAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++     +IS++M     + + +  I+ + +
Sbjct: 149 AITVAIAAADAVISKQMTATEANKLIDAAIADVDA 183


>gi|27376296|ref|NP_767825.1| FoF1 ATP synthase B chain [Bradyrhizobium japonicum USDA 110]
 gi|81739769|sp|Q89V71|ATPF_BRAJA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|27349436|dbj|BAC46450.1| FoF1 ATP synthase B chain [Bradyrhizobium japonicum USDA 110]
          Length = 161

 Score =  120 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/157 (28%), Positives = 80/157 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD    V ++ +I +V+  YL +    ++ LD  A +I+ ++ +A RL++++  +L  
Sbjct: 1   MFFDPETWVAIAFVILMVVFGYLGVFKSAMTALDHRAARIKAELDDATRLKQEAAKVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + +  E E  +II  AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 61  YKARSATAEREAADIIANAKVEAERIATEAKAKMEDFVARRTKTAESKIALAEAQAVADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A  A+ +V+    I+SQ +   V   +  K+IS ++
Sbjct: 121 RAAAAEAAVQAASTILSQSVKGQVADDLLAKSISEVR 157


>gi|259417462|ref|ZP_05741381.1| ATP synthase B chain (Subunit I) [Silicibacter sp. TrichCH4B]
 gi|259346368|gb|EEW58182.1| ATP synthase B chain (Subunit I) [Silicibacter sp. TrichCH4B]
          Length = 185

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++  ++PS++   LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTDFVVVLAFLLFIGILLAAKVPSLIGKQLDNRADSIKSELEEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+  A+  A   AE+   ++    A  L   E++I   +  A + +  +
Sbjct: 88  KQQDVQAQAERIVANARDEAAAAAEQAKADLAASIARRLAAAEEQISSAEASAVKEVRDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +VE+  ++IS++M+    + + +  I  + +
Sbjct: 148 AITIAVEVADQVISKQMSAADANKLIDAAIQDVDA 182


>gi|83313095|ref|YP_423359.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1]
 gi|123540650|sp|Q2W025|ATPF_MAGSA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|82947936|dbj|BAE52800.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1]
          Length = 178

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 76/153 (49%), Gaps = 1/153 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F V ++ I+ +V + +  +   + + LDA + KI+  + EA +LRE+++ +L  Y+ 
Sbjct: 22  EPHFWVDVAFIL-VVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQR 80

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K     +E  EII  AK  A+ LA++  +++E       +    +I   + +A R +   
Sbjct: 81  KQRDAMKEAEEIIAHAKAEAERLAKQAAKDLEVSMKRREQMAMDRIAQAEAQAVREVQNL 140

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             D ++   +++I + ++     S+ +  I  +
Sbjct: 141 AVDVAIGAAQKVIGESLSAAQTGSLVDNAIKDL 173


>gi|146343460|ref|YP_001208508.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. ORS278]
 gi|226741313|sp|A4Z2B7|ATPF_BRASO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146196266|emb|CAL80293.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. ORS278]
          Length = 164

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/156 (26%), Positives = 81/156 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  D    V ++ +I + +  YL +  ++L  LD  AD+IRD++ EA+RL++++  +L  
Sbjct: 4   LLADPETWVAIAFVILMGLFAYLGVHRMVLKALDHRADRIRDELAEAKRLKDEAAKVLAD 63

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + +  E E  EI+ +AK  A+ +A +    +E   A   K  E KI   + +A   +
Sbjct: 64  YKTRRASAEREAEEIVTSAKAEAERIAADAKAKMEDFVARRTKAAESKIALAEAQALADV 123

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A  A+ +V+    ++SQ +   +   +  K I+ +
Sbjct: 124 RAAAAEAAVQAAATVLSQSVKGGLGDDLVAKGIAEV 159


>gi|17983554|gb|AAL52724.1| ATP synthase b chain [Brucella melitensis bv. 1 str. 16M]
          Length = 142

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/139 (29%), Positives = 79/139 (56%)

Query: 20  VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAA 79
           +VY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y  K  + E+E  +I+ +A
Sbjct: 1   MVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYHRKRKEAEKEAGDIVASA 60

Query: 80  KHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQK 139
           +  AK L EE  +  E+  A   K  EQKI   + +A   + A   D +V     I+++K
Sbjct: 61  EREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRASAVDLAVAAAGSILAEK 120

Query: 140 MNDDVNSSIFEKTISSIQS 158
           ++     ++F   ++ ++S
Sbjct: 121 VDAKAAGNLFNDALAQVKS 139


>gi|283856305|ref|YP_162406.2| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775301|gb|AAV89295.2| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 212

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 81/157 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V +S+I+FL+++V+ ++PSI+ S LD   D+IR  + +A RLR+++E +  +
Sbjct: 49  LGLSGPAWVSVSIIVFLLVLVWKKVPSIITSGLDKQIDEIRTRLGDAERLRKEAEALKAE 108

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y EK  +   E   II  AK  A  +  +     +Q+     K   ++I   + EA   +
Sbjct: 109 YDEKTRQATSEAEAIIERAKEDASSIIADAKIQSQQLVERRQKMATEQIAAAEQEAVAEI 168

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               A  +++   +II ++ +   +  + ++TI S++
Sbjct: 169 RQTAAKLALQAATQIIQKQNDASHDKVLIDQTIDSLK 205


>gi|163738206|ref|ZP_02145622.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
 gi|161388822|gb|EDQ13175.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 186

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P +L   LDA A+ I+ D+ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTDFVVTLAFLLFVGILLYAKVPGLLGGQLDARAEGIKKDLEEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   A++   ++E   A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVQAQADRIVASAREDAAKAADQAKADLEISIARRMTAAEEQITAAQDSAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++     +IS++M     + + +  I+ + +
Sbjct: 149 AITVAIAAADAVISKQMTATEANKLIDAAIADVDA 183


>gi|8708912|gb|AAF78803.1| Fo ATP synthase B chain [Bradyrhizobium japonicum]
          Length = 169

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 62/122 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD    V ++ +I +V+  YL +    ++ LD  A +I+ ++ +A RL++++  +L  
Sbjct: 10  MFFDPETWVAIAFVILMVVFGYLGVFKSAMTALDHRAARIKAELDDATRLKQEAAKVLAD 69

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + +  E E  +II  AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 70  YKARSATAEREAADIIANAKVEAERIATEAKAKMEDFVARRTKTAESKIALAEAQAVADV 129

Query: 121 YA 122
            A
Sbjct: 130 RA 131


>gi|209883847|ref|YP_002287704.1| H+-transporting two-sector ATPase, B/B' subunit [Oligotropha
           carboxidovorans OM5]
 gi|226694331|sp|B6JDC7|ATPF_OLICO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209872043|gb|ACI91839.1| H+-transporting two-sector ATPase, B/B' subunit [Oligotropha
           carboxidovorans OM5]
          Length = 161

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 80/157 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +    V ++ ++ + + +Y     ++   LD  + +IR ++ +AR+L+E+++ ++ +
Sbjct: 1   MLHEAETWVAVAFVLMVALFIYFGAHRMIGEALDRRSARIRKELDDARQLKEEAQKLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ +    E E +EI+ AA+  A+ +A+E    +E   A   K  E KI   + +A   +
Sbjct: 61  YRSRRESAEREAQEIVAAAQADAERIAQEAKAKMEDFVARRTKAAESKIAQAETQAVADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A  A+ +      ++SQ +   +  ++ EK+I  + 
Sbjct: 121 RAAAAEAAAAAAANVLSQTVKGSIADNLIEKSIRELG 157


>gi|23016150|ref|ZP_00055909.1| COG0711: F0F1-type ATP synthase, subunit b [Magnetospirillum
           magnetotacticum MS-1]
          Length = 178

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 76/153 (49%), Gaps = 1/153 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F V ++ I+ +V + +  +   + + LDA + KI+  + EA +LRE+++ +L  Y+ 
Sbjct: 22  EPHFWVDVAFIL-VVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQR 80

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K     +E  EII  AK  A+ LA++  +++E       +    +I   + +A R +   
Sbjct: 81  KQRDAMKEAEEIIAHAKAEAERLAKQAAKDLEASMKRREQMAMDRIAQAEAQAVREVQNL 140

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             D ++   +++I + ++     ++ +  I  +
Sbjct: 141 AVDVAIGAAQKVIGESLSAAQTGALLDNAIKDL 173


>gi|241203304|ref|YP_002974400.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857194|gb|ACS54861.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 163

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 42/148 (28%), Positives = 88/148 (59%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           + L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y+ K  + E 
Sbjct: 13  VGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEA 72

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + +   D ++ 
Sbjct: 73  EAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVRSAAVDLAIA 132

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQS 158
               +++++ +  + S +F   +  +++
Sbjct: 133 AAETVLAKRADTKIQSELFGNAVGQVKT 160


>gi|241761302|ref|ZP_04759390.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752834|ref|YP_003225727.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|241374209|gb|EER63706.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258552197|gb|ACV75143.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 212

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 80/157 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V  S+I+FL+++V+ ++PSI+ S LD   D+IR  + +A RLR+++E +  +
Sbjct: 49  LGLSGPAWVSASIIVFLLVLVWKKVPSIITSGLDKQIDEIRTRLGDAERLRKEAEALKAE 108

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y EK  +   E   II  AK  A  +  +     +Q+     K   ++I   + EA   +
Sbjct: 109 YDEKTRQATSEAEAIIERAKEDASSIIADAKIQSQQLVERRQKMATEQIAAAEQEAVAEI 168

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               A  +++   +II ++ +   +  + ++TI S++
Sbjct: 169 RQTAAKLALQAATQIIQKQNDASHDKVLIDQTIDSLK 205


>gi|90420159|ref|ZP_01228067.1| possible ATP synthase chain B [Aurantimonas manganoxydans SI85-9A1]
 gi|90335493|gb|EAS49243.1| possible ATP synthase chain B [Aurantimonas manganoxydans SI85-9A1]
          Length = 159

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 51/156 (32%), Positives = 86/156 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F  F +LIIFL IV YL+ P+ + S LD  AD+IR++I EAR L+E+++  L +Y+
Sbjct: 1   MDNSFWAFAALIIFLAIVWYLKAPAKVGSTLDQRADRIRNEIEEARELKEEAKQQLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  + EEE +EI+ AAK  A+++  +  +  E+         E KI   + +A   + A
Sbjct: 61  RRRQEAEEEAKEIVAAAKREAELMLADTRRKNEEYVERRTAMAETKISQAETDAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V    +IIS + +        E +I+ ++S
Sbjct: 121 TAIDVAVAAAAKIISDRNSGGNAGQFTESSIAEVRS 156


>gi|312114303|ref|YP_004011899.1| H+transporting two-sector ATPase B/B' subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219432|gb|ADP70800.1| H+transporting two-sector ATPase B/B' subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 161

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/158 (26%), Positives = 82/158 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D    V ++ ++F+ +++Y  IP + L  LD  +D I  ++ EAR+LR ++E +L  
Sbjct: 1   MLMDPEVWVAIAFVLFICLILYYNIPGMALKALDQRSDAIGRELEEARKLRAEAETLLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK++ +  E E  EII  A+  A   A E   + +++    L   EQKI   + +A++ +
Sbjct: 61  YKQRAANAEIEAGEIIAQAEREAAAYATEARASFDELITRRLSVAEQKIKLEEEKARKQI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            AK A+ +V    +++  K+   +  +    ++  I+ 
Sbjct: 121 RAKAAELAVSAAEQLLQHKVTGKIAENTITASLDRIKK 158


>gi|325292103|ref|YP_004277967.1| ATP synthase B chain [Agrobacterium sp. H13-3]
 gi|325059956|gb|ADY63647.1| ATP synthase B chain [Agrobacterium sp. H13-3]
          Length = 161

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/158 (30%), Positives = 85/158 (53%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD +F   + L++F V++ YL++P +L   LD  A  I+D++ EA+RLRE+++++L +
Sbjct: 1   MAFDASFFALVGLVLFFVLIAYLKVPGMLSKSLDERAQNIQDELAEAKRLREEAQHLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  + E E   I+ AA+  A  L  E  Q  E+         EQKI   + +A   +
Sbjct: 61  YQRKRKEAEAEAAGIVAAAEREAAALTAEAKQKTEEFVVRRTALSEQKIKQAEEDAIGAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A   D ++    ++I++K      + +F  TI  ++S
Sbjct: 121 RAAAVDIAIAASEKLIAEKTTAAAKAKLFANTIGEVKS 158


>gi|159045567|ref|YP_001534361.1| F0F1 ATP synthase subunit B [Dinoroseobacter shibae DFL 12]
 gi|226694396|sp|A8LKH7|ATPF2_DINSH RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|157913327|gb|ABV94760.1| ATP synthase F0 [Dinoroseobacter shibae DFL 12]
          Length = 186

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 80/155 (51%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +S I F+ ++VY +IP IL   LD  A+ I+ ++ EA+ LRE+++ +L  Y+ 
Sbjct: 29  NTDFIVLISFIAFIGVLVYFKIPGILSGMLDKRAEGIKAELEEAKALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+  AK  A+  A +   ++E   A  L   E ++   +  A + +  K
Sbjct: 89  KQREVQAQADAIVATAKEDAEAAAAQAKVDLEASIARRLATAEDQLASAQAAAIKEVKDK 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               ++    ++IS K+     +++    I  +++
Sbjct: 149 AVTVAIAAAADVISSKLGKAELNALNADAIKEVKA 183


>gi|115526764|ref|YP_783675.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
 gi|122294477|sp|Q07H89|ATPF_RHOP5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|115520711|gb|ABJ08695.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
          Length = 164

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 75/154 (48%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
               V +   I +V+ VY  +   +L+ LD   D+I+ ++ EA RL+E++  +L  YK +
Sbjct: 8   AETWVAVGFAILMVVFVYFGVHRTVLNALDNRRDRIKAELDEASRLKEEAAKLLADYKAR 67

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  E E   II +AK  A+ +A E    +E   A   K  E KI   + +A   + A  
Sbjct: 68  AASAEREAEAIIASAKDEAERIAAEAKAKLEDFVARRTKTAEGKIAMAEAQAIADVRAAA 127

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A+ +V     I+SQ +   V   +  K I+ ++S
Sbjct: 128 ANAAVAAASSILSQSVKGSVADELIGKGIAEVRS 161


>gi|188582608|ref|YP_001926053.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           populi BJ001]
 gi|226741513|sp|B1ZJN2|ATPF_METPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|179346106|gb|ACB81518.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           populi BJ001]
          Length = 162

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 44/161 (27%), Positives = 82/161 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F V ++ + FLVIV  +   S++ S LD+ A ++R ++ EARRLRE++  +L  
Sbjct: 1   MLLTAEFWVAVAFVAFLVIVWRVGGFSMMTSGLDSRAKRVRHELDEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + ++ E E   I+  A+  A+ +A EG   +    A   K  E KI   + +A   +
Sbjct: 61  YKRRRTEAEREAEAIVAGAREDAERIAAEGHARLNDFVARRTKAAEAKIAQAEAQASAQV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  AD +V++   ++ +++       +   ++  ++S  Q
Sbjct: 121 RAAAADAAVKVSETLLRERLQGGAAQDLVRASLGDVKSRLQ 161


>gi|149201372|ref|ZP_01878347.1| H+-transporting two-sector ATPase, B/B' subunit [Roseovarius sp.
           TM1035]
 gi|149145705|gb|EDM33731.1| H+-transporting two-sector ATPase, B/B' subunit [Roseovarius sp.
           TM1035]
          Length = 186

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 86/155 (55%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+  ++Y+++P++L   LD  A  I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTNFVVLLAFLLFVGFLIYVKVPTLLGKKLDERAANIKGELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+  AK  A   AEE  + I+   A  ++  E++I   +  A R +  +
Sbjct: 89  KQKDVQAQADRIVAQAKEEANAAAEEAKEEIKASIARRMQAAEEQIASAEARAIRDVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V   R++I+++M     +++ +  I+ +++
Sbjct: 149 AVVVAVAAARDVIAKQMTAADGNALIDAAIADVEA 183


>gi|163852587|ref|YP_001640630.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           extorquens PA1]
 gi|226741515|sp|A9VYW7|ATPF_METEP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|163664192|gb|ABY31559.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           extorquens PA1]
          Length = 162

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 44/161 (27%), Positives = 83/161 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F V ++ + FLVIV  +   S++ + LD+ A ++R+++ EARRLRE++  +L  
Sbjct: 1   MLLTAEFWVAVAFVAFLVIVWRVGGFSMMTNGLDSRAKRVRNELDEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + ++ E E   II  A+  A+ +A EG   +    A   K  E KI   + +A   +
Sbjct: 61  YKRRRTEAEREAEAIISGAREDAERIAAEGHARLNDFVARRTKSAEAKIAQAEAQASAQV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  AD +V++   ++ +++       +   ++  ++S  Q
Sbjct: 121 RAAAADAAVKVSETLLRERLQGAAAQDLLRASLGDVKSRLQ 161


>gi|310814623|ref|YP_003962587.1| ATP synthase F0, B subunit [Ketogulonicigenium vulgare Y25]
 gi|308753358|gb|ADO41287.1| ATP synthase F0, B subunit [Ketogulonicigenium vulgare Y25]
          Length = 188

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 87/155 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ ++++ ++P++++  LDA A+ IR  + EAR LR+++  +L  Y++
Sbjct: 31  NTDFVVLLAFLLFIGVLIWAKVPALIVRVLDARAETIRAQLAEARALRDEAAALLASYEQ 90

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+  A+  A+  AE+   +IE   A  L   E +I      A + +  +
Sbjct: 91  KQKEVQEQAARIVEVARREAEAAAEKARADIETSVARRLSAAEDQIASAHKAAIKDVRDR 150

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  ++   R++I+ +M+    + + +  I ++ +
Sbjct: 151 AASVAIAAARDVIAGQMDATKGNKLIDDAIKTVDA 185


>gi|240139922|ref|YP_002964399.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens AM1]
 gi|254562346|ref|YP_003069441.1| F0F1 ATP synthase subunit b [Methylobacterium extorquens DM4]
 gi|240009896|gb|ACS41122.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens AM1]
 gi|254269624|emb|CAX25595.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens DM4]
          Length = 162

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 44/161 (27%), Positives = 83/161 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F V ++ + FLVIV  +   S++ + LD+ A ++R+++ EARRLRE++  +L  
Sbjct: 1   MLLTAEFWVAVAFVAFLVIVWRVGGFSMMTNGLDSRAKRVRNELDEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + ++ E E   II  A+  A+ +A EG   +    A   K  E KI   + +A   +
Sbjct: 61  YKRRRTEAEREAEAIIAGAREDAERIAAEGHARLNDFVARRTKSAEAKIAQAEAQASAQV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  AD +V++   ++ +++       +   ++  ++S  Q
Sbjct: 121 RAAAADAAVKVSETLLRERLQGAAAQDLLRASLGDVKSRLQ 161


>gi|218531428|ref|YP_002422244.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           chloromethanicum CM4]
 gi|218523731|gb|ACK84316.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           chloromethanicum CM4]
          Length = 162

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 44/161 (27%), Positives = 83/161 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F V ++ + FLVIV  +   S++ + LD+ A ++R+++ EARRLRE++  +L  
Sbjct: 1   MLLTAEFWVAVAFVAFLVIVWRVGGFSMMTNGLDSRAKRVRNELDEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + ++ E E   II  A+  A+ +A EG   +    A   K  E KI   + +A   +
Sbjct: 61  YKRRRTEAEREAEAIIAGAREDAERIAAEGHARLNDFVARRTKSAEAKIAQAEAQASAQV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  AD +V++   ++ +++       +   ++  ++S  Q
Sbjct: 121 RAAAADAAVKVSVTLLRERLQGAAAQDLLRASLGDVKSRLQ 161


>gi|92115897|ref|YP_575626.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           hamburgensis X14]
 gi|122418843|sp|Q1QRI1|ATPF_NITHX RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91798791|gb|ABE61166.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           hamburgensis X14]
          Length = 161

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 81/158 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +    V ++ +I + +  Y+ +   +L+ LD  + +I+ ++ +ARRL++++  +L  
Sbjct: 1   MFAEPETWVAIAFVILMGVFAYVGVHRTVLTTLDRRSARIKGELDDARRLKDEAAKLLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ +H+  E E ++II +AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 61  YRARHASAEREAQDIIASAKAEAERIAAEAKVKMEDFVARRTKSAEGKIASAEAQAIADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  AD +V     I+SQ +   V   +    ++ +++
Sbjct: 121 RAAAADAAVAAAAAILSQSVKGQVADDLLANGVNEVRA 158


>gi|330991389|ref|ZP_08315340.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
 gi|329761408|gb|EGG77901.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
          Length = 164

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 75/159 (47%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D  F   ++ ++F V+     +   L+S LD  A++IR ++ EA RLR ++E +L  
Sbjct: 1   MFHDPRFWSAVAFVLFFVLFGR-SLWKPLVSALDGRAERIRAELDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                     E RE++  +   A  +A +  ++ E  +A   +  + +I   +  A R +
Sbjct: 60  ATRDREAALAEARELVEHSLREAANIAAQARKDAEDAAARREQMAKDRIASAERSALREV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
                D +++  RE ++ K+  D +  I +++I  + + 
Sbjct: 120 RETAVDIAIQATRETLAAKLQADDDGKIVDRSIGDLSAA 158


>gi|39933920|ref|NP_946196.1| H+-transporting two-sector ATPase subunit B/B' [Rhodopseudomonas
           palustris CGA009]
 gi|192289339|ref|YP_001989944.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|81698371|sp|Q6NBI5|ATPF_RHOPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694454|sp|B3QF34|ATPF_RHOPT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|39647767|emb|CAE26287.1| putative Fo ATP synthase B chain [Rhodopseudomonas palustris
           CGA009]
 gi|192283088|gb|ACE99468.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 163

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/154 (24%), Positives = 77/154 (50%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +    V ++ +I L +  YL +   +L  LD   D+I+ ++ EAR+L++++  +L  Y+ 
Sbjct: 6   EAETWVAIAFVILLGVFAYLGVHRTVLQALDKRRDRIKAELDEARKLKDEAAKLLADYRA 65

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + +  E E + I+ +AK  A+ +A E    +E   A   K  E KI   + +A   + A 
Sbjct: 66  RRASAEREAQAIVDSAKADAERIAAEAKAKLEDFVARRTKTAESKIALAEAQALADVRAA 125

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A+ +V     I+S+ +  ++   +  K I  ++
Sbjct: 126 AAEAAVAAASRILSESVKGNLADELLSKGIQEVR 159


>gi|85706759|ref|ZP_01037851.1| ATP synthase F0, B subunit [Roseovarius sp. 217]
 gi|85668817|gb|EAQ23686.1| ATP synthase F0, B subunit [Roseovarius sp. 217]
          Length = 186

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+  ++Y+++PS++   LD  A  I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTNFVVLLAFLLFVGFLIYVKVPSLVGKKLDERAVSIKAELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+  AK  A   AEE    I+   A  ++  E++I   +  A R +  +
Sbjct: 89  KQKEVQAQADRIVAHAKDEANAAAEEAKDEIKASIARRMQAAEEQIASAEARAIRDVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V   R++I+++M     +++ +  I+ + +
Sbjct: 149 AVVVAVAAARDVIAKQMTAADGNALIDAAIADVDA 183


>gi|158425887|ref|YP_001527179.1| putative Fo ATP synthase B chain [Azorhizobium caulinodans ORS 571]
 gi|226741324|sp|A8HT73|ATPF_AZOC5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158332776|dbj|BAF90261.1| putative Fo ATP synthase B chain [Azorhizobium caulinodans ORS 571]
          Length = 164

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/154 (25%), Positives = 75/154 (48%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
               V ++  +F+ I++Y  +   L   LDA   +I  ++ EARRL+E+++ ++ +YK K
Sbjct: 7   AELWVAVAFFVFVGILLYNGVHKALAKALDARGARIAAELDEARRLKEEAQKLVAEYKRK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E E   I+ AAK  A+ LA E    +E+  +   +  E KI   + +A   + A  
Sbjct: 67  QREAEAEAEAIVTAAKAEAERLAAETKAKLEEFVSRRTRMAEDKIAQAEHQALADVKAFA 126

Query: 125 ADFSVEIVREIISQKMNDDV-NSSIFEKTISSIQ 157
           AD +V+    I++  +        +  + I  ++
Sbjct: 127 ADAAVQAAERILAASVPGTATGDRLLGQAIQDVR 160


>gi|84515978|ref|ZP_01003339.1| FoF1 ATP synthase, subunit B [Loktanella vestfoldensis SKA53]
 gi|84510420|gb|EAQ06876.1| FoF1 ATP synthase, subunit B [Loktanella vestfoldensis SKA53]
          Length = 185

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 83/155 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P+++   LD  A  IR ++ EA+ LRE++  +L  Y+ 
Sbjct: 28  NTDFVVLVAFLIFIGILLYYKVPALVADMLDKRAVNIRAELDEAKALREEAMALLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+ +AK  A   A    + I +  +  ++  E++I   +  A + +  +
Sbjct: 88  KQKDVQVQADRIVASAKQEANDAAVAAKEEIAKSISRRMQAAEEQIASAQAAAIKDVRDQ 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V   +++++ +MN     ++ +++I+ +  
Sbjct: 148 AVIVAVAAAKDVLAGQMNAKSAGALIDESIAVVAD 182


>gi|86751672|ref|YP_488168.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris HaA2]
 gi|123003608|sp|Q2IRA3|ATPF_RHOP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86574700|gb|ABD09257.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris HaA2]
          Length = 163

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 77/158 (48%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  +    V ++ +I + I  YL +   +L  LD   D+I+ ++ EAR+L++++  +L  
Sbjct: 3   IFAEAETWVAIAFVILMGIFAYLGVHRTVLKALDNRRDRIKAELDEARKLKDEAAKLLAD 62

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ + ++ E E   I+ +AK  A+ +A E    +E       K  E KI   + +A   +
Sbjct: 63  YRARRAQAEREAEAIVASAKADAERIAAESKAKLEDFVVRRTKTAESKIALAEAQALADV 122

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  A+ +V     ++SQ +   V   +  K I  ++S
Sbjct: 123 RAAAAEAAVSAAAIVLSQSVKGQVADDLLGKGIQEVRS 160


>gi|15888061|ref|NP_353742.1| F0F1 ATP synthase subunit B [Agrobacterium tumefaciens str. C58]
 gi|226694431|sp|A9CK01|ATPF_AGRT5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15155685|gb|AAK86527.1| ATP synthase B chain [Agrobacterium tumefaciens str. C58]
          Length = 161

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 87/158 (55%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD +F   + L++F V++ YL++P +L   LD  A  I+D++ EA+RLRE+++++L +
Sbjct: 1   MAFDASFFALVGLVLFFVLIAYLKVPGMLSKSLDERAQNIQDELAEAKRLREEAQHLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  + E E   I+ AA+  A  L EE  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKEAEAEAAGIVAAAEREAAALTEEAKQKTEEFVARRTALSEQKIKQAEEDAIGAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A   D ++    +++++K      + +F  TI  ++S
Sbjct: 121 RAAAVDIAIAASEKLLAEKTTAAAKAKLFAATIGEVKS 158


>gi|182677733|ref|YP_001831879.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|226694366|sp|B2IGK8|ATPF1_BEII9 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|182633616|gb|ACB94390.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 161

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 83/161 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M F+E F V +  +IF+ I++Y  + + L + LD  AD+IR+D+  A RLRE++  +L  
Sbjct: 1   MEFNEEFYVALGFVIFVAILLYYGVHNKLNAALDKRADRIREDLAHAVRLREEAAALLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           ++++ ++ E E   ++  A+  A+++A+E  + + +      +  E KI   + +A   +
Sbjct: 61  FEKRKAEAEAEAEALVAQARTEAEMIAKEAHERLAEFVQRRTQQAENKIANAEAQAMAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  AD + +    +++          + ++ I  +++   
Sbjct: 121 KAIAADAATKAAEILLTDAAKGAYGQKLIDQGIDGLKAAAH 161


>gi|316932387|ref|YP_004107369.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris DX-1]
 gi|315600101|gb|ADU42636.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 163

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 78/157 (49%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  +    V +S +I L +  YL +   +L  LD   D+I+ ++ EAR+L++++  +L  
Sbjct: 3   IFAEAETWVAISFVILLGVFAYLGVHRTVLQALDKRRDRIKAELDEARKLKDEAAKLLAD 62

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ + +  E E + I+ +AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 63  YRARRASAEREAQAIVESAKADAERIAAEAKAKLEDFVARRTKSAESKIALAEAQALADV 122

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A  A+ +V     I+S+ +  ++   +  K I  ++
Sbjct: 123 RAAAAEAAVAAASRILSESVKGNLADELLTKGIQEVR 159


>gi|91975307|ref|YP_567966.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB5]
 gi|123749362|sp|Q13CX4|ATPF_RHOPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91681763|gb|ABE38065.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB5]
          Length = 163

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/158 (25%), Positives = 77/158 (48%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  +    V ++ +I + +  YL +   +L  LD    +I+ ++ EAR+L++++  +L  
Sbjct: 3   IFAEAETWVAVAFVILMALFAYLGVHRTVLQALDNRRARIKAELDEARKLKDEAAKLLAD 62

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ + ++ E E   II +AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 63  YRARRAQAEREAEAIISSAKADAERIAAESKAKLEDFVARRTKTAESKIALAEAQAVADV 122

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  A+ +V     I+SQ +   V   +  K I  ++S
Sbjct: 123 RAAAAEAAVSAAATILSQSVKGQVADDLLGKGIQEVRS 160


>gi|260428790|ref|ZP_05782767.1| ATP synthase B chain [Citreicella sp. SE45]
 gi|260419413|gb|EEX12666.1| ATP synthase B chain [Citreicella sp. SE45]
          Length = 187

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/141 (25%), Positives = 75/141 (53%)

Query: 18  VIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIIL 77
            I+VY ++P +L   LD  A+ IRD++ EAR LRE+++ +L  Y+ K  +V  +   I+ 
Sbjct: 44  AILVYFKVPPVLGKLLDKRAEGIRDELDEARALREEAQTLLASYERKQKEVAAQAELIVA 103

Query: 78  AAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIIS 137
            A+  A+  A +   +++   A  L   E +I   +  A + +  + A+ +V   R +I+
Sbjct: 104 NARKEAEAAAVQAQADLKASIARRLAAAEDQIASAEASAVKEVRDRAAEIAVAAARTVIA 163

Query: 138 QKMNDDVNSSIFEKTISSIQS 158
           Q+ +      + +++I+ + +
Sbjct: 164 QQTSAADRDRMIDESIAEVGA 184


>gi|322385219|ref|ZP_08058866.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
 gi|321270843|gb|EFX53756.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
          Length = 164

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S L+  + KI DDI  A   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKFAWGNITSILEERSKKITDDIDGAESARKKAEELAQKRENELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   II  AK  A+        +  + +        Q+I   K EA   +   +AD
Sbjct: 72  GSRQEATTIIEHAKETAEKNKAGILADAAEEAGRLKAKANQEIAQSKAEALNSIKDDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++   +S + ++ I  +   
Sbjct: 132 LTVSLASKILSQQLDTKAHSELIDRYIDKLGDA 164


>gi|144898768|emb|CAM75632.1| ATP synthase B chain precursor [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 176

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 76/155 (49%), Gaps = 1/155 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           + D  F V ++  + +  + +  +   L + LDA A KI+  + EA RLRE+++ +L  Y
Sbjct: 18  YADAAFWVGVAFFL-VAGLAFKPVFRALGAGLDARAAKIKARLDEAARLREEAQEMLATY 76

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K     +E  EII  AK  A+ LA++  ++++            +I   +  A R + 
Sbjct: 77  QRKQRDAMKEAEEIIAHAKAEAERLAQQAAKDLDASLKRREAQAMDRIAQAEAAALREVQ 136

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
               + ++   R++++  ++ D  + + +K I+ +
Sbjct: 137 NVAVEVAINAARDVLASSISADQAAKLVDKAIAEL 171


>gi|332361636|gb|EGJ39440.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1056]
 gi|332363074|gb|EGJ40861.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK355]
          Length = 164

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAESARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|325688345|gb|EGD30364.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK72]
          Length = 164

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + ++  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREDAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|83594573|ref|YP_428325.1| H+-transporting two-sector ATPase, subunit B/B' [Rhodospirillum
           rubrum ATCC 11170]
 gi|114626|sp|P15013|ATPF_RHORU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|123525687|sp|Q2RPA7|ATPF_RHORT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46374|emb|CAA31249.1| ATPase F-0-subunit b (AA 1 - 182) [Rhodospirillum rubrum]
 gi|152602|gb|AAA26458.1| ATP synthase F-0 sector, b subunit [Rhodospirillum rubrum]
 gi|83577487|gb|ABC24038.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 182

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 71/156 (45%), Gaps = 1/156 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  D  F V ++ ++ +   VY++  + +L  LD     ++  + EAR+LR+ ++ +L +
Sbjct: 23  LFADPAFWVSIAFLMVVG-FVYIKAKNKILGALDGRGAAVKAKLDEARKLRDDAQALLAE 81

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ +     +E  EII  AK  A  L  +   ++E       +    +I   + +A   +
Sbjct: 82  YQRRQRDAMKEADEIIRHAKDEAARLRAKAEADLEASIRRREQQAVDRIAQAEAQALAQV 141

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +  D +V   R +++  +     + + +  I+ +
Sbjct: 142 RNEAVDVAVSAARSLMAGSLAKADQNRLIDAAIADL 177


>gi|332362652|gb|EGJ40450.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK49]
          Length = 164

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 70/154 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREESL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   EE   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSREEAATIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVALASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|327468904|gb|EGF14376.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK330]
          Length = 164

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|307294417|ref|ZP_07574261.1| H+transporting two-sector ATPase B/B' subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306880568|gb|EFN11785.1| H+transporting two-sector ATPase B/B' subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 208

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 70/155 (45%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I+V  ++P ++   LD    +I+  + EA +LR ++E +  +Y+
Sbjct: 51  MDATAWVSLAMAVFILILVIKKVPGLIGGALDGRIAQIKTQLEEASKLRAEAEALKAEYE 110

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K +    E   +  +A+H A  L E+   N   + +   K  E KI   +  A   +  
Sbjct: 111 AKLTAAAGEADAMRKSAEHEAATLLEDAKTNAAALVSRRQKMAEDKIGAAERSAIADIRT 170

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K    +      +I+Q  +   +  + +  I  + 
Sbjct: 171 KAVRAATSAAASLIAQGHDAKADKLLVDDAIKGLG 205


>gi|75674434|ref|YP_316855.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|123614286|sp|Q3SW38|ATPF_NITWN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|74419304|gb|ABA03503.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           winogradskyi Nb-255]
          Length = 161

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 82/158 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +    V ++ ++ + +  Y+ +   +LS LD  + +I++++ +ARRL++++  +L  
Sbjct: 1   MLAEPETWVAIAFLLLMGVFAYVGVHRTVLSALDRRSARIKNELDDARRLKDEAAKLLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK +H+  E E ++II +A+  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 61  YKARHASAEREAQDIIASARAEAERIAAEAKAKMEDFVARRTKSAEGKIASAEAQAIADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  AD +V     I+S  +   +   +  + +S ++S
Sbjct: 121 RAAAADAAVAAASSILSNSVKGQLADELLVQGVSEVRS 158


>gi|324995407|gb|EGC27319.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK678]
          Length = 164

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 68/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|125717632|ref|YP_001034765.1| F0F1 ATP synthase subunit B [Streptococcus sanguinis SK36]
 gi|226696182|sp|A3CM10|ATPF_STRSV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125497549|gb|ABN44215.1| Proton-translocating ATPase, F0 sector, subunit b, putative
           [Streptococcus sanguinis SK36]
 gi|332365950|gb|EGJ43706.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1059]
          Length = 164

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + ++  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREDAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|327458649|gb|EGF04997.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1057]
          Length = 164

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI +DI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISEDIDGAEAARQKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ D  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKDAQSELIDRYIKQLGDA 164


>gi|323352618|ref|ZP_08087588.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
 gi|322121654|gb|EFX93400.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
          Length = 164

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 68/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + ++  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREDAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|325690060|gb|EGD32064.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK115]
 gi|328945467|gb|EGG39618.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1087]
          Length = 164

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|315221772|ref|ZP_07863686.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
 gi|315189158|gb|EFU22859.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
          Length = 164

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L++++       + S  +  A KI DDI  A   R+K+E++  + + + +
Sbjct: 12  FILVAGSFLLLIVLIKKFAWDNITSTFEQRAKKISDDIDGAESARQKAEDLAQKRETELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   II  AK  A+        +    +    +   Q+I   K EA   +   +AD
Sbjct: 72  GSRQEATTIIENAKETAEKNKAGILADAADEAGRLKEKANQEIAQTKAEAMNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+ QK++ + +  + ++ I  +   
Sbjct: 132 LTVNLASKILGQKLDQEAHKELIDRYIDKLGDA 164


>gi|325693993|gb|EGD35911.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK150]
          Length = 164

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVALASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|306825333|ref|ZP_07458674.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432465|gb|EFM35440.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 165

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I LV++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 12  NFILIAGSFILLVVLVKKYAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKREDEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E + II  AK  A+    +     +  +    +   Q+I   K EA + +  ++A
Sbjct: 72  AGSRSEAKTIIENAKETAEKSKSDILAEAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 DLTVSLAGKIISQNLDSHAHKELIDQYIDQLGEA 165


>gi|114705287|ref|ZP_01438195.1| F0F1 ATP synthase subunit B' [Fulvimarina pelagi HTCC2506]
 gi|114540072|gb|EAU43192.1| F0F1 ATP synthase subunit B' [Fulvimarina pelagi HTCC2506]
          Length = 156

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 64/121 (52%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   ++L++F  +V Y++    +   LD  + +IR ++ EAR L+E+++  L +Y+
Sbjct: 1   MDNSFWTLIALLVFFGVVFYVKGFRRINQSLDERSKRIRTELEEARELKEEAKQQLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  + E+E ++II AAK  A+ +  E  +  ++         E +I   + +A++ +  
Sbjct: 61  RRRREAEQEAQDIIEAAKREAQQMLAETAKKNKEFVERRTAMAEDQIAQAEADARKDIRT 120

Query: 123 K 123
            
Sbjct: 121 T 121


>gi|85713869|ref|ZP_01044858.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698995|gb|EAQ36863.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter sp.
           Nb-311A]
          Length = 161

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/158 (25%), Positives = 80/158 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +    V ++ +I + +  Y+ +   +LS LD  + +I+ ++ +ARRL++ +  +L  
Sbjct: 1   MFAEPETWVAIAFLILMGVFAYVGVHRTVLSALDRRSARIKGELDDARRLKDDAAKLLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK +H+  E E ++II +AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 61  YKARHASAEREAQDIIASAKAEAERIAAEAKAKMEDFVARRTKSAEGKIASAEAQAIADV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  AD +V     I+S+ +   +   +    +S +++
Sbjct: 121 RAAAADAAVAAASSILSKSVKGQLADELLANGVSEVRA 158


>gi|327473285|gb|EGF18705.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK408]
          Length = 164

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 68/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E +  + +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEALAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   EE   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSREEAATIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|319939419|ref|ZP_08013779.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
 gi|319811405|gb|EFW07700.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
          Length = 164

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L++++       + S  +  A KI DDI  A   R+K+E++  + + + +
Sbjct: 12  FILVAGSFLLLIVLIKKFAWDNITSTFEQRAKKISDDIDSAESARQKAEDLAQKRETELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   II  AK  A+        +    +    +   Q+I   K EA   +   +AD
Sbjct: 72  GSRQEATTIIENAKETAEKNKAGILADAADEAGRLKEKANQEIAQTKAEAMNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+ QK++ + +  + ++ I  +   
Sbjct: 132 LTVNLASKILGQKLDQEAHKELIDRYIDKLGDA 164


>gi|288957578|ref|YP_003447919.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
 gi|288909886|dbj|BAI71375.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
          Length = 159

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F V ++ +IF   +V+ +  + + + LD  A++IR ++ EA RL + ++ +L  Y+ +
Sbjct: 4   PEFWVAIAFVIF-AALVWKKASAAIGTLLDGRAERIRGELDEAERLHKDAQALLNGYQSR 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  ++E   ++  A+  A  L  +   ++E            +I   +  A   +    
Sbjct: 63  LADAQKEAEAVMAHAREEAARLRTQAATDLEASLKRREAQAMDRIAQAEAAALAEVRNLT 122

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D ++   + +++  +       + E++I  +  
Sbjct: 123 VDVAIGASQRVLAGGLPAAQADKLIEQSIGELPK 156


>gi|319947326|ref|ZP_08021559.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
 gi|319746568|gb|EFV98828.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S LDA A+KI +DI EA   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKFAWGNITSILDARAEKITNDIDEAEAARKKAEELATKREAELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  AK  A+           Q +    +  + +I   K EA   +   +AD
Sbjct: 72  GSRQEATTILETAKETAEKNKAHILSEANQEALRLKEKAQLEISQNKEEAMNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +++SQ+++ + +  + ++ ++ +   
Sbjct: 132 LTVNLAGKLLSQQLDSEGHRQLIDRYLNELGDA 164


>gi|4100653|gb|AAD00914.1| proton-translocating ATPase b subunit [Streptococcus sanguinis]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        +  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|35436116|gb|AAO45674.1| AtpB [Streptococcus viridans]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 71/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|322387997|ref|ZP_08061604.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
 gi|321141270|gb|EFX36768.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
          Length = 164

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S LD  A+KI  DI  A   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKYAWGNITSVLDERAEKISSDIDGAEEARKKAEELASKREAELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +     +  +    +   Q+I   K EA + +   +AD
Sbjct: 72  GSRTEAKTIIENAKETAEKSKADILAEAKLEAGRLKEKANQEIAQNKAEALQSVKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGQAHKELIDQYIDQLGEA 164


>gi|293365285|ref|ZP_06612002.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307703825|ref|ZP_07640766.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
 gi|291316735|gb|EFE57171.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307622660|gb|EFO01656.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
          Length = 164

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 73/154 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +IIS+ ++   +  + ++ I  +   
Sbjct: 131 DLTVSLAGKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|322392089|ref|ZP_08065551.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
 gi|321144989|gb|EFX40388.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
          Length = 164

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKFAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+    +     +  +        Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIDNAKDTAEKSKADILAEAKLEAGRLKDKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +IIS+ ++   +  + ++ I  +   
Sbjct: 131 DLTVSLAGKIISKNLDGHAHKELIDQYIDQLGEA 164


>gi|324990544|gb|EGC22480.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK353]
          Length = 164

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 67/154 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        +  + +        Q+I   K E    +  ++A
Sbjct: 71  AGSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAETMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|306829404|ref|ZP_07462594.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315613054|ref|ZP_07887965.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|322374420|ref|ZP_08048934.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
 gi|304428490|gb|EFM31580.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315315164|gb|EFU63205.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|321279920|gb|EFX56959.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
          Length = 164

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 73/154 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IIS+ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAGKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|407170|emb|CAA81449.1| Adenosine Triphosphatase [Streptococcus pneumoniae]
 gi|1589420|prf||2211259C F0F1 ATPase:SUBUNIT=b
          Length = 164

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 71/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEQSKANILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +IIS+ ++   +  + ++ I  +   
Sbjct: 131 DLTVSLAGKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|289168152|ref|YP_003446421.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307705151|ref|ZP_07642026.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|322376879|ref|ZP_08051372.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
 gi|288907719|emb|CBJ22556.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307621290|gb|EFO00352.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|321282686|gb|EFX59693.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
          Length = 164

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 71/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|162146972|ref|YP_001601433.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544036|ref|YP_002276265.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|226741476|sp|A9HDM4|ATPF_GLUDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|161785549|emb|CAP55120.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531713|gb|ACI51650.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 164

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 76/159 (47%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F   ++ ++F V+    ++ + L + LD+ AD+IR D+ EA RLR ++E +L  
Sbjct: 1   MLHEPRFWSAVAFVLFFVLFG-KKLWTPLAAALDSRADRIRADLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +      E R ++  +   A  +A+E  +  E ++    +    +I   +  A R +
Sbjct: 60  ATRERETAMVEARALVEHSLIEAARIADEARREAEAVATRREQMARDRIAASERSAVREV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
                D +++  R++++  +    + +I ++ I+ + S 
Sbjct: 120 RQVAIDVAIQATRDVLATALPAGADHAIVDRAIADLPSA 158


>gi|324993290|gb|EGC25210.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK405]
          Length = 164

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 68/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  
Sbjct: 11  NFILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDSAEAARKKAEDLAQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        +  + +        Q+I   K E    +  ++A
Sbjct: 71  AGSRAEAVAIVETAKETAEKNKAGILADAVEEAGRLKAKANQEIAQNKAETMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|307706800|ref|ZP_07643605.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
 gi|307617885|gb|EFN97047.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
          Length = 164

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 71/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEILAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  A+  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENARETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|170744960|ref|YP_001773615.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium sp.
           4-46]
 gi|226741511|sp|B0ULY4|ATPF_METS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|168199234|gb|ACA21181.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium sp.
           4-46]
          Length = 161

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 77/156 (49%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +  F V ++ +IF  IV        +++ LD   +++R ++ EARRLRE++  +L  Y+
Sbjct: 2   LEPEFWVAVAFVIFCGIVWKAGGFDQIINGLDRRGERVRRELEEARRLREEAAALLADYQ 61

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + E E   I+  A+  A+  A EG   +    A   K  E KI   + +A   + A
Sbjct: 62  KRRGEAEREAEAIVANARAEAERAAAEGHARLNDFVARRTKAAEAKIAQAEAQAAAEVRA 121

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             A+ +V +   I+ +K+  D    +  +++  I++
Sbjct: 122 AAAEAAVRVSETILREKVTGDAAQDLIRRSLGDIRT 157


>gi|307701975|ref|ZP_07638983.1| ATP synthase F0, B subunit [Streptococcus mitis NCTC 12261]
 gi|35436127|gb|AAO45680.1| AtpB [Streptococcus mitis]
 gi|307616620|gb|EFN95809.1| ATP synthase F0, B subunit [Streptococcus mitis NCTC 12261]
          Length = 164

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLVKKYAWSNLTSIFEQRAEKIAADIDGAEQARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|307709039|ref|ZP_07645499.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
 gi|307620375|gb|EFN99491.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
          Length = 164

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S + S  +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITSIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|331266493|ref|YP_004326123.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
 gi|326683165|emb|CBZ00783.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
          Length = 164

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 74/154 (48%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IIS+ ++   +  + ++ I  ++  
Sbjct: 131 DLTISLAGKIISKNLDSHAHKELIDQYIDQLEEA 164


>gi|270292839|ref|ZP_06199050.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
 gi|270278818|gb|EFA24664.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
          Length = 164

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 73/154 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRNEAKTIIENAKGTAEKSKADILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IIS+ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAAKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|323136717|ref|ZP_08071798.1| H+transporting two-sector ATPase B/B' subunit [Methylocystis sp.
           ATCC 49242]
 gi|322398034|gb|EFY00555.1| H+transporting two-sector ATPase B/B' subunit [Methylocystis sp.
           ATCC 49242]
          Length = 158

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 87/161 (54%), Gaps = 3/161 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFD  F V +   IF+++++++   S   + +DA  ++I+ ++ EA RLR ++E +L  
Sbjct: 1   MHFDAEFYVAVGFTIFVLVLLWVGAHSKFAALIDARINRIKSELAEAERLRSEAETLLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +++K +  E E + I+  AK  A+++A EG + +++  A  +K +EQKI   + +A   +
Sbjct: 61  FEKKRADAEAEAKAIVAQAKEEAELIAAEGRRRLDEFMARSVKQVEQKISQAEAQAAAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  AD +V I   ++ + +            I+ ++S   
Sbjct: 121 RAAAADAAVRIAEGVLRKGV---AGKDFVAAGINEVKSLAH 158


>gi|325696687|gb|EGD38575.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK160]
 gi|327461561|gb|EGF07892.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1]
 gi|327489415|gb|EGF21208.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1058]
          Length = 164

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 68/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + L++++       + S  +  A KI DDI  A   R+K+E +  + + + 
Sbjct: 11  NFILVAGSFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARQKAEELAQKREHEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E   I+  AK  A+        N  + +        Q+I   K EA   +  ++A
Sbjct: 71  AGSRAEAVTIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 131 DLTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|35436123|gb|AAO45677.1| AtpB [Streptococcus viridans]
          Length = 164

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 71/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IIS+ ++   +  + ++ I  +   
Sbjct: 131 DLTISLAGKIISENLDGHAHKELIDQYIDQLGEA 164


>gi|209966768|ref|YP_002299683.1| ATP synthase F0, B subunit [Rhodospirillum centenum SW]
 gi|226694398|sp|B6IX47|ATPF2_RHOCS RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|209960234|gb|ACJ00871.1| ATP synthase F0, B subunit [Rhodospirillum centenum SW]
          Length = 160

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 73/158 (46%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + TF V ++ ++F+   V+    + +   LD  A++IR++I +A++LRE ++  L Q
Sbjct: 1   MLQNPTFWVLVAFVLFVAA-VWRIAANTIGKALDDRAERIREEIEQAQKLREDAQAALAQ 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K     +E   II AA+  A  +      ++E           +KI   + +A + +
Sbjct: 60  YQRKQRDALKEAENIIAAAREEADRIRRRAATDLEASLRRREAQAMEKIAQAEAQAVQQV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
                D +V     I+ Q M+   +  +    I+ + +
Sbjct: 120 RDLAVDIAVAATERILVQNMDATRDEVLVGNAIAELPA 157


>gi|15901359|ref|NP_345963.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae TIGR4]
 gi|15903407|ref|NP_358957.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae R6]
 gi|111657414|ref|ZP_01408167.1| hypothetical protein SpneT_02001384 [Streptococcus pneumoniae
           TIGR4]
 gi|116515510|ref|YP_816801.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae D39]
 gi|148984855|ref|ZP_01818108.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|148992604|ref|ZP_01822272.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|148997428|ref|ZP_01825033.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|149003274|ref|ZP_01828170.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|149007582|ref|ZP_01831217.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|149011746|ref|ZP_01832942.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|149021779|ref|ZP_01835786.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168489672|ref|ZP_02713871.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|168492581|ref|ZP_02716724.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|168493413|ref|ZP_02717556.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|168575967|ref|ZP_02721882.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|169832491|ref|YP_001694918.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Hungary19A-6]
 gi|182684466|ref|YP_001836213.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|194396745|ref|YP_002038142.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae G54]
 gi|221232224|ref|YP_002511377.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225854956|ref|YP_002736468.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae JJA]
 gi|225857137|ref|YP_002738648.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae P1031]
 gi|225859269|ref|YP_002740779.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae 70585]
 gi|225861345|ref|YP_002742854.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649217|ref|ZP_04523469.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974]
 gi|237821826|ref|ZP_04597671.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974M2]
 gi|298255868|ref|ZP_06979454.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298503247|ref|YP_003725187.1| H (+)-transporting two-sector ATPase subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|303254151|ref|ZP_07340264.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|303260734|ref|ZP_07346694.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|303263061|ref|ZP_07348993.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|303264465|ref|ZP_07350385.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|303267443|ref|ZP_07353297.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|303269782|ref|ZP_07355531.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|307068156|ref|YP_003877122.1| F0F1-type ATP synthase subunit b [Streptococcus pneumoniae AP200]
 gi|307127716|ref|YP_003879747.1| ATP synthase F0 subunit B [Streptococcus pneumoniae 670-6B]
 gi|61219603|sp|P0A2Z2|ATPF_STRPN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219605|sp|P0A2Z3|ATPF_STRR6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122277701|sp|Q04HT5|ATPF_STRP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695882|sp|B5E675|ATPF_STRP4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696178|sp|B1ICT3|ATPF_STRPI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696179|sp|B2IQX4|ATPF_STRPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15004343|gb|AAK77043.1|AF334396_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|15004348|gb|AAK77047.1|AF334397_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|18253301|gb|AAL66413.1|AF368465_3 proton-translocating ATPase b subunit [Streptococcus pneumoniae]
 gi|14973002|gb|AAK75603.1| ATP synthase F0, B subunit [Streptococcus pneumoniae TIGR4]
 gi|15459012|gb|AAL00168.1| Proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           pneumoniae R6]
 gi|116076086|gb|ABJ53806.1| ATP synthase F0, B subunit [Streptococcus pneumoniae D39]
 gi|147756483|gb|EDK63524.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|147758734|gb|EDK65731.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|147760941|gb|EDK67911.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|147764177|gb|EDK71109.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|147922877|gb|EDK73993.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|147928621|gb|EDK79635.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|147930015|gb|EDK81002.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168994993|gb|ACA35605.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Hungary19A-6]
 gi|182629800|gb|ACB90748.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|183571984|gb|EDT92512.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|183573266|gb|EDT93794.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|183576602|gb|EDT97130.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|183578325|gb|EDT98853.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|194356412|gb|ACF54860.1| ATP synthase F0, B chain [Streptococcus pneumoniae G54]
 gi|220674685|emb|CAR69258.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225721806|gb|ACO17660.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 70585]
 gi|225722344|gb|ACO18197.1| ATP synthase F0, B subunit [Streptococcus pneumoniae JJA]
 gi|225726166|gb|ACO22018.1| ATP synthase F0, B subunit [Streptococcus pneumoniae P1031]
 gi|225726416|gb|ACO22267.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238842|gb|ADI69973.1| H (+)-transporting two-sector ATPase, subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301794524|emb|CBW36966.1| ATP synthase B chain [Streptococcus pneumoniae INV104]
 gi|301800348|emb|CBW32977.1| ATP synthase B chain [Streptococcus pneumoniae OXC141]
 gi|301802232|emb|CBW34982.1| ATP synthase B chain [Streptococcus pneumoniae INV200]
 gi|302598877|gb|EFL65910.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|302635824|gb|EFL66327.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|302638137|gb|EFL68612.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|302640675|gb|EFL71073.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|302643034|gb|EFL73327.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|302646277|gb|EFL76504.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|306409693|gb|ADM85120.1| F0F1-type ATP synthase, subunit b [Streptococcus pneumoniae AP200]
 gi|306484778|gb|ADM91647.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 670-6B]
 gi|327389695|gb|EGE88040.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA04375]
 gi|332072303|gb|EGI82786.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17570]
 gi|332074263|gb|EGI84740.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17545]
 gi|332199556|gb|EGJ13631.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41317]
 gi|332200951|gb|EGJ15022.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47901]
          Length = 164

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 73/154 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K+EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IISQ ++   + ++ ++ I  +   
Sbjct: 131 DLTISLAGKIISQNLDSHAHKALIDQYIDQLGEA 164


>gi|148988556|ref|ZP_01819989.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|168483879|ref|ZP_02708831.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|168487555|ref|ZP_02712063.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|147925757|gb|EDK76832.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|172042717|gb|EDT50763.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|183569630|gb|EDT90158.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|332073846|gb|EGI84324.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41301]
 gi|332200072|gb|EGJ14145.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47368]
          Length = 164

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 73/154 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFVLITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K+EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D ++ +  +IISQ ++   + ++ ++ I  +   
Sbjct: 131 DLTISLAGKIISQNLDSHAHKALIDQYIDQLGEA 164


>gi|322389183|ref|ZP_08062744.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
 gi|321144088|gb|EFX39505.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
          Length = 164

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + L+ ++     + +   L+A A KI DDI  A   R+K+E +  + +E+ 
Sbjct: 11  NFILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREEEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E   I+  AK  A+    +      Q +    +  +Q+I + K EA   +   +A
Sbjct: 71  AGSRKEAASIVENAKETAEKNKSQILSEATQEAVRLKEKAQQEIAHNKEEALNSIKGDVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +++SQ+++ +    + ++ +  +   
Sbjct: 131 DLTVNLAGKLLSQQLDAEGQRQLIDRYLDELGEA 164


>gi|157150236|ref|YP_001450825.1| F0F1 ATP synthase subunit B [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283124|ref|ZP_06060891.1| predicted protein [Streptococcus sp. 2_1_36FAA]
 gi|226695878|sp|A8AYG5|ATPF_STRGC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157075030|gb|ABV09713.1| ATP synthase F0, B subunit [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262261376|gb|EEY80075.1| predicted protein [Streptococcus sp. 2_1_36FAA]
          Length = 164

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 67/154 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + L++++       + S  +  A KI DDI  A   R+ +E +  + +E  
Sbjct: 11  NFILVAGSFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARKNAEVLEQKREEAL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   EE   I+  AK  A+        +  +  +   +   Q+I   K EA R +   +A
Sbjct: 71  AGSREEAATIVETAKETAEKNKASILADTTEEVSRLKQKANQEIAQSKAEALRSIKGDVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D S+++  +II Q ++ +  S + +  I  +   
Sbjct: 131 DLSIDLASKIIGQTLDKEAQSQLIDSYIDKLGDA 164


>gi|89053261|ref|YP_508712.1| F0F1 ATP synthase subunit B [Jannaschia sp. CCS1]
 gi|122999622|sp|Q28UC5|ATPF_JANSC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|88862810|gb|ABD53687.1| ATP synthase F0 subcomplex B subunit [Jannaschia sp. CCS1]
          Length = 190

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 69/134 (51%)

Query: 24  RIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRA 83
            +P +L   LDA A+ IR ++ EAR LRE+++ +L  Y+ K  +VEE++  I+  A+  A
Sbjct: 53  GVPKMLGGMLDARAEGIRSELDEARALREEAQTLLASYERKAREVEEQSARIVTEARANA 112

Query: 84  KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDD 143
           +  AE+   +IE+     L   E +I   + +A R +    A  +V    E+I+   +  
Sbjct: 113 ETAAEQAKADIERSITRRLAAAEDQIASAEAKASRAVRDTAASVAVAAAAEVIAGGTSAT 172

Query: 144 VNSSIFEKTISSIQ 157
             + + ++ I  + 
Sbjct: 173 DQNKMIDEAIEEVG 186


>gi|296876804|ref|ZP_06900852.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|312867266|ref|ZP_07727476.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
 gi|296432306|gb|EFH18105.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|311097395|gb|EFQ55629.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
          Length = 164

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     + L+ ++     + +   L+A A KI DDI  A   R+K+E +  + +E+ 
Sbjct: 11  NFILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREEEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E   I+  AK  A+    +      Q +    +  +Q+I + K EA   +   +A
Sbjct: 71  AGSRKEAASIVENAKETAEKNKSQILSEATQEAVRLKEKAQQEIAHNKEEALNSIKGDVA 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +++SQ+++ +    + ++ +  +   
Sbjct: 131 DLTVNLASKLLSQQLDAEGQRQLIDRYLDELGEA 164


>gi|58039570|ref|YP_191534.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
 gi|81352058|sp|Q5FRW8|ATPF1_GLUOX RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|58001984|gb|AAW60878.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
          Length = 166

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 82/161 (50%), Gaps = 3/161 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D  F   ++ ++F VI    ++   +   LDA AD +R D+ EA RLR ++E +L  
Sbjct: 1   MFHDPRFWTALAFVLFFVIFGR-KLWVAITGHLDARADSVRHDLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  K   ET+ ++  ++  A  LAE   ++ E  +A Y K  + +IH  +  A R +
Sbjct: 60  ANREREKTLAETQAMLARSEAEAAGLAERARKDAEAAAARYEKMAQDRIHAAERSAIREI 119

Query: 121 YAKIADFSVEIVREIISQKMND--DVNSSIFEKTISSIQSC 159
             + A  +V   R+++S ++ +  D+ +++ +K I S+   
Sbjct: 120 QDRAAQIAVAAARDVVSTRLTESPDIAATLIDKGIDSLPEA 160


>gi|298294370|ref|YP_003696309.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
 gi|296930881|gb|ADH91690.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
          Length = 160

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/154 (27%), Positives = 84/154 (54%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +T  V ++ +IF+ IV      S + + LDA  ++IR ++ EAR+L+E+++ ++ +YK +
Sbjct: 4   DTLWVAVAFVIFMAIVARAGAFSGIAAKLDARGERIRHELEEARKLKEEAQKLVAEYKRR 63

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E   II  AK  A+ LA E    +E + A   K  EQKI   + +A   + A  
Sbjct: 64  QREAEDEAEAIITTAKAEAERLAAETKAKLEDMIARRTKMAEQKIAQAEAQALADVKAAA 123

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD +V+    +++ ++  +    +  + +S ++S
Sbjct: 124 ADAAVKAAETLLAAQVVGETAERVLGEAVSEVKS 157


>gi|163794978|ref|ZP_02188947.1| ATP synthase B chain precursor [alpha proteobacterium BAL199]
 gi|159179797|gb|EDP64324.1| ATP synthase B chain precursor [alpha proteobacterium BAL199]
          Length = 160

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 80/161 (49%), Gaps = 1/161 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S ++F+  + +  +     + LDA A++IR+ + EA+ LRE+++     
Sbjct: 1   MFADPTFWVAVSFVLFVA-LTFKMVWQKATTALDARANEIRNRLEEAQNLREEAQAAKAN 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+       +E   I+  A+  AK + EEG + +E   A   +   +KI   + +A + +
Sbjct: 60  YQRLQRDALKEAEAILAHAREEAKRMREEGEKKLEASLARREQLAIEKIAAAEAKALQDV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
             ++ D ++   R++I   ++  V S +    ++ I +  Q
Sbjct: 120 REQMVDLAMAATRQLIESNIDGAVRSRLVADAVAEIPTRLQ 160


>gi|296446969|ref|ZP_06888904.1| H+transporting two-sector ATPase B/B' subunit [Methylosinus
           trichosporium OB3b]
 gi|296255536|gb|EFH02628.1| H+transporting two-sector ATPase B/B' subunit [Methylosinus
           trichosporium OB3b]
          Length = 158

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/161 (26%), Positives = 82/161 (50%), Gaps = 3/161 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFD    V +   IF+V++ ++     L + LD+   +I+ ++ EA RLR ++E +L  
Sbjct: 1   MHFDAELFVAVGFGIFVVVLFWVGAHRKLGAALDSRVHRIKSELAEAERLRSEAEILLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           +++K  + E E + I+  AK  A++LA+E  Q +E+      K +E KI   + +A   +
Sbjct: 61  FEKKREEAEAEAKAIVAQAKSEAEMLAQEARQRLEEFVTRRTKQVEDKIAQAEAQAAAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A  A+ +V+I   ++ + +     +      I  ++S   
Sbjct: 121 RASAAEAAVKIAEAVLRKGV---AGTDFVSAGIKDVKSLAH 158


>gi|220927391|ref|YP_002502693.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951998|gb|ACL62390.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 162

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 80/158 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F V ++ ++F  IV       ++L+ LD   +++R ++ EARRLRE++  +L  
Sbjct: 1   MLMEPEFWVAVAFVVFCGIVWKAGGFDLILNGLDHRGERVRRELEEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+++ ++ E E   I+  A+  A+  A EG   + +      K  E KI   + +A   +
Sbjct: 61  YQKRRAEAEREAEAIVANAREEAERAAAEGHARLNEFVTRRTKAAEAKIAQAEAQAAAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  A+ +V I   I+ +K+  +    +  +++  I++
Sbjct: 121 RAAAAEAAVRISETILREKVGGEAGQDLIRRSLGDIRT 158


>gi|114763715|ref|ZP_01443109.1| ATP synthase F0, B subunit [Pelagibaca bermudensis HTCC2601]
 gi|114543716|gb|EAU46729.1| ATP synthase F0, B subunit [Roseovarius sp. HTCC2601]
          Length = 187

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 74/138 (53%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK 80
            Y ++P +L   LD  AD IR+++ EAR LRE+++ +L  Y+ +  +V  +   I+  AK
Sbjct: 47  AYFKVPGMLGKLLDKRADDIRNELDEARALREEAQTLLASYERQQHEVSAQADRIVANAK 106

Query: 81  HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM 140
             A+I AE+  ++++   A  L   +  I   +  A + +  + A  +V   R++I+Q+ 
Sbjct: 107 EEAEIAAEQARKDLKDAIARRLAAADDHIASAQASAVKEVRDRAAIVAVAAARDVIAQQT 166

Query: 141 NDDVNSSIFEKTISSIQS 158
           +      + +++I+ + +
Sbjct: 167 SAADKDRMIDESIAEVGA 184


>gi|114570754|ref|YP_757434.1| H+-transporting two-sector ATPase subunit B/B' [Maricaulis maris
           MCS10]
 gi|122314859|sp|Q0AK30|ATPF2_MARMM RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|114341216|gb|ABI66496.1| H+-transporting two-sector ATPase, B/B' subunit [Maricaulis maris
           MCS10]
          Length = 183

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/154 (24%), Positives = 76/154 (49%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D +F  F++L+IF  +++++ +   +   LD  A+ I +++ EA+RLRE +  +L  Y+ 
Sbjct: 26  DPSFYAFLALLIFFGLLLHMGVHRTIAKTLDDRAEGISNELDEAKRLREDAAEMLASYQR 85

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  + E E   II  AK  AK L  E  + + +         EQ+I   + +A   + A 
Sbjct: 86  KQREAEAEAEAIIAQAKTEAKSLKAEARKEMTERLERRTAMAEQRIAQAEAQAAADVKAA 145

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A+ + +   EI+  ++     + + +  I ++ 
Sbjct: 146 AAELAAQAAEEILKTQLKKSDLNKLVDADIKTVG 179


>gi|294012247|ref|YP_003545707.1| F0F1-type ATP synthase subunit b [Sphingobium japonicum UT26S]
 gi|292675577|dbj|BAI97095.1| F0F1-type ATP synthase subunit b [Sphingobium japonicum UT26S]
          Length = 208

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 71/155 (45%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I++  ++P ++   LD    +I+  + EA +LR ++E +  +Y+
Sbjct: 51  MDATAWVSLAMAVFILILLVKKVPGLIGGALDGRIAQIKAQLEEASKLRAEAEALKAEYE 110

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            + +    E   +  +A+H A  L E+   N   + +   K  E KI   +  A   + A
Sbjct: 111 ARLAAAAGEAETMRKSAEHEAATLLEDAKANAAALVSRRQKMAEDKIGAAERAAIADIRA 170

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K    +      +I+Q  +   +  + +  I  + 
Sbjct: 171 KAVRAATGAAASLIAQGHDAKADKLLVDDAIKGLG 205


>gi|296114242|ref|ZP_06832897.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979318|gb|EFG86041.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 164

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 73/159 (45%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F   ++  +F ++    ++   L + LDA A KIR D+ EA RLR ++E +L  
Sbjct: 1   MLHEPRFWSAVAFFLFFILFG-AKLWRPLSAALDARAQKIRADLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +      E R ++  +   A  +A +  Q+ + I+    +    +I   +  A R +
Sbjct: 60  ATREREAALAEARAMVEHSLQEAARIAAQASQDADDIARRREQMARDRIAAAERGAIREV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
                D +++  RE ++  ++ D + S+ +  IS + S 
Sbjct: 120 REAAIDIAMQATRETLAASLSADGDKSLIDSAISGLPSA 158


>gi|329113592|ref|ZP_08242372.1| ATP synthase subunit b [Acetobacter pomorum DM001]
 gi|326697114|gb|EGE48775.1| ATP synthase subunit b [Acetobacter pomorum DM001]
          Length = 167

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 72/151 (47%), Gaps = 1/151 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  +  F V +S ++F V+V   +I   + + LD+ A++IR+++ EA RLR ++E +L  
Sbjct: 4   IFHEAGFWVAVSFVLFFVLVG-KKIWGPIATILDSRANRIREELDEAARLRREAEQMLED 62

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 +   E +  +  A  +A  +A++     E     + +    +I  ++  A + +
Sbjct: 63  ATRDREQALAEAKSYVEQAHQQAAEMAQKARAEAEAAVQRHEQMARDRIAAVERAAIKEV 122

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEK 151
                D +V+    +I Q +++   + + ++
Sbjct: 123 RQLAIDVAVQAANGVIPQTLDEQKAAGLVDQ 153


>gi|89069738|ref|ZP_01157074.1| ATP synthase F0, B subunit [Oceanicola granulosus HTCC2516]
 gi|89044684|gb|EAR50795.1| ATP synthase F0, B subunit [Oceanicola granulosus HTCC2516]
          Length = 185

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 72/135 (53%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK 80
           VY ++P +L   LD  AD IR +I EA+ LRE+++++L  Y+ K   V+ +   I+  A+
Sbjct: 45  VYFKVPGMLTKMLDERADSIRKEIDEAKALREEAQSLLASYERKQKDVQAQADRIVENAR 104

Query: 81  HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM 140
             A   AE+   +I+   A  L   E++I   +  A R +  +    +V   RE+I+++M
Sbjct: 105 AEANSAAEQAKTDIQTSVARRLAAAEEQIASAQDAAVRDVRNQAVTVAVAAAREVIAKQM 164

Query: 141 NDDVNSSIFEKTISS 155
           +    + + ++ IS 
Sbjct: 165 SAADANRLIDEGISE 179


>gi|85374331|ref|YP_458393.1| AtpF, ATP synthase F0, B subunit [Erythrobacter litoralis HTCC2594]
 gi|122544275|sp|Q2N9P5|ATPF_ERYLH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|84787414|gb|ABC63596.1| AtpF, ATP synthase F0, B subunit [Erythrobacter litoralis HTCC2594]
          Length = 187

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 78/149 (52%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +++++ + I+++ ++PS++   LD    +I+  + EA+ LR ++E +  +Y  K + 
Sbjct: 39  WVSVAMLVLIAIMLWKKVPSLVTGGLDNKIAEIKAQLDEAKALRAEAEKLRDEYTAKIAN 98

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            E++   ++  A+H A  + E+   + + +     K  E KI   + +A   + A  A  
Sbjct: 99  AEKDAEAMMENARHEADAILEKAEADSKALVERRKKMAEDKISAAERDAVDEVRATAAAA 158

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
           +    R++I++K + + +  + ++ I+ +
Sbjct: 159 AAAASRKLIAEKHDAEADRKLADEVIAEL 187


>gi|315498136|ref|YP_004086940.1| h+transporting two-sector atpase b/b' subunit [Asticcacaulis
           excentricus CB 48]
 gi|315416148|gb|ADU12789.1| H+transporting two-sector ATPase B/B' subunit [Asticcacaulis
           excentricus CB 48]
          Length = 168

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 78/155 (50%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +    V + L  F ++++ +++P  L + L    + +R ++ EA R+R++++ +L Q K 
Sbjct: 11  NPETWVRIGLGCFFLLLIVMKVPQKLWASLADTGNAVRAELDEAVRIRQEAQALLNQIKA 70

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  + E++ +E+I  A+  A+ L  E    +++         E KI   + +A   + A 
Sbjct: 71  ERLEAEQKAKELIAFAEEEAQRLTAEARTKLDESIKRRQAQAEAKIAQAEAKAASEVKAA 130

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            AD + +I   I+  +++   +  + ++ I+ + +
Sbjct: 131 AADLATQIAENILISRVDGLKSDPLIDQAITQVAT 165


>gi|258543512|ref|YP_003188945.1| ATP synthase F0 subunit beta' [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634590|dbj|BAI00566.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01]
 gi|256637646|dbj|BAI03615.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-03]
 gi|256640700|dbj|BAI06662.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-07]
 gi|256643755|dbj|BAI09710.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-22]
 gi|256646810|dbj|BAI12758.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-26]
 gi|256649863|dbj|BAI15804.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-32]
 gi|256652853|dbj|BAI18787.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655907|dbj|BAI21834.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-12]
          Length = 167

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 72/151 (47%), Gaps = 1/151 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  +  F V +S ++F V+V   +I   + + LD+ A++IR+++ EA RLR ++E +L  
Sbjct: 4   IFHEAGFWVAVSFVLFFVLVG-KKIWLPITTVLDSRANRIREELDEAARLRREAEQMLED 62

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 +   E +  +  A  +A  +A++     E     + +    +I  ++  A + +
Sbjct: 63  ATRDREQALAEAKSYVEQAHQQAAEMAQKARAEAEAAVQRHEQMARDRIAAVERAAVKEV 122

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEK 151
                D +V+    +I Q +++   + + ++
Sbjct: 123 RQLAIDVAVQAANGVIPQTLDEQKAAGLVDQ 153


>gi|296127000|ref|YP_003634252.1| ATP synthase F0, B subunit [Brachyspira murdochii DSM 12563]
 gi|296018816|gb|ADG72053.1| ATP synthase F0, B subunit [Brachyspira murdochii DSM 12563]
          Length = 166

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/158 (23%), Positives = 77/158 (48%), Gaps = 2/158 (1%)

Query: 5   ETFLVFMSLIIFLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  ++  + I FL+++  L      I+L  L+A ADKI++D+ EA + RE ++  L  Y+
Sbjct: 7   DPGIIIWTWITFLLVLAILGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYR 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+    + E   II  A+  A  + ++   N  + + +    +  +I   K EA   +  
Sbjct: 67  EQIDNAKAEASSIIENARVEANRIRDKIINNAREEAEVNKNKIMSEIDRSKEEAMNSVKK 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +  D +V +   I+ + +N + N +I  + I++    +
Sbjct: 127 QALDIAVVMAETILKRNINKEDNQAIINEFINNAGKEN 164


>gi|300870197|ref|YP_003785068.1| putative F0F1 type ATP synthase subunit B [Brachyspira pilosicoli
           95/1000]
 gi|300687896|gb|ADK30567.1| putative F0F1 type ATP synthase subunit B [Brachyspira pilosicoli
           95/1000]
          Length = 166

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 78/158 (49%), Gaps = 2/158 (1%)

Query: 5   ETFLVFMSLIIFLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  ++  + I FL+++  L      I+L  L+A ADKI++D+ EA + RE ++  L  Y+
Sbjct: 7   DPGIIIWTWITFLLVLAVLGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYR 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+    + E   II  A+  A  + ++   N  + +  +   +  +I   K EA   +  
Sbjct: 67  EQIDNAKAEASSIIENARIEANRVRDKIIGNAREEAESHRNKILSEIDRAKDEAMGNVRK 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +  D +V +   I+ + ++ + N ++  + +++ +  +
Sbjct: 127 QAVDIAVVMAETILKRNIDKNDNQALINEFVNNFEKDN 164


>gi|254293423|ref|YP_003059446.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
 gi|254041954|gb|ACT58749.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
          Length = 204

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/159 (27%), Positives = 82/159 (51%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
             D TF   ++++IFL I+V+ +IP+ +   LD  A KI+D++  AR LREK++  L + 
Sbjct: 44  FADPTFWATIAVLIFLGILVWKKIPATIAKSLDDRAQKIQDELDNARLLREKAQAALAEA 103

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           +   ++ EE+ + I+ AAK  AK  A+    ++++      K  E++I   + EA + + 
Sbjct: 104 ERSQAQAEEDAKAIVAAAKAEAKAFADTSRADLKERMERREKMAEERIARAEAEATQAVR 163

Query: 122 AKIADFSVEIVREIISQK-MNDDVNSSIFEKTISSIQSC 159
              A+ +      I+ +         S+FE ++  I+  
Sbjct: 164 NTAAEAASAAAAGILRESTAKGPAKKSLFETSLEDIKKS 202


>gi|225621094|ref|YP_002722352.1| putative F0F1-type ATP synthase subunit B [Brachyspira
           hyodysenteriae WA1]
 gi|225215914|gb|ACN84648.1| putative F0F1-type ATP synthase, subunit B [Brachyspira
           hyodysenteriae WA1]
          Length = 167

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 76/153 (49%), Gaps = 2/153 (1%)

Query: 5   ETFLVFMSLIIFLVIVVYLRI--PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  ++  + I FL+++  L      I+L  L+A ADKI++D+ EA + RE ++  L  Y+
Sbjct: 7   DPGIIIWTWITFLLVLAILGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYR 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+    + E   II  A+  A  + ++   N  + + L    +  +I   K EA   +  
Sbjct: 67  EQIDNAKVEASAIIENARVEANRIRDKIINNAREEAELNKNKIMSEIDRSKEEAMNSVKK 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           +  D +V +   I+ + +N + N ++  + I++
Sbjct: 127 QALDIAVVMAETILKRNINKEDNQALINEFINN 159


>gi|294084673|ref|YP_003551431.1| ATP synthase subunit B [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664246|gb|ADE39347.1| ATP synthase B chain precursor [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 162

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 76/156 (48%), Gaps = 1/156 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           E+  V ++ + F VI+V+ +  ++L + LD  ++KIR D+ EA+ LR+ +   L  Y+  
Sbjct: 8   ESVWVAVAFV-FFVILVWKKAGAVLATMLDERSEKIRADLAEAKDLRDAAITELHNYQRL 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
           H +  +E + II  A+  A+ + E   +N              KI   +      L  + 
Sbjct: 67  HREAADEAKVIIKNAEITAERIRETAEKNANDAVKRREAQATAKIKAAEANMVAELRERA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           A  +V    EIIS K++ D + ++ ++  + I+  +
Sbjct: 127 ASLAVATATEIISSKLDKDASLAMIDEAAAEIEKLN 162


>gi|94498731|ref|ZP_01305281.1| AtpF, ATP synthase F0, B subunit [Sphingomonas sp. SKA58]
 gi|94421830|gb|EAT06881.1| AtpF, ATP synthase F0, B subunit [Sphingomonas sp. SKA58]
          Length = 204

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 80/158 (50%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I++  ++P+++   LD    +I++ + EA RLR ++E +  +Y+
Sbjct: 47  MDATAWVSLAMAVFILILLVKKVPALIGGALDGRIAQIKEQLAEASRLRAEAEALKGEYE 106

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K +    E   +  AA+H A++L ++   + E++     K  E KI   +  A   + A
Sbjct: 107 AKLAAAAGEADAMRKAAEHEAEVLVDDARTHAEELVVRRQKMAEDKIGAAERAAIAAIRA 166

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           K  + +      +I+Q  +   + ++ +  I  + + +
Sbjct: 167 KAVNAATSAAATLIAQGHDAQSDKALVDSAIGKLGTIN 204


>gi|23004074|ref|ZP_00047593.1| hypothetical protein Magn03000159 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 159

 Score = 98.1 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 57/108 (52%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F V ++ + FL IV  +   S++ S LD  A ++R ++ EARRLRE++  +L  
Sbjct: 1   MLLTAEFWVAVAFVAFLAIVWRVGGFSMMTSGLDNRAKRVRHELDEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQK 108
           YK + ++ E+E   I+  A+  A+ LA EG   + +  A   K    +
Sbjct: 61  YKRRRAEAEKEAEAIVANAREDAERLAAEGHARLNEFVARRTKARRSQ 108


>gi|170747145|ref|YP_001753405.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|226741512|sp|B1LWM0|ATPF_METRJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|170653667|gb|ACB22722.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 162

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 41/158 (25%), Positives = 84/158 (53%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F V ++  IF+ I   +   S +   LD  A+++R ++ EA+RLRE++  +L  
Sbjct: 1   MLLEAEFWVAVAFFIFMGIAWKVGAFSAMTKGLDGRANRVRHELDEAKRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + ++ E+E   I+  A+  A+  AEEG + ++   A   K  E KI   + +A+  +
Sbjct: 61  YKRRRAEAEKEAEAIVAGAREEAERAAEEGHRKLDDFLARRTKAAETKIAQAEAQAEAQV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  A+ +V++   I+ ++M  D   ++   ++  +++
Sbjct: 121 RAAAAEAAVKVSETILRERMQGDAAQNLIRASLGEVRT 158


>gi|312865390|ref|ZP_07725618.1| ATP synthase F0, B subunit [Streptococcus downei F0415]
 gi|311099501|gb|EFQ57717.1| ATP synthase F0, B subunit [Streptococcus downei F0415]
          Length = 165

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 65/152 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++    ++ L  ++       +    +  A+KI  DI +A   R++++ +  + +E+ + 
Sbjct: 14  IITTGSVLVLYWLIRTFAWKQITGIFEERANKINQDIDDAENARQEAQELAQKRQEQLNS 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            +++  +II  AK      + +         +   +   Q I   K EA   +   +AD 
Sbjct: 74  AKDDAAKIIDDAKETGNAQSAKILAETRDEVSRLKEKANQDIAQNKAEALSSVKGDVADL 133

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V +  +++++ ++    S + ++ +  +   
Sbjct: 134 TVLLAEKVMTKNLDKAAQSELIDQYLDQLGDA 165


>gi|222152830|ref|YP_002562007.1| F0F1 ATP synthase subunit B [Streptococcus uberis 0140J]
 gi|222113643|emb|CAR41544.1| ATP synthase B chain [Streptococcus uberis 0140J]
          Length = 164

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 66/154 (42%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    I+ L +++       +   L+  + KI  DI  A + R ++EN+  + + + 
Sbjct: 11  NFILVTGSILVLYLLLKKFAWGSISGILEERSAKISSDIDRAEQARIEAENLAQKRENEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +  ++E  +II  AK   ++  E+         +   +  +  I   K +A   + +++ 
Sbjct: 71  AGAKQEASKIITDAKELGQVKGEQLVAEASAEVSRLKEKAQADIQQSKTDAISSVKSEMT 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +++   ++    S + +  +  +   
Sbjct: 131 DLTVLLAEKVLGANLDKSAQSQLIDSYLDDLGEA 164


>gi|302383815|ref|YP_003819638.1| H+transporting two-sector ATPase B/B' subunit [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194443|gb|ADL02015.1| H+transporting two-sector ATPase B/B' subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 171

 Score = 95.0 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 80/155 (51%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +    V + L+IF+ I +   +P ++   LDA A KI+ ++ EA+RLR ++E +L Q + 
Sbjct: 14  EPELWVGIGLLIFIGIAIAAGVPKLVAGTLDARAAKIQSELDEAQRLRAEAEALLAQIRA 73

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + +  + + RE++ AA+  A+I+  E    +E+  A      E++I   + +A   + A 
Sbjct: 74  EKAAADIQAREMLAAAEADARIMEAEAKVRLEETLARRQALAERRIASAEAQASAEVKAA 133

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            AD + +    I++ ++    +  + +  I  I +
Sbjct: 134 AADVAAQAAETILAARLQTQKSDPLLDAAIGQIGT 168


>gi|313890505|ref|ZP_07824133.1| ATP synthase F0, B subunit [Streptococcus pseudoporcinus SPIN
           20026]
 gi|313121022|gb|EFR44133.1| ATP synthase F0, B subunit [Streptococcus pseudoporcinus SPIN
           20026]
          Length = 164

 Score = 94.6 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    ++ L +++       +   L+  + KI  DI +A   R+ +E +  + + + 
Sbjct: 11  NFILVSGSVLVLYLLIKKFAWGAISGILEERSVKIATDIDKAEEARQSAETLAQKRELEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +  ++E  +II  AK   ++  ++   +  + ++      E  I   K +A   + A+++
Sbjct: 71  AGAKQEASQIITDAKELGQVKGDQIIADASEEASRLKTQAEADIQQSKTDAIASVKAEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D SV +  +I+   ++ D  S + +  +  +   
Sbjct: 131 DLSVLLAEKIMGSNLDKDAQSQLIDTYLDELGDA 164


>gi|85708924|ref|ZP_01039990.1| ATP synthase subunit B [Erythrobacter sp. NAP1]
 gi|85690458|gb|EAQ30461.1| ATP synthase subunit B [Erythrobacter sp. NAP1]
          Length = 173

 Score = 94.6 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 75/149 (50%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +++ + + +V++ ++P  +   LD    +I+  + EA+ LR ++E +  +Y  K + 
Sbjct: 25  WVSLAMAVLIGVVLWKKVPGAIAGGLDNKIAEIKQQLDEAKSLRAEAEKLRDEYAAKIAG 84

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            E++   ++  A+  A  +  +   + E + A   +  E KI   + EA   + A  A+ 
Sbjct: 85  AEKDAEAMMEGAQREADAILAKAEADSEAMVARRQRMAEDKIAAAEREAVDGVRASAANA 144

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
           +    R II+ K + + + ++ ++ I+S+
Sbjct: 145 AAAASRTIIASKHDAEADKALADEVIASL 173


>gi|103486568|ref|YP_616129.1| H+-transporting two-sector ATPase, B/B' subunit [Sphingopyxis
           alaskensis RB2256]
 gi|122985120|sp|Q1GU76|ATPF_SPHAL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|98976645|gb|ABF52796.1| H+-transporting two-sector ATPase, B/B' subunit [Sphingopyxis
           alaskensis RB2256]
          Length = 176

 Score = 94.6 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 74/154 (48%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++++FL I+V+  +P  + + LD    +I   + EA +LR  +E++  +Y+
Sbjct: 20  LDATVWVSIAMLVFLGILVWKGVPGAIAAMLDKRIAEISKQLGEAEQLRLDAESLKAEYE 79

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K +   +E  E+   A   A+ L  +   +   + A   +  E +I   +  A   + A
Sbjct: 80  AKLADAAKEADEMRARADAEAQALVAKAKADATALIARRKQMAEDRIAAAEANALAEVRA 139

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
                + E   ++I+ + +   + ++ ++ I+SI
Sbjct: 140 AAVKAATEAAAKLIADRHDVAADKALVDQAIASI 173


>gi|114328534|ref|YP_745691.1| ATP synthase B chain [Granulibacter bethesdensis CGDNIH1]
 gi|122326512|sp|Q0BQY4|ATPF2_GRABC RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|114316708|gb|ABI62768.1| ATP synthase B chain [Granulibacter bethesdensis CGDNIH1]
          Length = 171

 Score = 94.6 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 73/157 (46%), Gaps = 1/157 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
               F V ++ ++F V+    +I   L S LD++AD++R ++ EAR+LR ++E +L   +
Sbjct: 12  HHPVFWVAVAFVLFFVLFGR-KIWGALTSKLDSYADEVRQNLDEARKLRREAEAMLEDAR 70

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  +   E + ++ +A   A   A+    + E       K    +I   +  A   +  
Sbjct: 71  RRKEQALAEAKRLLESAHAEAARAAQALSDDAEASIRRREKMANDRIAAAEKAAVDEVRF 130

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             AD +    ++I++++     ++++ +  IS +   
Sbjct: 131 AAADIASRAAKDILAREFGPYADAALIDSAISKLPQA 167


>gi|332523942|ref|ZP_08400194.1| ATP synthase F0, B subunit [Streptococcus porcinus str. Jelinkova
           176]
 gi|332315206|gb|EGJ28191.1| ATP synthase F0, B subunit [Streptococcus porcinus str. Jelinkova
           176]
          Length = 164

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    ++ L +++       +   L+  + KI  DI +A   R+ +E +  + + + 
Sbjct: 11  NFILVSGSVLVLYLLIKKFAWGAISGILEERSAKIATDIDKAEEARQSAETLAQKRELEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +  ++E  +II  AK   ++  ++   +  + ++      E  I   K +A   + A+++
Sbjct: 71  AGAKQEANQIITDAKELGQVKGDKIIADASEEASRLKTQAEADIQQSKTDAIASVKAEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D SV +  +I+   ++ D  S + +  +  +   
Sbjct: 131 DLSVLLAEKIMGSNLDKDAQSHLIDTYLDELGDA 164


>gi|329115988|ref|ZP_08244705.1| ATP synthase F0, B subunit [Streptococcus parauberis NCFD 2020]
 gi|326906393|gb|EGE53307.1| ATP synthase F0, B subunit [Streptococcus parauberis NCFD 2020]
          Length = 164

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 70/154 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    I+ L +++       +   LD  A KI +DI +A   R  +EN+ ++ +++ 
Sbjct: 11  NFILVTGSILVLYLLLKKFAWGQISGILDERAAKISNDIDKAENARINAENLQVERQKEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + E  +II+ AK   +  + +  +     ++   +  +  I   K EA   +  +++
Sbjct: 71  DGAKSEASQIIVDAKEIGQAQSTKLIEEANDEASRLKEKADIDIERSKAEALSDVKNQMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D S+ +  +II   ++ D  S + +  ++ +   
Sbjct: 131 DLSISLAEKIIGANLDKDAQSKLIDSYLNDLGEA 164


>gi|167648335|ref|YP_001685998.1| F0F1 ATP synthase subunit B [Caulobacter sp. K31]
 gi|226741354|sp|B0T010|ATPF_CAUSK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167350765|gb|ABZ73500.1| H+transporting two-sector ATPase B/B' subunit [Caulobacter sp. K31]
          Length = 171

 Score = 93.0 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/158 (22%), Positives = 76/158 (48%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +    V + LI+F+ IV++ + P+++   LD  A KI+ D+ EA R+R ++E +L   + 
Sbjct: 14  NPELWVGVGLILFIAIVIWAKAPAMIAGKLDETAAKIQTDLDEAARIRAEAEALLATIRA 73

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  + E +   ++ AAK     +  E    +E       +  E+KI   + +A+  + A 
Sbjct: 74  EREETERQAIAMLAAAKADVAQMEIEAKAKLEDQIKRRAEMAERKIAQSEAQAQADVKAA 133

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
             D + +I  +++  ++    +  + +  I  I +  Q
Sbjct: 134 AVDLAAQIAEQVLMARLAAGGSDGLVDTAIGQIGAKLQ 171


>gi|87199340|ref|YP_496597.1| H+-transporting two-sector ATPase, B/B' subunit [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135021|gb|ABD25763.1| H+-transporting two-sector ATPase, B/B' subunit [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 184

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 72/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V +++ IFL I+V  ++P  ++  LD     IR  + EA+ LR ++E +  +
Sbjct: 27  LGLGPGAWVALAMFIFLAILVVKKVPGAIVGGLDKQIGAIRKQLDEAKVLRAEAEKLRAE 86

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y  K +  E++   ++  AK  A  +  +   +   + +   K    KI   +  A   L
Sbjct: 87  YAAKIANAEKDAAAMVEHAKSEAAAIVAKAEADAAAVISRREKMASDKIAAAERAAVDDL 146

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            AK A+ +    R++I++  +   + ++ +  I+ +
Sbjct: 147 RAKAAEAATAAARDLIAKNHSAGADKALVDGAIAGL 182


>gi|319899220|ref|YP_004159313.1| ATP synthase B chain (modular protein) [Bartonella clarridgeiae 73]
 gi|319403184|emb|CBI76743.1| ATP synthase B chain (modular protein) [Bartonella clarridgeiae 73]
          Length = 210

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 37/151 (24%), Positives = 78/151 (51%), Gaps = 2/151 (1%)

Query: 1   MHFDETF-LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M+F   F  + +S  +F + +  + +P  +   ++   D+I  D+ +A RL+++++N++ 
Sbjct: 57  MYFGSHFLWLAISFGLFYLFISRVIVPR-IGGVIETRRDRIVSDLDQAMRLKQEADNVVE 115

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
            YK+K +K   E + II    +  KI A+   + IE+     LK  E KI  ++ +A + 
Sbjct: 116 VYKQKLAKARLEAKTIIQTESNEIKIRADLQRKKIEEDLEKKLKKSEDKIKEIQNKAMQN 175

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFE 150
           +     + + EIV+++I   ++    SS  +
Sbjct: 176 VGLIAEEITFEIVKKLIDINVSRKSVSSAVK 206


>gi|322372409|ref|ZP_08046945.1| ATP synthase F0, B subunit [Streptococcus sp. C150]
 gi|321277451|gb|EFX54520.1| ATP synthase F0, B subunit [Streptococcus sp. C150]
          Length = 165

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 60/154 (38%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             ++ +  +  L  ++       +     A   KI  DI  A   R+++E++  + +++ 
Sbjct: 12  NIIITLGSVFLLYYLIRKFAWDQITGIFAAREKKIATDIDSAENARQEAESLAQKRQDEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E  +II  AK   K    +        +        Q I   ++EA   +  ++A
Sbjct: 72  AGARTEAAQIIDGAKETGKTQESKIIAEAHDEAKRLKDKANQDIAQSRVEALAGVKGEVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +++ Q ++    S + +  +  +   
Sbjct: 132 DLTVLLAEKVMKQNLDAKAQSDLIDSYLDQLGDA 165


>gi|228478369|ref|ZP_04062977.1| ATP synthase F0, B subunit [Streptococcus salivarius SK126]
 gi|312864174|ref|ZP_07724408.1| ATP synthase F0, B subunit [Streptococcus vestibularis F0396]
 gi|322517280|ref|ZP_08070157.1| ATP synthase F0 sector subunit B [Streptococcus vestibularis ATCC
           49124]
 gi|228250048|gb|EEK09318.1| ATP synthase F0, B subunit [Streptococcus salivarius SK126]
 gi|311100175|gb|EFQ58384.1| ATP synthase F0, B subunit [Streptococcus vestibularis F0396]
 gi|322124110|gb|EFX95649.1| ATP synthase F0 sector subunit B [Streptococcus vestibularis ATCC
           49124]
          Length = 165

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 61/154 (39%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             ++ +  +  L  ++       +     A   KI  DI  A   R+++E++  + +++ 
Sbjct: 12  NIIITLGSVFLLYYLIRKFAWDQITGIFAAREKKIATDIDSAENARQEAESLAQKRQDEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E  +II  AK   K    +        +    +   Q I   ++EA   +  ++A
Sbjct: 72  AGARTEAAQIIDGAKETGKTQESKIIAEAHDEAKRLKEKANQDIAQSRVEALAGVKGEVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +++ Q ++    S + +  +  +   
Sbjct: 132 DLTVLLAEKVMKQNLDAKAQSDLIDSYLDQLGDA 165


>gi|296120445|ref|YP_003628223.1| ATP synthase F0 subunit beta [Planctomyces limnophilus DSM 3776]
 gi|296012785|gb|ADG66024.1| ATP synthase F0, B subunit [Planctomyces limnophilus DSM 3776]
          Length = 238

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 69/149 (46%), Gaps = 1/149 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ + F+ ++        L + LD    +IR+DI EA   R K++ +L +++ + +K
Sbjct: 86  WSLITFVAFVFLLSKF-AWKPLAAGLDQREARIRNDIQEAESARLKAQQLLAEHEARLAK 144

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            EE  RE+I  AK  A+ +  +     E       K    +I   +  A + L+  ++  
Sbjct: 145 TEETVRELIAEAKRDAEKVRVDLTAAAEADVQTMKKRAVSEIEQARDVALQQLFDTLSTH 204

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++    I+ + +N D +  + ++ ++ +
Sbjct: 205 VMDATSRIVGRSLNSDDHQRLVQEALAEL 233


>gi|148557380|ref|YP_001264962.1| H+-transporting two-sector ATPase, B/B' subunit [Sphingomonas
           wittichii RW1]
 gi|226695870|sp|A5VEV8|ATPF_SPHWW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148502570|gb|ABQ70824.1| H+-transporting two-sector ATPase, B/B' subunit [Sphingomonas
           wittichii RW1]
          Length = 205

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 76/159 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +    T  V ++++I ++++++ ++PS++ + LD     IR ++ EA  LR  +E +  +
Sbjct: 45  LGMTATAWVSLAMVIVILLLLWKKVPSVIGASLDKKIASIRANLDEAAALRADAEKLKAE 104

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K     +E  E++  A+  A+ +  +   +   +     K  E KI   +  A   +
Sbjct: 105 YEAKAKAAAKEAEEMLAHARSEAEAIVSQARVDATALIERRGKMAEDKIAAAERGAVAEV 164

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            AK A  +      +I+++ N   + ++ +  I ++ + 
Sbjct: 165 RAKAASAAAAAAGALIAERNNAKADKALIDGAIDALGNA 203


>gi|189501405|ref|YP_001960875.1| F0F1 ATP synthase subunit B [Chlorobium phaeobacteroides BS1]
 gi|226741336|sp|B3EQ96|ATPF_CHLPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189496846|gb|ACE05394.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides BS1]
          Length = 175

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L I+        +LS L+     I++ I  A+  +E++E +L + ++  +
Sbjct: 22  FWTTVTFLIVLFIL-KKFTWGPMLSALEEREKGIKNSIDRAQSAKEEAEAVLNKNRQLLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +  +II   K     L  E  +     ++  +   + +I   K  A   L  ++AD
Sbjct: 81  QAGADADKIIREGKEYGDKLKAEITEKAHLEASRMISSAKDEIDQEKRRALTELRTEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +V+   +II   ++ +   +I +  I  +
Sbjct: 141 LAVKGAEKIIMANLDAEKQKNIVDSMIQEL 170


>gi|217979916|ref|YP_002364063.1| H+transporting two-sector ATPase B/B' subunit [Methylocella
           silvestris BL2]
 gi|217505292|gb|ACK52701.1| H+transporting two-sector ATPase B/B' subunit [Methylocella
           silvestris BL2]
          Length = 160

 Score = 89.6 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 72/157 (45%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   V    ++ + +  YL +   +   LD+  ++I+ ++ EA+RLR ++E +L  + 
Sbjct: 2   LNEETFVAFGFLLLVGLFAYLGVHKKIAGALDSRGERIKGELAEAQRLRAEAEAVLASFG 61

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + E E   ++  A   A  LA+E    + +      K  ++KI   + +A   + A
Sbjct: 62  KRLQEAEAEAAAVVAQAHAEADRLAKEAATRLTEFVERRTKQAQEKIAAAEAQATADVRA 121

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             AD + +    ++ ++        +   +I+ ++S 
Sbjct: 122 AAADAATKAAGLVLKEEAKGPFGEQLVSSSINDLKSL 158


>gi|55820563|ref|YP_139005.1| F0F1 ATP synthase subunit B [Streptococcus thermophilus LMG 18311]
 gi|55822453|ref|YP_140894.1| F0F1 ATP synthase subunit B [Streptococcus thermophilus CNRZ1066]
 gi|116627372|ref|YP_819991.1| F0F1 ATP synthase subunit B [Streptococcus thermophilus LMD-9]
 gi|81676599|sp|Q5M108|ATPF_STRT1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81676748|sp|Q5M5J5|ATPF_STRT2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122268027|sp|Q03LX7|ATPF_STRTD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|55736548|gb|AAV60190.1| H+-translocating ATPase b subunit [Streptococcus thermophilus LMG
           18311]
 gi|55738438|gb|AAV62079.1| proton-translocating ATPase, b subunit [Streptococcus thermophilus
           CNRZ1066]
 gi|116100649|gb|ABJ65795.1| F0F1-type ATP synthase, subunit b [Streptococcus thermophilus
           LMD-9]
 gi|312277885|gb|ADQ62542.1| ATP synthase subunit b [Streptococcus thermophilus ND03]
          Length = 165

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 60/154 (38%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             ++ +  +  L  ++       +     A   KI  DI  A   R+++E ++ + +E+ 
Sbjct: 12  NIIITLGSVFLLYYLIRKFAWDQITGIFVAREKKIATDIDSAENARQEAEILVQKRQEEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E  +II  AK   K    +        +    +   Q I    +EA   +  ++A
Sbjct: 72  AAARTEATQIIDEAKKTGKTKESKIIAEAYDEAKRLKEKANQDIAQSWVEALAGVKGEVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +++ Q ++    S + +  +  +   
Sbjct: 132 DLTVLLAEKVMKQNLDAKAQSDLIDSYLDQLGDA 165


>gi|329850278|ref|ZP_08265123.1| ATP synthase B chain [Asticcacaulis biprosthecum C19]
 gi|328840593|gb|EGF90164.1| ATP synthase B chain [Asticcacaulis biprosthecum C19]
          Length = 163

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 77/153 (50%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D    V ++L++F +I++  ++P  +   L      +R ++ EA R+R+++ ++L   K 
Sbjct: 6   DAETWVRIALVLFFLILIVAKVPGKVWGSLGDTGKAVRAELDEAVRIRQEATDLLNTIKA 65

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +    E++ RE+I  A+  A  L++E  + + +      +  E+KI   + +A   + A 
Sbjct: 66  QRVAAEQKARELIALAEEEAARLSKEAREKLAESIQRREELAERKIAQAEAKATADVKAA 125

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            AD + ++   I++ ++    N  + +K I  I
Sbjct: 126 AADLAAQLAESILADRIAKTTNDPLVDKAIRQI 158


>gi|290580099|ref|YP_003484491.1| FoF1 membrane-bound proton-translocating ATPase b subunit
           [Streptococcus mutans NN2025]
 gi|1773262|gb|AAD13379.1| ATPase, b subunit [Streptococcus mutans]
 gi|254996998|dbj|BAH87599.1| FoF1 membrane-bound proton-translocating ATPase b subunit
           [Streptococcus mutans NN2025]
          Length = 165

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 64/154 (41%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             L+     I L+++V     S L +      +KI  DI +A   R+ ++ +  + + + 
Sbjct: 12  NLLIVTGSFILLLLLVKKFAWSQLAAIFKTREEKIAKDIDDAENSRQNAQVLENKRQVEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ ++E  +II  AK   K    +      + +        Q I   K EA   + A +A
Sbjct: 72  NQAKDEAAQIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKAEALSSVKADVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D SV +  +I+++ ++      + +  +  +   
Sbjct: 132 DLSVLLAEKIMAKNLDKTAQGDLIDSYLDKLGDA 165


>gi|309390209|gb|ADO78089.1| ATP synthase F0, B subunit [Halanaerobium praevalens DSM 2228]
          Length = 166

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               ++  + L  ++   + + +   LD  A +I  D+ +A   R+++E +  +Y++K  
Sbjct: 9   LWQLVNFFVLL-FLLRKFLYAPIKGMLDQRAAQINGDLDDAEARRKEAEELKAKYEQKLK 67

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E +EII  A+ RA   A+E     E+ +        ++I   K EA   L   +AD
Sbjct: 68  EAHSEAQEIIDNAETRANKKAKEIINEAEEKAENLKAKKLEEIEQAKKEATAELRDSLAD 127

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +++     +I ++++ + +  +    I  +  
Sbjct: 128 YTILAANNLIQEQLDKEKHQQMIMSFIDDLDK 159


>gi|302039013|ref|YP_003799335.1| ATP synthase F0 subunit B [Candidatus Nitrospira defluvii]
 gi|300607077|emb|CBK43410.1| ATP synthase F0, subunit B [Candidatus Nitrospira defluvii]
          Length = 170

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 74/155 (47%), Gaps = 1/155 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +S  I   ++     P +L   L+    KI+D + +A R R ++E  L +Y+ K +
Sbjct: 14  FWEVLSFGILFFLLYKYAFPGLLG-MLEEREKKIKDSLDQAERHRSEAERRLKEYEAKLA 72

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              ++   ++  AK RA+ L EE  Q +   +     D  ++I   + +A + + ++  D
Sbjct: 73  TAAKDAEALLAQAKERAQRLMEENEQRMTADAERIKGDATREIETERRKAIQDIRSQTTD 132

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            ++ +  +++ + + +  +  + ++ + ++   +Q
Sbjct: 133 LAMMVAEKVVGRALTEGDHRRLADEALDALAKSYQ 167


>gi|24379921|ref|NP_721876.1| F0F1 ATP synthase subunit B [Streptococcus mutans UA159]
 gi|26006946|sp|P95785|ATPF_STRMU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24377901|gb|AAN59182.1|AE014985_6 FoF1 membrane-bound proton-translocating ATPase, b subunit
           [Streptococcus mutans UA159]
          Length = 165

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 65/154 (42%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             L+     I L+++V     S L +   A  +KI  DI +A   R+ ++ +  + + + 
Sbjct: 12  NLLIVTGSFILLLLLVKKFAWSQLAAIFKAREEKIAKDIDDAENSRQNAQVLENKRQVEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ ++E  +II  AK   K    +      + +        Q I   K EA   + A +A
Sbjct: 72  NQAKDEAAQIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKAEALSSVKADVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D SV +  +I+++ ++      + +  +  +   
Sbjct: 132 DLSVLLAEKIMAKNLDKTAQGDLIDSYLDKLGDA 165


>gi|22537022|ref|NP_687873.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae 2603V/R]
 gi|25010932|ref|NP_735327.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae NEM316]
 gi|76788233|ref|YP_329604.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae A909]
 gi|76799296|ref|ZP_00781463.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|77406457|ref|ZP_00783513.1| ATP synthase F0, B subunit [Streptococcus agalactiae H36B]
 gi|77407986|ref|ZP_00784736.1| ATP synthase F0, B subunit [Streptococcus agalactiae COH1]
 gi|77410700|ref|ZP_00787059.1| ATP synthase F0, B subunit [Streptococcus agalactiae CJB111]
 gi|77414097|ref|ZP_00790265.1| ATP synthase F0, B subunit [Streptococcus agalactiae 515]
 gi|81744393|sp|Q8E076|ATPF_STRA5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81744548|sp|Q8E5V2|ATPF_STRA3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123601926|sp|Q3K1J9|ATPF_STRA1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|22533879|gb|AAM99745.1|AE014231_3 ATP synthase F0, B subunit [Streptococcus agalactiae 2603V/R]
 gi|23095311|emb|CAD46521.1| H+-transporting ATP synthase b chain [Streptococcus agalactiae
           NEM316]
 gi|76563290|gb|ABA45874.1| ATP synthase F0, B subunit [Streptococcus agalactiae A909]
 gi|76585356|gb|EAO61947.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|77159849|gb|EAO70992.1| ATP synthase F0, B subunit [Streptococcus agalactiae 515]
 gi|77163236|gb|EAO74188.1| ATP synthase F0, B subunit [Streptococcus agalactiae CJB111]
 gi|77173444|gb|EAO76563.1| ATP synthase F0, B subunit [Streptococcus agalactiae COH1]
 gi|77174926|gb|EAO77739.1| ATP synthase F0, B subunit [Streptococcus agalactiae H36B]
          Length = 165

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 65/152 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++    ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S 
Sbjct: 14  IIVSGSVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSN 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + E  +II  AK       ++     +  +    +   Q I   K EA   +  ++AD 
Sbjct: 74  AKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADL 133

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V +  +I+   ++ +  S++ +  I  +   
Sbjct: 134 TVLLAEKIMVSNLDKEAQSNLIDSYIKKLGDA 165


>gi|76800063|ref|ZP_00781968.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|76584627|gb|EAO61436.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
          Length = 165

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 65/152 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++    ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S 
Sbjct: 14  IIVSGSVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSN 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + E  +II  AK       ++     +  +    +   Q I   K EA   +  ++AD 
Sbjct: 74  AKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADL 133

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V +  +I+   ++ +  S++ +  I  +   
Sbjct: 134 TVLLAEKIMVSNLDKEAQSNLIDSYIXKLGDA 165


>gi|16124620|ref|NP_419184.1| ATP synthase F0, B subunit [Caulobacter crescentus CB15]
 gi|221233309|ref|YP_002515745.1| F0F1 ATP synthase subunit B [Caulobacter crescentus NA1000]
 gi|81782749|sp|Q9AB66|ATPF_CAUCR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13421520|gb|AAK22352.1| ATP synthase F0, B subunit [Caulobacter crescentus CB15]
 gi|220962481|gb|ACL93837.1| ATP synthase B chain [Caulobacter crescentus NA1000]
          Length = 169

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 81/161 (50%), Gaps = 1/161 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRI-PSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
             +  F V  +L+IF  ++V L++ P  L   LD +A KI+ ++ EA++LRE+++ +L  
Sbjct: 9   FSNPEFWVLAALVIFFGLLVVLKVLPGALFGALDGYAAKIKAELDEAQQLREEAQALLAD 68

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K +    E +   ++ AAK  AK LAEE  + +E+      +  E+KI   + +A   +
Sbjct: 69  VKAQREDAERQAAAMLEAAKADAKRLAEEAKEKLEEQIKRRAEMAERKIAQAEAQAAADV 128

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            A   D + +    +++ ++      ++ +  I  + +  Q
Sbjct: 129 KAAAVDLAAQAAETVLAARLAGAKGDTLVDAAIGQMGAKLQ 169


>gi|329888297|ref|ZP_08266895.1| ATP synthase B chain [Brevundimonas diminuta ATCC 11568]
 gi|328846853|gb|EGF96415.1| ATP synthase B chain [Brevundimonas diminuta ATCC 11568]
          Length = 171

 Score = 86.9 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/154 (25%), Positives = 84/154 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +    V + L+IF+ IVV   +P ++ + LDA A KI+ ++ EA RLR ++E +L Q ++
Sbjct: 14  NPELWVAIGLLIFIAIVVMAGVPKLVATSLDAKAAKIQSELDEAARLRAEAEAMLAQIRQ 73

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + ++ E +  +++  A+  AK L  +    IE+ +A      E++I   + EA + + A 
Sbjct: 74  EKAEAEAQAADLLATAEADAKRLEADAKARIEESTARRQALAERRIAQAEAEATQEVKAA 133

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            AD + +   +I++ ++      ++ ++ I+ I 
Sbjct: 134 AADLAAKAAHQILAARIAGAKTDALIDQAIAQIG 167


>gi|319744886|gb|EFV97220.1| ATP synthase F0 sector subunit B [Streptococcus agalactiae ATCC
           13813]
          Length = 165

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 64/152 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++    ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S 
Sbjct: 14  IIVSGSVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSN 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + E  +II  AK       ++     +  +    +   Q I   K EA   +  ++AD 
Sbjct: 74  AKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADL 133

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V +  +I+   ++ +  S++    I  +   
Sbjct: 134 TVLLAEKIMVSNLDKEAQSNLINSYIKKLGDA 165


>gi|110277409|gb|ABG57236.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKDTAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|145220542|ref|YP_001131251.1| ATP synthase F0, B subunit [Prosthecochloris vibrioformis DSM 265]
 gi|226694438|sp|A4SGZ0|ATPF_PROVI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145206706|gb|ABP37749.1| ATP synthase F0 subcomplex B subunit [Chlorobium phaeovibrioides
           DSM 265]
          Length = 175

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 67/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ ++ L+I+        +L  L+     I+  I  A   +E++E IL Q KE  +
Sbjct: 22  FWTAITFVLVLLIL-KKIAWGPILGALEEREKGIQSSIDRAYGAKEEAEAILRQNKETLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K E E+  II   +  A  +  E  +     S   +   + +I   K  A  +L  ++AD
Sbjct: 81  KAEAESDRIIREGREFADKIRAEITEKAHTESQKMIGAAKDEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V    +II   ++ +V   + +  I+ + +
Sbjct: 141 LAVRGAEKIIRASLDGEVQRKVVDSMIADLST 172


>gi|116494658|ref|YP_806392.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei ATCC 334]
 gi|122263921|sp|Q03A22|ATPF_LACC3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116104808|gb|ABJ69950.1| ATP synthase F0 subcomplex B subunit [Lactobacillus casei ATCC 334]
          Length = 162

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 67/160 (41%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V  +     +   +     KI  D+  A + R+ ++ ++ +
Sbjct: 1   MTLGDTLFTLVTFLVLMLAVGKV-AWKPVSKMMADRQQKISGDLDYAEKSRKDADALVAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+    + +  +I+  AK   + L +              K+ + +I   + +A    
Sbjct: 60  RQEELQHSQADAVKIVNQAKENGEKLRQSLVDAANAEVTTMKKNAQTEIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              +AD S+ I +++I +++N D    + +  I  +   +
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRLGDAN 159


>gi|296283436|ref|ZP_06861434.1| AtpF, ATP synthase F0, B subunit [Citromicrobium bathyomarinum
           JL354]
          Length = 189

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 78/150 (52%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVI-VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            V +++++ +++ ++ L+    + + LD+    IR+++ EA+RLR ++E +  +Y  K +
Sbjct: 40  WVSVAMLLLILVAILRLKAHKSITAGLDSRIAAIREELDEAKRLRAEAETLRDEYAAKIA 99

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             E +   ++  A+  A+ + E   ++ +++     +  + KI   + EA   + AK A 
Sbjct: 100 NAESDAEAMLDNARAEAESILERAEEDSKELVERRKRMAQDKISAAEREAVAEVRAKAAA 159

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +    R +I +K++ D +  + +  I+ I
Sbjct: 160 AAAAASRSLIGEKLDADADRKLADDMIAGI 189


>gi|326387162|ref|ZP_08208772.1| AtpF, ATP synthase F0, B subunit [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208343|gb|EGD59150.1| AtpF, ATP synthase F0, B subunit [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 171

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 72/149 (48%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V  S+++ + I+++ ++PS++   LD     IR+ + EA+ LR ++E +   Y  + S 
Sbjct: 21  IVSASMLVLIAIMIWKKVPSLITGGLDKQIVAIREQLDEAKALRAEAEKMRADYAARISN 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            E++   ++  A+  A+++         ++ A   K   +KI   +  A   L  +    
Sbjct: 81  AEKDAEAMLAHARREAELIISRATSETAEVIARREKMAGEKIAAAEHAAVEDLRKRAVSA 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
           +     ++I+ +   D + ++   TI+++
Sbjct: 141 AAAAAGQLIAARHGLDADRAMINGTIANL 169


>gi|110277374|gb|ABG57208.1| AtpB [Streptococcus pseudopneumoniae]
          Length = 140

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 59/130 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++    +I
Sbjct: 131 DLTISFAGKI 140


>gi|110277379|gb|ABG57212.1| AtpB [Streptococcus pseudopneumoniae ATCC BAA-960]
          Length = 140

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKAIIENAKTTAEKSKASILVDAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|110277394|gb|ABG57224.1| AtpB [Streptococcus mitis]
 gi|110277414|gb|ABG57240.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|119358471|ref|YP_913115.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides DSM 266]
 gi|226741357|sp|A1BJW4|ATPF_CHLPD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119355820|gb|ABL66691.1| ATP synthase F0 subcomplex B subunit [Chlorobium phaeobacteroides
           DSM 266]
          Length = 175

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +S +I L+I+  L     ++S L+     I+  I  A + ++++E IL + +E  +
Sbjct: 22  FWTTVSFVIVLLILRKL-AWGPIISALEEREKGIQSSIDRAHKAKDEAEEILRKNRELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +II   K   + L     +  +  +A  +   +++I   K  A  +L  ++A+
Sbjct: 81  KADAESDKIIREGKEYGEKLRAGIAEKAQAEAAKMISMAKEEIEQEKRRALDVLRNEVAE 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V    +II   ++ D+   I +  I  + +
Sbjct: 141 LAVMGAEKIIKTSLDADMQKKIVDSMIQDLST 172


>gi|257064831|ref|YP_003144503.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
 gi|256792484|gb|ACV23154.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
          Length = 203

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 1/158 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   + ++ II  +I+     P I    L+     IR+D+  A   R +SE IL +YK
Sbjct: 45  MNEFIPMLVAFIILWIILAKFGWP-IFDGMLEKRESTIRNDLKNAEEARMESERILAEYK 103

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++ + E  +I+  AK   + +  +     +  +   ++     I   K  A   L  
Sbjct: 104 QQLAEAKAEASQIVANAKKAGEDVKADITAKAQVEADGMIEKARAAIEAEKKAAIADLQG 163

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +AD SVE+  ++I   ++DD + +I ++ +  + S +
Sbjct: 164 SVADISVEVASKVIGTDLSDDEHRAIIKRYVEEVGSFN 201


>gi|114619|sp|P26681|ATPF_ENTHR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|153569|gb|AAA26855.1| H+ ATPase [Enterococcus faecalis]
 gi|153577|gb|AAA26862.1| F1F0-ATPase beta subunit [Enterococcus faecalis]
          Length = 174

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 68/156 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     + L+ ++       +   L    DKI +D+  A + R  S  +  + +++ 
Sbjct: 17  NIIVVSGSFLILMFLLKHFAWGPISDILKKREDKIANDLDSAEKSRINSAKMEQEREQQL 76

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  +   +  ++  A      +  I   +  A   +   +A
Sbjct: 77  LASRSDAADIIKNAKESGELSRQNILKETQEEVARLKSKAQTDIMLERDTALNSVKDDVA 136

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           D S++I  +I++++++ +++ S+  + I  + S ++
Sbjct: 137 DLSLQIAAKILNKELSPEMHESLINQYIEGLGSSNE 172


>gi|110277399|gb|ABG57228.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKAIIENAKQTAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|110277384|gb|ABG57216.1| AtpB [Streptococcus mitis]
 gi|110277389|gb|ABG57220.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIATDIDSAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKAIIENAKATAEKSKASILVDAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|110277419|gb|ABG57244.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDSAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKAIIENAKASAEKSKASILVDAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|188587438|ref|YP_001918983.1| ATP synthase F0, B subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226694327|sp|B2A3G6|ATPF_NATTJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|179352125|gb|ACB86395.1| ATP synthase F0, B subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 162

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 80/152 (52%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF++ +  I+ L  ++   +   +  F++   ++I+ ++ +A + R+++E +  QY EK 
Sbjct: 8   TFVLTIVNILVLFYLLKRFLFKPIGEFMENRKNEIKQNLEDAEKERQEAEKLKEQYYEKL 67

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + E +EII  A+ R + + +E  Q  +Q +   +    ++I+  + +A   L ++++
Sbjct: 68  RGAKSEAQEIIQQARQREEEIIKEAKQEAKQEADDMIARAREEINQEQKKAIESLRSEVS 127

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           D +++I   +++  ++ D    + +K +  + 
Sbjct: 128 DLTIQITERVLNDTIDKDQQKKLVQKYLKEVG 159


>gi|194337849|ref|YP_002019643.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1]
 gi|226694332|sp|B4SH38|ATPF_PELPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|194310326|gb|ACF45026.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1]
          Length = 175

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        ++  L+     I+  I  A   +E+SE IL + +E  +
Sbjct: 22  FWTAITFVIVLLIL-KKIAWGPIIGALEEREKGIQSSIDRAHSAKEESEAILRKNRELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +II   K  A  L  +  +  +  +   +   + +I   K  A  +L  ++AD
Sbjct: 81  KADAESDKIIREGKDYADKLRADITEKAQSEAKKMIATAKDEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V+   +II   ++ D+   I +  I  + +
Sbjct: 141 LAVKGAEKIIKTTLDADMQKKIVDSMIQDLST 172


>gi|319407569|emb|CBI81219.1| ATP synthase subunit b 1 [Bartonella sp. 1-1C]
          Length = 210

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 72/150 (48%), Gaps = 5/150 (3%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S   F + +  + +P  +   ++   D+I  D+ +A R++++++ ++   ++K +
Sbjct: 64  LWLAISFGFFYLFISRVIVPR-IGGVIETRRDRIVSDLDQAMRMKQEADTVIEICEKKLA 122

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E + II  A +  K+ AE   + IE      L+D E KI  ++ +A + +     +
Sbjct: 123 EARLEAKTIIQVANNEIKLKAELQREKIEAALEKKLEDAENKIKKIQNKAMQNVNLIAEE 182

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +     EII + ++ D++       I ++
Sbjct: 183 IAF----EIIKKLIDVDISKKSVSSAIKAV 208


>gi|110277404|gb|ABG57232.1| AtpB [Streptococcus mitis]
          Length = 140

 Score = 85.0 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 60/130 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ 
Sbjct: 11  NFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E + +I  AK  A+        + +  +    +   Q+I   K EA + +  ++A
Sbjct: 71  AGSRKEAKTVIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVA 130

Query: 126 DFSVEIVREI 135
           D ++ +  +I
Sbjct: 131 DLTISLAGKI 140


>gi|319404578|emb|CBI78184.1| ATP synthase subunit b 1 [Bartonella rochalimae ATCC BAA-1498]
          Length = 210

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 73/150 (48%), Gaps = 5/150 (3%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S   F + +  + +P  + S ++   D+I  D+ +A R++++++ ++   ++K +
Sbjct: 64  LWLAISFGFFYLFISRVIVPR-IGSVIETRRDRIVSDLDQAMRMKQEADTVIEICEKKLA 122

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E + II  A +  K+ AE   + IE      L+D E KI  ++ +A + +     +
Sbjct: 123 EARLEAKTIIQVANNEIKLKAELQREKIEAALEKELEDAENKIKKIQNKAMQNVNLIAEE 182

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +     EII + ++ D++       I ++
Sbjct: 183 IAF----EIIKKLIDVDISKKSISSAIKAV 208


>gi|269216179|ref|ZP_06160033.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
 gi|269130438|gb|EEZ61516.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
          Length = 215

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 75/158 (47%), Gaps = 1/158 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   + ++ +I  VI+     P +    L+  A  IR+D+  A   R++SE +L +YK
Sbjct: 57  MNEFIPMLVAFVILWVILAKFGWP-VFDRMLEKRATTIREDLKSAEAARQESEKLLAEYK 115

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ +  + E   I+  AK   + +  +  +     +A  ++  +  I   + +A   L  
Sbjct: 116 QQLADAKAEASSIVAEAKKTGEAVKADIQKKAADEAAGMIEKAQAAIEAERKQAVSDLQK 175

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +AD SV +  ++I   ++DD + +I ++ +    S +
Sbjct: 176 SVADISVSVASKLIGTDLSDDEHRAIIKRYVEEAGSFN 213


>gi|21672860|ref|NP_660925.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
 gi|81860150|sp|Q8KGE9|ATPF_CHLTE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21645909|gb|AAM71267.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
          Length = 175

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I LVI+        +LS L+  A  I+  I  A   ++++E IL + ++  +
Sbjct: 22  FWTALTFLIVLVIL-RKTAWGPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRDLLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E  +II  AK  A  L  +  +     S   +   +++I   K  A  +L  ++AD
Sbjct: 81  KADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASAKEEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V+   +II   ++ D   ++    I  + + 
Sbjct: 141 MAVKGAEKIIRTTLDADKQKAVVNDMIKEMAAS 173


>gi|148259411|ref|YP_001233538.1| H+-transporting two-sector ATPase, B/B' subunit [Acidiphilium
           cryptum JF-5]
 gi|326402637|ref|YP_004282718.1| ATP synthase subunit b [Acidiphilium multivorum AIU301]
 gi|226694364|sp|A5FVI7|ATPF1_ACICJ RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|146401092|gb|ABQ29619.1| H+-transporting two-sector ATPase, B/B' subunit [Acidiphilium
           cryptum JF-5]
 gi|325049498|dbj|BAJ79836.1| ATP synthase subunit b [Acidiphilium multivorum AIU301]
          Length = 173

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF V ++++IFL       +   + + LD  +  I+ ++ EA RLR ++E +L   + + 
Sbjct: 15  TFWVTVAVLIFLAFFGRKIV-GAITTMLDQRSAAIQHELDEASRLRAEAEAMLKDAESRR 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                + ++++  A   A+ LA +     E  +    +   ++I   +  A   +    A
Sbjct: 74  EAALAQAKDMLAMAGREAERLAADLLAEAEASARRREQMARERISAAEAAAIAEVRDAAA 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             +     +I+ + +++  +  + ++ I  + + 
Sbjct: 134 ALAARAAEQILKETIDEAHDRGLIDQAIGGLPAA 167


>gi|315170138|gb|EFU14155.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1342]
          Length = 176

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 68/156 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 19  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 79  LSSRSEAAEIIKNAKESGEQTRQKTLKETTVEVTRLREKARTDISQEREEALSSVKNEVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           D S++I  +I+++++  D + ++ +  I S+   ++
Sbjct: 139 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANE 174


>gi|29377097|ref|NP_816251.1| ATP synthase F0, B subunit [Enterococcus faecalis V583]
 gi|227554107|ref|ZP_03984154.1| ATP synthase F0, B subunit [Enterococcus faecalis HH22]
 gi|229545020|ref|ZP_04433745.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1322]
 gi|229549264|ref|ZP_04437989.1| ATP synthase F0, B subunit [Enterococcus faecalis ATCC 29200]
 gi|256853923|ref|ZP_05559288.1| ATP synthase F0 [Enterococcus faecalis T8]
 gi|256957851|ref|ZP_05562022.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis DS5]
 gi|256961150|ref|ZP_05565321.1| ATP synthase subunit B [Enterococcus faecalis Merz96]
 gi|257081865|ref|ZP_05576226.1| ATP synthase subunit B [Enterococcus faecalis E1Sol]
 gi|257084407|ref|ZP_05578768.1| ATP synthase subunit B [Enterococcus faecalis Fly1]
 gi|257087594|ref|ZP_05581955.1| ATP synthase subunit B [Enterococcus faecalis D6]
 gi|257416801|ref|ZP_05593795.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis AR01/DG]
 gi|257420017|ref|ZP_05597011.1| ATP synthase subunit B [Enterococcus faecalis T11]
 gi|293384096|ref|ZP_06629990.1| ATP synthase F0, B subunit [Enterococcus faecalis R712]
 gi|293386911|ref|ZP_06631480.1| ATP synthase F0, B subunit [Enterococcus faecalis S613]
 gi|300861260|ref|ZP_07107347.1| ATP synthase F0, B subunit [Enterococcus faecalis TUSoD Ef11]
 gi|307285542|ref|ZP_07565681.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0860]
 gi|307290374|ref|ZP_07570289.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0411]
 gi|312899986|ref|ZP_07759304.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0470]
 gi|312902383|ref|ZP_07761589.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0635]
 gi|312907953|ref|ZP_07766936.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 512]
 gi|312953643|ref|ZP_07772480.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0102]
 gi|312978519|ref|ZP_07790257.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 516]
 gi|81722327|sp|Q831A1|ATPF_ENTFA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29344563|gb|AAO82321.1| ATP synthase F0, B subunit [Enterococcus faecalis V583]
 gi|227176733|gb|EEI57705.1| ATP synthase F0, B subunit [Enterococcus faecalis HH22]
 gi|229305501|gb|EEN71497.1| ATP synthase F0, B subunit [Enterococcus faecalis ATCC 29200]
 gi|229309912|gb|EEN75899.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1322]
 gi|256710866|gb|EEU25909.1| ATP synthase F0 [Enterococcus faecalis T8]
 gi|256948347|gb|EEU64979.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis DS5]
 gi|256951646|gb|EEU68278.1| ATP synthase subunit B [Enterococcus faecalis Merz96]
 gi|256989895|gb|EEU77197.1| ATP synthase subunit B [Enterococcus faecalis E1Sol]
 gi|256992437|gb|EEU79739.1| ATP synthase subunit B [Enterococcus faecalis Fly1]
 gi|256995624|gb|EEU82926.1| ATP synthase subunit B [Enterococcus faecalis D6]
 gi|257158629|gb|EEU88589.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ARO1/DG]
 gi|257161845|gb|EEU91805.1| ATP synthase subunit B [Enterococcus faecalis T11]
 gi|291078576|gb|EFE15940.1| ATP synthase F0, B subunit [Enterococcus faecalis R712]
 gi|291083581|gb|EFE20544.1| ATP synthase F0, B subunit [Enterococcus faecalis S613]
 gi|295113591|emb|CBL32228.1| ATP synthase F0 subcomplex B subunit [Enterococcus sp. 7L76]
 gi|300850299|gb|EFK78049.1| ATP synthase F0, B subunit [Enterococcus faecalis TUSoD Ef11]
 gi|306498567|gb|EFM68069.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0411]
 gi|306502766|gb|EFM72031.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0860]
 gi|310626044|gb|EFQ09327.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 512]
 gi|310628481|gb|EFQ11764.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0102]
 gi|310634053|gb|EFQ17336.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0635]
 gi|311288668|gb|EFQ67224.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 516]
 gi|311292982|gb|EFQ71538.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0470]
 gi|315025248|gb|EFT37180.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2137]
 gi|315030331|gb|EFT42263.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4000]
 gi|315035797|gb|EFT47729.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0027]
 gi|315150004|gb|EFT94020.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0012]
 gi|315151910|gb|EFT95926.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0031]
 gi|315159209|gb|EFU03226.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0312]
 gi|315162852|gb|EFU06869.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0645]
 gi|315173363|gb|EFU17380.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1346]
 gi|315576216|gb|EFU88407.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0309B]
 gi|315579207|gb|EFU91398.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0630]
 gi|315582932|gb|EFU95123.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0309A]
 gi|323481548|gb|ADX80987.1| ATP synthase F0, B subunit [Enterococcus faecalis 62]
 gi|327535843|gb|AEA94677.1| ATP synthase F0 sector subunit B [Enterococcus faecalis OG1RF]
          Length = 176

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 68/156 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 19  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 79  LSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           D S++I  +I+++++  D + ++ +  I S+   ++
Sbjct: 139 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANE 174


>gi|21910031|ref|NP_664299.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS315]
 gi|28896271|ref|NP_802621.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes SSI-1]
 gi|81759289|sp|Q8K829|ATPF_STRP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21904221|gb|AAM79102.1| putative putative proton-translocating ATPase subunit b
           [Streptococcus pyogenes MGAS315]
 gi|28811522|dbj|BAC64454.1| putative proton-translocating ATPase, beta subunit [Streptococcus
           pyogenes SSI-1]
          Length = 164

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 62/154 (40%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V + ++I+   ++    S + +  +  +   
Sbjct: 131 DLTVLLAKKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|116333892|ref|YP_795419.1| F0F1 ATP synthase subunit B [Lactobacillus brevis ATCC 367]
 gi|122269421|sp|Q03QY4|ATPF_LACBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116099239|gb|ABJ64388.1| F0F1-type ATP synthase, subunit b [Lactobacillus brevis ATCC 367]
          Length = 171

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/161 (16%), Positives = 69/161 (42%), Gaps = 1/161 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +++ ++    +  ++ + I + +     +   +   ADKI +DI  A + R  +  ++ +
Sbjct: 11  LYYGDSIFYAVCFLLLMWI-IKVLAWKPVTKMMQDRADKISNDIDSAEKSRNDAAELVQK 69

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +   +    E + I+  AK   +   E+     +       ++ ++ I   + +A    
Sbjct: 70  RQAALASSRSEAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQERQDALSNA 129

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              +AD S+EI  +II +++  D   ++ +  I  +   H+
Sbjct: 130 RNYVADLSIEIASKIIQRELKADDQKALIDSYIEGLGKQHE 170


>gi|227519703|ref|ZP_03949752.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0104]
 gi|256616876|ref|ZP_05473722.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ATCC 4200]
 gi|256963731|ref|ZP_05567902.1| ATP synthase subunit B [Enterococcus faecalis HIP11704]
 gi|257079789|ref|ZP_05574150.1| ATP synthase subunit B [Enterococcus faecalis JH1]
 gi|257421804|ref|ZP_05598794.1| ATP synthase F0 subunit B [Enterococcus faecalis X98]
 gi|294781388|ref|ZP_06746730.1| ATP synthase F0, B subunit [Enterococcus faecalis PC1.1]
 gi|307270672|ref|ZP_07551963.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4248]
 gi|307271678|ref|ZP_07552949.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0855]
 gi|307276860|ref|ZP_07557971.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2134]
 gi|307287563|ref|ZP_07567606.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0109]
 gi|227072791|gb|EEI10754.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0104]
 gi|256596403|gb|EEU15579.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ATCC 4200]
 gi|256954227|gb|EEU70859.1| ATP synthase subunit B [Enterococcus faecalis HIP11704]
 gi|256987819|gb|EEU75121.1| ATP synthase subunit B [Enterococcus faecalis JH1]
 gi|257163628|gb|EEU93588.1| ATP synthase F0 subunit B [Enterococcus faecalis X98]
 gi|294451515|gb|EFG19975.1| ATP synthase F0, B subunit [Enterococcus faecalis PC1.1]
 gi|306501301|gb|EFM70604.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0109]
 gi|306506497|gb|EFM75656.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2134]
 gi|306511556|gb|EFM80555.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0855]
 gi|306512982|gb|EFM81623.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4248]
 gi|315032745|gb|EFT44677.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0017]
 gi|315143756|gb|EFT87772.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2141]
 gi|315148587|gb|EFT92603.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4244]
 gi|315155494|gb|EFT99510.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0043]
 gi|315164960|gb|EFU08977.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1302]
 gi|315168603|gb|EFU12620.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1341]
 gi|329578104|gb|EGG59516.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1467]
          Length = 176

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 68/156 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 19  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 79  LSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           D S++I  +I+++++  D + ++ +  I S+   ++
Sbjct: 139 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANE 174


>gi|28378942|ref|NP_785834.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum WCFS1]
 gi|254557147|ref|YP_003063564.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300769657|ref|ZP_07079540.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181150|ref|YP_003925278.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|81631034|sp|Q88UT9|ATPF_LACPL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28271779|emb|CAD64685.1| H(+)-transporting two-sector ATPase, B subunit [Lactobacillus
           plantarum WCFS1]
 gi|254046074|gb|ACT62867.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300492700|gb|EFK27885.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308046641|gb|ADN99184.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 171

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 73/158 (46%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +   + +S I+ +  ++ +     +   +   ADKI +DI  A++ R+++ ++  Q
Sbjct: 12  LYLGDMLFIGISFIVLMA-LISVVAWKPITKMMADRADKIANDIDSAQKSRQEASDLADQ 70

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  S    E  EI+  AK   +        + +  +  Y ++  + I   + +A + +
Sbjct: 71  RRDALSHSRAEASEIVADAKKSGEKQRSSIVADAQNEATQYKQNARKDIEQERQDALKNV 130

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            + +AD SV I  +II ++++ +   ++    I  +  
Sbjct: 131 QSDVADISVAIATKIIKKQLDPEGQQALINSYIEGLGK 168


>gi|56808119|ref|ZP_00365907.1| COG0711: F0F1-type ATP synthase, subunit b [Streptococcus pyogenes
           M49 591]
 gi|71903221|ref|YP_280024.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS6180]
 gi|94988262|ref|YP_596363.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS9429]
 gi|94992136|ref|YP_600235.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS2096]
 gi|94994057|ref|YP_602155.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10750]
 gi|123640162|sp|Q48UD7|ATPF_STRPM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696173|sp|Q1JCL7|ATPF_STRPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696174|sp|Q1JMJ3|ATPF_STRPC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696176|sp|Q1J7G3|ATPF_STRPF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71802316|gb|AAX71669.1| ATP synthase B chain [Streptococcus pyogenes MGAS6180]
 gi|94541770|gb|ABF31819.1| ATP synthase B chain [Streptococcus pyogenes MGAS9429]
 gi|94545644|gb|ABF35691.1| ATP synthase B chain [Streptococcus pyogenes MGAS2096]
 gi|94547565|gb|ABF37611.1| ATP synthase B chain [Streptococcus pyogenes MGAS10750]
          Length = 164

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 61/154 (39%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + +  +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|78187938|ref|YP_375981.1| ATP synthase F0, subunit B [Chlorobium luteolum DSM 273]
 gi|123582422|sp|Q3B143|ATPF2_PELLD RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|78167840|gb|ABB24938.1| ATP synthase F0 subcomplex B subunit [Chlorobium luteolum DSM 273]
          Length = 175

 Score = 83.8 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ ++ L+I+        ++S L+     I+  I  A   +E+SE IL Q +E  +
Sbjct: 22  FWTTITFVLVLIIL-KKIAWGPIISALEEREKGIQSSIDRAHGAKEESEAILRQNRELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E   +I   +  A+ +  E  +   Q S   +   +++I   K  A   L  ++AD
Sbjct: 81  KADAEADRVIREGREYAEKIRAEITEKAHQESQKMISAAKEEIEQEKRRALAELRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V    +II   ++ DV   + +  I  + +
Sbjct: 141 LAVRGAEKIIRGVLDADVQKKVVDSMIQDLST 172


>gi|251782138|ref|YP_002996440.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390767|dbj|BAH81226.1| ATP synthase B chain [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|323126992|gb|ADX24289.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 164

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 61/154 (39%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAESQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRSEASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + +  +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKAAQSQLIDSYLDDLGEA 164


>gi|332188714|ref|ZP_08390428.1| ATP synthase B/B' CF family protein [Sphingomonas sp. S17]
 gi|332011278|gb|EGI53369.1| ATP synthase B/B' CF family protein [Sphingomonas sp. S17]
          Length = 211

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 78/160 (48%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + FD T  V ++ ++ L+ ++  ++P+++   LD     IR  + EA +LR+++E +  +
Sbjct: 52  LGFDSTGWVALAALVVLIGMLVKKVPAMIGRSLDQKIAGIRAQLDEATKLRQEAEALKAE 111

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K      +   + + A+H A  L  +   + E +     K  E KI   +  A   +
Sbjct: 112 YEAKAKAAHADAEAMRVQAQHEAGQLLSKAKADAEALMERRAKMAEDKIAAAERAALAEV 171

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            A+ A+ +      +I++  + D + ++ ++TI+ +   +
Sbjct: 172 RARAAEAAARAAGLLIAEHHSADADRAMIDRTIAGLGRPN 211


>gi|320546475|ref|ZP_08040790.1| ATP synthase F0 sector subunit B [Streptococcus equinus ATCC 9812]
 gi|320448860|gb|EFW89588.1| ATP synthase F0 sector subunit B [Streptococcus equinus ATCC 9812]
          Length = 165

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 67/153 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             ++     + L++++ +     L     A  +KI +DI  A   REK+E + ++ +E+ 
Sbjct: 12  NIIIVTGSFLLLLVLIKIFAWEQLTGVFKAREEKISNDIDGAEAAREKAEALAVKRQEEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E  +II  AK   K    +      + ++       Q I   K EA   + + +A
Sbjct: 72  AGARTEATQIIDDAKETGKNQEAKIVAEAREEASRLKAKANQDIEQSKAEALSSVKSDVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +V +  +I++  ++ +  S++ +  +  +  
Sbjct: 132 DLTVLLAEKIMTTNLDKEAQSNLIDSYLDKLGD 164


>gi|193213684|ref|YP_001999637.1| F0F1 ATP synthase subunit B [Chlorobaculum parvum NCIB 8327]
 gi|226741335|sp|B3QLV1|ATPF_CHLP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193087161|gb|ACF12437.1| ATP synthase F0, B subunit [Chlorobaculum parvum NCIB 8327]
          Length = 175

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I LVI+        ++S L+     I+  I  A   +E++E+IL + KE  +
Sbjct: 22  FWTAVTFVIVLVIL-KKIAWGPIVSMLEEREKGIQSAIDRAHTAKEEAESILKKNKEMLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E  +II   K  A  +  E  +  +  S   +   +++I   K  A  +L  ++AD
Sbjct: 81  KADAEADKIIREGKEYADKVRSELTEKAQVESQKMIAAAKEEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V+   +II   ++ D   ++    I+ + +
Sbjct: 141 MAVKGAEKIIRTTLDADKQKAVVNDMINEMAA 172


>gi|288904994|ref|YP_003430216.1| F0F1 ATP synthase b chain [Streptococcus gallolyticus UCN34]
 gi|306831065|ref|ZP_07464226.1| ATP synthase F0 sector subunit B [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977961|ref|YP_004287677.1| F0F1 ATP synthase subunit B [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288731720|emb|CBI13281.1| F0F1 ATP synthase b chain [Streptococcus gallolyticus UCN34]
 gi|304426631|gb|EFM29742.1| ATP synthase F0 sector subunit B [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177889|emb|CBZ47933.1| F0F1 ATP synthase subunit B [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 165

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 66/154 (42%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             ++     + L++++ +     L     A  +KI +DI  A   REK+E +  + +E+ 
Sbjct: 12  NIIIVTGSFLLLLVLIKIFAWEQLTGVFKAREEKISNDIDGAEAAREKAEALAAKRQEEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E  +II  AK   K    +      + ++       Q I   K EA   + + +A
Sbjct: 72  AGARTEATQIIDDAKETGKNQEAKIVAEAREEASRLKAKANQDIEQSKAEALSSVKSDVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I++  ++ +  S++ +  +  +   
Sbjct: 132 DLTVLLAEKIMTTNLDKEAQSNLIDSYLDKLGDA 165


>gi|110598590|ref|ZP_01386858.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031]
 gi|110339824|gb|EAT58331.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031]
          Length = 175

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+  +     +L+ L+     I+  I  A   ++++E  L +  E  +
Sbjct: 22  FWTAVTFVIVLLILKKV-AWGPILTALEEREKGIQSSIDRAYHAKDEAEAALRKNSELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +II   K  A  L  +  +  +  +   +   + +I   K  A   L  ++AD
Sbjct: 81  KADAESDKIIREGKDFADKLRTDITEKAQAEAQKMISMAKDEIEQEKRRALNELRTEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V+   +II   ++ D+   I +  I    +
Sbjct: 141 LAVKGAEKIIRGSLDADLQKKIVDSMIQDFST 172


>gi|19745843|ref|NP_606979.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS8232]
 gi|50913940|ref|YP_059912.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10394]
 gi|94990141|ref|YP_598241.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10270]
 gi|139474054|ref|YP_001128770.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes str. Manfredo]
 gi|306827637|ref|ZP_07460917.1| ATP synthase F0 sector subunit B [Streptococcus pyogenes ATCC
           10782]
 gi|81372210|sp|Q5XCY4|ATPF_STRP6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81763190|sp|Q8P1K8|ATPF_STRP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696175|sp|Q1JHN9|ATPF_STRPD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696177|sp|A2RFC6|ATPF_STRPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|19747991|gb|AAL97478.1| putative proton-translocating ATPase, subunit b [Streptococcus
           pyogenes MGAS8232]
 gi|50903014|gb|AAT86729.1| ATP synthase B chain [Streptococcus pyogenes MGAS10394]
 gi|94543649|gb|ABF33697.1| ATP synthase B chain [Streptococcus pyogenes MGAS10270]
 gi|134272301|emb|CAM30555.1| ATP synthase B chain [Streptococcus pyogenes str. Manfredo]
 gi|304430200|gb|EFM33229.1| ATP synthase F0 sector subunit B [Streptococcus pyogenes ATCC
           10782]
          Length = 164

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 61/154 (39%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLETKSQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + +  +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|255971976|ref|ZP_05422562.1| ATP synthase subunit B [Enterococcus faecalis T1]
 gi|255975033|ref|ZP_05425619.1| ATP synthase subunit B [Enterococcus faecalis T2]
 gi|256763250|ref|ZP_05503830.1| ATP synthase subunit B [Enterococcus faecalis T3]
 gi|257090753|ref|ZP_05585114.1| ATP synthase subunit B [Enterococcus faecalis CH188]
 gi|255962994|gb|EET95470.1| ATP synthase subunit B [Enterococcus faecalis T1]
 gi|255967905|gb|EET98527.1| ATP synthase subunit B [Enterococcus faecalis T2]
 gi|256684501|gb|EEU24196.1| ATP synthase subunit B [Enterococcus faecalis T3]
 gi|256999565|gb|EEU86085.1| ATP synthase subunit B [Enterococcus faecalis CH188]
          Length = 171

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 68/156 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 14  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 74  LSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVA 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           D S++I  +I+++++  D + ++ +  I S+   ++
Sbjct: 134 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANE 169


>gi|194335033|ref|YP_002016893.1| F0F1 ATP synthase subunit B [Prosthecochloris aestuarii DSM 271]
 gi|226694419|sp|B4S6E4|ATPF2_PROA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|194312851|gb|ACF47246.1| ATP synthase F0, B subunit [Prosthecochloris aestuarii DSM 271]
          Length = 175

 Score = 83.0 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 64/152 (42%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        +L  L+     I+  I  A   ++++E  L + KE  +
Sbjct: 22  FWTAVTFVIVLLIL-KKFAWGPILGALEEREKAIQSSIDRAHTAKDEAEAALRKNKELLT 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E  +I+   K   + L  +  +     +   +   +++I   K  A   L  ++AD
Sbjct: 81  KADAEAEKILREGKEYGEKLRADIVEKAHSEATKMISSAKEEIEQEKRRALDELRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V+   +I+   ++ D   +I    I  +  
Sbjct: 141 LAVQGAEKILMANLDADKQKAIVSSMIQDLSK 172


>gi|15674804|ref|NP_268978.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes M1 GAS]
 gi|71910390|ref|YP_281940.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS5005]
 gi|81533828|sp|Q9A0J1|ATPF_STRP1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13621934|gb|AAK33699.1| putative proton-translocating ATPase, subunit b [Streptococcus
           pyogenes M1 GAS]
 gi|71853172|gb|AAZ51195.1| ATP synthase B chain [Streptococcus pyogenes MGAS5005]
          Length = 164

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 61/154 (39%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRLQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + +  +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|306833165|ref|ZP_07466295.1| ATP synthase F0 sector subunit B [Streptococcus bovis ATCC 700338]
 gi|304424739|gb|EFM27875.1| ATP synthase F0 sector subunit B [Streptococcus bovis ATCC 700338]
          Length = 165

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 65/154 (42%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             ++     + L++++ +     L     A  +KI +DI  A   REK+E +  + +E+ 
Sbjct: 12  NIIIVTGSFLLLLVLIKIFAWEQLTGVFKAREEKISNDIDGAEAAREKAEALAAKRQEEL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +    E  +II  AK   K    +      + +        Q I   K EA   + + +A
Sbjct: 72  AGARTEATQIIDDAKETGKNQEAKIVAEAREEANRLKAKANQDIEQSKAEALSSVKSDVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I++  ++ +  S++ +  +  +   
Sbjct: 132 DLTVLLAEKIMTTNLDKEAQSNLIDSYLDKLGDA 165


>gi|209559132|ref|YP_002285604.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes NZ131]
 gi|226696180|sp|B5XKP7|ATPF_STRPZ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209540333|gb|ACI60909.1| ATP synthase B chain [Streptococcus pyogenes NZ131]
          Length = 164

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 60/154 (38%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D  V +  +I+   ++    S + +  +  +   
Sbjct: 131 DLMVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|90961572|ref|YP_535488.1| ATP synthase B chain [Lactobacillus salivarius UCC118]
 gi|227890658|ref|ZP_04008463.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus salivarius
           ATCC 11741]
 gi|122449154|sp|Q1WUD0|ATPF_LACS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|90820766|gb|ABD99405.1| ATP synthase B chain [Lactobacillus salivarius UCC118]
 gi|227867596|gb|EEJ75017.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus salivarius
           ATCC 11741]
 gi|300214396|gb|ADJ78812.1| ATP synthase subunit b (ATP synthase F(0) sector subunit b) (F-type
           ATPase subunit b) (F-ATPase subunit b) (ATPase subunit
           I) [Lactobacillus salivarius CECT 5713]
          Length = 175

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 67/155 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+ ++   + L+ +V     + +   ++  A KI +DI  A + R+K+E ++ +      
Sbjct: 19  FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVEKRDLALK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   +        +  +       + ++ I   + EA   +   +A+
Sbjct: 79  NSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKANAKKDIQQERQEALDSVKNDVAE 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            S+EI  +II +++  D   ++ +  I  +   ++
Sbjct: 139 LSIEIASKIIRKELTADDQKALVDSYIEGLGKQNE 173


>gi|191638157|ref|YP_001987323.1| ATP synthase B chain [Lactobacillus casei BL23]
 gi|239631741|ref|ZP_04674772.1| predicted protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|301066217|ref|YP_003788240.1| F0F1-type ATP synthase subunit b [Lactobacillus casei str. Zhang]
 gi|226741491|sp|B3WDL4|ATPF_LACCB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190712459|emb|CAQ66465.1| ATP synthase B chain [Lactobacillus casei BL23]
 gi|239526206|gb|EEQ65207.1| predicted protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|300438624|gb|ADK18390.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei str. Zhang]
 gi|327382188|gb|AEA53664.1| ATP synthase subunit b 2 [Lactobacillus casei LC2W]
 gi|327385385|gb|AEA56859.1| ATP synthase subunit b 2 [Lactobacillus casei BD-II]
          Length = 162

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 64/160 (40%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V  +     +   +     KI  D+  A + R+ ++ +  +
Sbjct: 1   MTLGDTLFTLVTFLVLMLAVGKV-AWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+    + +  +I+  AK   +   +              K+ +  I   + +A    
Sbjct: 60  RQEELQHSQADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              +AD S+ I +++I +++N D    + +  I  +   +
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRLGDAN 159


>gi|301299955|ref|ZP_07206182.1| ATP synthase F0, B subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852437|gb|EFK80094.1| ATP synthase F0, B subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 175

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 67/155 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+ ++   + L+ +V     + +   ++  A KI +DI  A + R+K+E ++ +      
Sbjct: 19  FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVKKRDLALK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   +        +  +       + ++ I   + EA   +   +A+
Sbjct: 79  NSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKTNAKKDIQQERQEALDSVKNDVAE 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
            S+EI  +II +++  D   ++ +  I  +   ++
Sbjct: 139 LSIEIASKIIRKELTADDQKALVDSYIEGLGKQNE 173


>gi|149184784|ref|ZP_01863102.1| AtpF, ATP synthase F0, B subunit [Erythrobacter sp. SD-21]
 gi|148832104|gb|EDL50537.1| AtpF, ATP synthase F0, B subunit [Erythrobacter sp. SD-21]
          Length = 193

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 70/144 (48%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           L++ L      ++   +   LD     I++ + EA++LR ++E +  +Y +K +  E++ 
Sbjct: 50  LVLLLFAFFGAKVHKTIAGGLDNKIASIKEQLEEAKQLRAEAEALRKEYADKIAGAEKDA 109

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
             +++ A+  A  + E+   + + +     +  E KI   + EA   +  +    +    
Sbjct: 110 EAMLVNAQTEADAILEKAEADSKAMVERRKRMAEDKIAAAEREAVEEVRNRAVSAATGAS 169

Query: 133 REIISQKMNDDVNSSIFEKTISSI 156
           R++I++K + + + ++ +K I+ I
Sbjct: 170 RKLIAEKHDAEADRALADKVIAGI 193


>gi|227535358|ref|ZP_03965407.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|227186954|gb|EEI67021.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
          Length = 162

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 64/160 (40%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V  +     +   +     KI  D+  A + R+ ++ +  +
Sbjct: 1   MTLGDTLFTLVTFLVLMLAVGKV-AWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+    + +  +I+  AK   +   +              K+ +  I   + +A    
Sbjct: 60  RQEELQHAQADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              +AD S+ I +++I +++N D    + +  I  +   +
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRLGDAN 159


>gi|295687785|ref|YP_003591478.1| H+transporting two-sector ATPase b/b' subunit [Caulobacter segnis
           ATCC 21756]
 gi|295429688|gb|ADG08860.1| H+transporting two-sector ATPase B/B' subunit [Caulobacter segnis
           ATCC 21756]
          Length = 169

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 36/159 (22%), Positives = 81/159 (50%), Gaps = 1/159 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRI-PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  F V ++L++F  ++  L++ P  L   LD ++ KI+ ++ EA++LRE+++ +L   K
Sbjct: 11  NPEFWVLVALVVFFGLLFALKVLPGALFGALDNYSAKIKAELDEAQQLREEAQALLADVK 70

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  + E +   ++ AAK  AK +AEE  + +E+      +  E+KI   + +A   + A
Sbjct: 71  AQREEAERQAAAMMEAAKADAKRMAEEAKEKLEEQIKRRAEMAERKIAQAEAQAAADVKA 130

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              D + +    +++ ++       + +  I  + +  Q
Sbjct: 131 AAVDLAAQAAETVLAARLAGAKTDPLADAAIGQMGAKLQ 169


>gi|322411473|gb|EFY02381.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 164

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 61/154 (39%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAESQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +II  AK   ++  ++        +    +     I   K +A   +  +++
Sbjct: 71  DASRSEASKIISDAKEIGQLQGDKLVAAATAETKRLKEKALTDIEQSKSDAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + +  +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKAAQSQLIDSYLDDLGEA 164


>gi|163761009|ref|ZP_02168087.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
 gi|162281790|gb|EDQ32083.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
          Length = 203

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 68/136 (50%), Gaps = 1/136 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + +P  +   L+   D+I  D+ EA RL+E+++  +  Y+++ +
Sbjct: 56  LWLAITFGLFYLLMSRVVVPR-IGGILEHRRDRIAQDLDEANRLKEEADAAIAAYEQELA 114

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +++  I  AA+ +AK  A+      E   +  + D E+ I  +K +A   +     D
Sbjct: 115 EARKKSSAIAEAAREKAKSAADAERAATEAELSAKMADAEKSIAAIKAKALGDVDTIAQD 174

Query: 127 FSVEIVREIISQKMND 142
            + ++V+ ++   +  
Sbjct: 175 TATDLVKHLLGGTVTK 190


>gi|227877277|ref|ZP_03995350.1| F0F1 ATP synthase subunit B [Lactobacillus crispatus JV-V01]
 gi|256842840|ref|ZP_05548328.1| ATP synthase F0, B subunit [Lactobacillus crispatus 125-2-CHN]
 gi|256848796|ref|ZP_05554230.1| H+-transporting ATP synthase chain b [Lactobacillus crispatus
           MV-1A-US]
 gi|262045806|ref|ZP_06018770.1| ATP synthase F0, B subunit [Lactobacillus crispatus MV-3A-US]
 gi|293381675|ref|ZP_06627656.1| ATP synthase F0, B subunit [Lactobacillus crispatus 214-1]
 gi|295692629|ref|YP_003601239.1| ATP synthase subunit b [Lactobacillus crispatus ST1]
 gi|312977640|ref|ZP_07789387.1| ATP synthase F0, B subunit [Lactobacillus crispatus CTV-05]
 gi|227863133|gb|EEJ70579.1| F0F1 ATP synthase subunit B [Lactobacillus crispatus JV-V01]
 gi|256614260|gb|EEU19461.1| ATP synthase F0, B subunit [Lactobacillus crispatus 125-2-CHN]
 gi|256714335|gb|EEU29322.1| H+-transporting ATP synthase chain b [Lactobacillus crispatus
           MV-1A-US]
 gi|260573765|gb|EEX30321.1| ATP synthase F0, B subunit [Lactobacillus crispatus MV-3A-US]
 gi|290921722|gb|EFD98743.1| ATP synthase F0, B subunit [Lactobacillus crispatus 214-1]
 gi|295030735|emb|CBL50214.1| ATP synthase subunit B [Lactobacillus crispatus ST1]
 gi|310895379|gb|EFQ44446.1| ATP synthase F0, B subunit [Lactobacillus crispatus CTV-05]
          Length = 168

 Score = 82.3 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 65/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I + +++       +   ++    K+ DD+  A   R+K+E +  +
Sbjct: 12  IYLGNAIWYLICFAILM-LLIKHFAWGPVSDMMEKRRQKVIDDLDSAASERKKAETLANE 70

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+  ++E   N  + +A   K   +     K +A    
Sbjct: 71  REAALKNSRQEATQILSDAKSNAQNTSKEIVANANEDAAAIRKKANEDAAQAKADALNSA 130

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD SV I  ++I++ ++      + ++ I  +  
Sbjct: 131 RDQVADISVAIAEKVIAKNLSAKDQKDLVDQFIKGLDD 168


>gi|189347958|ref|YP_001944487.1| F0F1 ATP synthase subunit B [Chlorobium limicola DSM 245]
 gi|226741334|sp|B3EIJ6|ATPF_CHLL2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189342105|gb|ACD91508.1| ATP synthase F0, B subunit [Chlorobium limicola DSM 245]
          Length = 175

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+  L     ++S L+     I+  I  A   ++++E IL + ++  +
Sbjct: 22  FWTAVTFVIVLLILKQL-AWGPIISALEEREKGIQSSIDRAYSAKDEAEAILRKNRDMLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+  II   K   + L +E  +  +  +   +   + +I   K  A  +L  ++AD
Sbjct: 81  KADLESERIIREGKEYGEKLRQEMAEKAQFEAKKMIASAKDEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++    +II   ++ D    I +  I  + S
Sbjct: 141 LAIMGAEKIIKSSLDADTQKKIVDSMIRDLAS 172


>gi|78188050|ref|YP_378388.1| F0F1 ATP synthase subunit B [Chlorobium chlorochromatii CaD3]
 gi|123579103|sp|Q3ANW4|ATPF_CHLCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78170249|gb|ABB27345.1| ATP synthase F0 subcomplex B subunit [Chlorobium chlorochromatii
           CaD3]
          Length = 175

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        ++  L+     I+  I  A + ++++E IL + +E  S
Sbjct: 22  FWTAITFVIVLLIL-KKIAWGPIIGALEEREKGIQSSIDRAEKAKDEAEAILRKNRELLS 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +I+   K  A+ L  +  +     +A  +   +++I   K  A  +L  ++AD
Sbjct: 81  KADAESEKIVREGKEYAEKLRTDITEKAHTEAAKMIASAKEEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V     II + +N D+   +    I  + S
Sbjct: 141 LAVLGAERIIRESLNADMQKKVVASMIQDMSS 172


>gi|227513062|ref|ZP_03943111.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227524277|ref|ZP_03954326.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083637|gb|EEI18949.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227088508|gb|EEI23820.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
          Length = 169

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +S +I +  ++ L   + +   +   +DKI +DI  A+  R+K+  +  Q + +  K
Sbjct: 18  FVMISFLILM-FLIKLIAWNPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQAQLDK 76

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             E+   +I  AK   +   E+  ++    ++      E+ I   + EA       +A  
Sbjct: 77  TREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRKDVASL 136

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           S+EI  +IIS+++N+     + +  I  +  
Sbjct: 137 SIEIATKIISKELNEQDQKGLVDSYIEGLGK 167


>gi|138896939|ref|YP_001127392.1| F0F1 ATP synthase subunit B [Geobacillus thermodenitrificans
           NG80-2]
 gi|134268452|gb|ABO68647.1| ATPase subunit b [Geobacillus thermodenitrificans NG80-2]
          Length = 207

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 68/145 (46%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++       L+  +    + I ++I +A + R+++E +L + +E   +  +E +
Sbjct: 58  FILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSRQEAQ 117

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            I+  A+  A+   E+   +    +    +  +Q+I   K +A   L  ++A  SV I  
Sbjct: 118 TILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSVLIAS 177

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I +++ +     + E  I  IQ 
Sbjct: 178 KVIERELTEQDQRKLIEAYIKDIQE 202


>gi|220932620|ref|YP_002509528.1| ATP synthase F0, B subunit [Halothermothrix orenii H 168]
 gi|219993930|gb|ACL70533.1| ATP synthase F0, B subunit [Halothermothrix orenii H 168]
          Length = 166

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 73/151 (48%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               ++ ++ + ++    +   L  FLD  + KI++++  A R +E+++ +  +Y+ K  
Sbjct: 9   LWQVVNFLVLMWLLKRF-LYGPLTEFLDKRSQKIKNELDSAARKKEEADKLKKEYESKLQ 67

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  ++ +EII  A+ RA+  AEE        +    +   ++I   K +A   L  ++A 
Sbjct: 68  QARDKAQEIIEDAEKRAQQRAEEIIAEARVEAKKVKERNMEEIAQAKRDALDELRKEVAS 127

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            S+ +  + I +K++     ++  + I ++ 
Sbjct: 128 ISLMVAGKFIKEKIDKKQQEALINQYIENLD 158


>gi|227510133|ref|ZP_03940182.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227190338|gb|EEI70405.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 169

 Score = 81.1 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +S +I +  ++ L   + +   +   +DKI +DI  A+  R+K+  +  Q + +  K
Sbjct: 18  FVMISFLILM-YLIKLIAWNPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQAQLDK 76

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             E+   +I  AK   +   E+  ++    ++      E+ I   + EA       +A  
Sbjct: 77  TREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRKDVASL 136

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           S+EI  +IIS+++N+     + +  I  +  
Sbjct: 137 SIEIATKIISKELNEQDQKGLVDSYIEGLGK 167


>gi|49475211|ref|YP_033252.1| F0F1 ATP synthase subunit B' [Bartonella henselae str. Houston-1]
 gi|81696227|sp|Q6G5L0|ATPF1_BARHE RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|49238016|emb|CAF27222.1| ATP synthase B chain [Bartonella henselae str. Houston-1]
          Length = 188

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 73/146 (50%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +F + +  + +P  +   ++   D+I  D+ +A R++++++ ++  Y+ K +
Sbjct: 42  FWLAISFGLFYLFISRVIVPR-IGGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I   A    K   E   + IE      L D E++I  ++ +A + + +   +
Sbjct: 101 QARSQAHVIAQTASEEIKQKVELERKEIEANLEKKLTDAEKQIAKIRDKAMKSVGSIAEE 160

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            ++EIV+++I  +++ +   S  + T
Sbjct: 161 VALEIVKKLIDVEVSKESVRSAVKAT 186


>gi|227552049|ref|ZP_03982098.1| H(+)-transporting ATPase F(0) B subunit [Enterococcus faecium
           TX1330]
 gi|257882703|ref|ZP_05662356.1| ATP synthase F0 [Enterococcus faecium 1,231,502]
 gi|257886789|ref|ZP_05666442.1| ATP synthase F0 [Enterococcus faecium 1,141,733]
 gi|257895357|ref|ZP_05675010.1| ATP synthase F0 [Enterococcus faecium Com12]
 gi|257897969|ref|ZP_05677622.1| ATP synthase F0 [Enterococcus faecium Com15]
 gi|261208696|ref|ZP_05923133.1| ATP synthase F0 [Enterococcus faecium TC 6]
 gi|289566047|ref|ZP_06446484.1| ATP synthase F0, B subunit [Enterococcus faecium D344SRF]
 gi|293378228|ref|ZP_06624397.1| ATP synthase F0, B subunit [Enterococcus faecium PC4.1]
 gi|293556420|ref|ZP_06675001.1| ATP synthase F0, B subunit [Enterococcus faecium E1039]
 gi|293572429|ref|ZP_06683409.1| ATP synthase F0, B subunit [Enterococcus faecium E980]
 gi|294617577|ref|ZP_06697207.1| ATP synthase F0, B subunit [Enterococcus faecium E1679]
 gi|294623200|ref|ZP_06702078.1| ATP synthase F0, B subunit [Enterococcus faecium U0317]
 gi|227178802|gb|EEI59774.1| H(+)-transporting ATPase F(0) B subunit [Enterococcus faecium
           TX1330]
 gi|257818361|gb|EEV45689.1| ATP synthase F0 [Enterococcus faecium 1,231,502]
 gi|257822843|gb|EEV49775.1| ATP synthase F0 [Enterococcus faecium 1,141,733]
 gi|257831922|gb|EEV58343.1| ATP synthase F0 [Enterococcus faecium Com12]
 gi|257835881|gb|EEV60955.1| ATP synthase F0 [Enterococcus faecium Com15]
 gi|260077198|gb|EEW64918.1| ATP synthase F0 [Enterococcus faecium TC 6]
 gi|289162154|gb|EFD10017.1| ATP synthase F0, B subunit [Enterococcus faecium D344SRF]
 gi|291596183|gb|EFF27446.1| ATP synthase F0, B subunit [Enterococcus faecium E1679]
 gi|291597395|gb|EFF28568.1| ATP synthase F0, B subunit [Enterococcus faecium U0317]
 gi|291601487|gb|EFF31758.1| ATP synthase F0, B subunit [Enterococcus faecium E1039]
 gi|291607491|gb|EFF36833.1| ATP synthase F0, B subunit [Enterococcus faecium E980]
 gi|292643092|gb|EFF61233.1| ATP synthase F0, B subunit [Enterococcus faecium PC4.1]
          Length = 174

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 70/156 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     + L+ ++       +   L    DKI +D+  A + R  S  +  + +++ 
Sbjct: 17  NIIVVSGSFLILLALLKHFAWGPISDILKKREDKIANDLDSAEQSRINSAKMEQEREQQL 76

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  +   ++ ++ +A      +  I   +  A   +   +A
Sbjct: 77  LASRSDAADIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKDDVA 136

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           + S++I  +I++++++ +++ S+  + I  + S ++
Sbjct: 137 ELSLQIAEKILNKELSPEMHESLINQYIEGLGSSNE 172


>gi|241895229|ref|ZP_04782525.1| H(+)-transporting ATPase F(0) B subunit [Weissella
           paramesenteroides ATCC 33313]
 gi|241871535|gb|EER75286.1| H(+)-transporting ATPase F(0) B subunit [Weissella
           paramesenteroides ATCC 33313]
          Length = 171

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 69/157 (43%), Gaps = 1/157 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V ++ ++ + +++       ++  ++  A+K+  D+  A   R+++E +  +
Sbjct: 14  LALGNMLFVLVAFLVLM-LLLKKYAWGPVVKMMEKRAEKVAHDLDTAEEARQQAEEMAAK 72

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+      E   I+  AK  A    ++   + +  +    +    +I   + EA   +
Sbjct: 73  RSEQLQSARTEANSIVSDAKTAAGKQRDQIVADAQADAQATKEQASAQIAQERSEAMADV 132

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +++A+ SV I ++II +++  D   ++ +  I  + 
Sbjct: 133 KSEVAELSVTIAQKIIQKELKLDDQKALIDAYIEGLG 169


>gi|81428739|ref|YP_395739.1| H(+)-transporting two-sector ATPase (ATP synthase), B subunit
           [Lactobacillus sakei subsp. sakei 23K]
 gi|123564149|sp|Q38WK1|ATPF_LACSS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78610381|emb|CAI55431.1| H(+)-transporting two-sector ATPase (ATP synthase), B subunit
           [Lactobacillus sakei subsp. sakei 23K]
          Length = 173

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 66/160 (41%), Gaps = 1/160 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           +  ++  V +  II + +V        +   +   ++KI +D+  A + RE +  +  Q 
Sbjct: 13  YLGDSLFVLVVFIILVALVGKF-AFGPVSKMMQERSNKITNDLDSAAQSREDAAKLAAQR 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
             +    + E  EI+  AK   +   E      ++      ++ ++ I   +L+A     
Sbjct: 72  ATELKSSKSEAVEIVNTAKQNGEKQREGMVTLAQEEVQTLKQNAKKDIEQSRLDALNSAR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
             +A  S+EI  ++I ++++     S+    I  +   ++
Sbjct: 132 DDVAQLSIEIASKLIKKELSVTDQKSLINSYIEGLDKQNE 171


>gi|69247779|ref|ZP_00604484.1| ATP synthase F0, subunit B [Enterococcus faecium DO]
 gi|257879710|ref|ZP_05659363.1| ATP synthase F0 [Enterococcus faecium 1,230,933]
 gi|257884017|ref|ZP_05663670.1| ATP synthase F0 [Enterococcus faecium 1,231,501]
 gi|257890374|ref|ZP_05670027.1| ATP synthase F0 [Enterococcus faecium 1,231,410]
 gi|257892982|ref|ZP_05672635.1| ATP synthase F0 [Enterococcus faecium 1,231,408]
 gi|258616680|ref|ZP_05714450.1| ATP synthase F0, B subunit [Enterococcus faecium DO]
 gi|260559631|ref|ZP_05831811.1| ATP synthase F0 [Enterococcus faecium C68]
 gi|293560032|ref|ZP_06676536.1| ATP synthase F0, B subunit [Enterococcus faecium E1162]
 gi|293568728|ref|ZP_06680043.1| ATP synthase F0, B subunit [Enterococcus faecium E1071]
 gi|314939616|ref|ZP_07846843.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a04]
 gi|314941242|ref|ZP_07848138.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133C]
 gi|314949825|ref|ZP_07853135.1| ATP synthase F0, B subunit [Enterococcus faecium TX0082]
 gi|314953383|ref|ZP_07856308.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133A]
 gi|314993460|ref|ZP_07858825.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133B]
 gi|314997317|ref|ZP_07862282.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a01]
 gi|68194708|gb|EAN09190.1| ATP synthase F0, subunit B [Enterococcus faecium DO]
 gi|257813938|gb|EEV42696.1| ATP synthase F0 [Enterococcus faecium 1,230,933]
 gi|257819855|gb|EEV47003.1| ATP synthase F0 [Enterococcus faecium 1,231,501]
 gi|257826734|gb|EEV53360.1| ATP synthase F0 [Enterococcus faecium 1,231,410]
 gi|257829361|gb|EEV55968.1| ATP synthase F0 [Enterococcus faecium 1,231,408]
 gi|260074299|gb|EEW62621.1| ATP synthase F0 [Enterococcus faecium C68]
 gi|291588688|gb|EFF20521.1| ATP synthase F0, B subunit [Enterococcus faecium E1071]
 gi|291605899|gb|EFF35329.1| ATP synthase F0, B subunit [Enterococcus faecium E1162]
 gi|313588608|gb|EFR67453.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a01]
 gi|313592125|gb|EFR70970.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133B]
 gi|313594576|gb|EFR73421.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133A]
 gi|313599966|gb|EFR78809.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133C]
 gi|313641156|gb|EFS05736.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a04]
 gi|313643898|gb|EFS08478.1| ATP synthase F0, B subunit [Enterococcus faecium TX0082]
          Length = 174

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 70/156 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     + L+ ++       +   L    DKI +D+  A + R  S  +  + +++ 
Sbjct: 17  NVIVVSGSFLILLALLKHFAWGPISDILKKREDKIANDLDSAEQSRINSAKMEQEREQQL 76

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  +   ++ ++ +A      +  I   +  A   +   +A
Sbjct: 77  LASRSDAADIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKDDVA 136

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           + S++I  +I++++++ +++ S+  + I  + S ++
Sbjct: 137 ELSLQIAEKILNKELSPEMHESLINQYIEGLGSSNE 172


>gi|199597580|ref|ZP_03211009.1| F0F1-type ATP synthase, subunit b [Lactobacillus rhamnosus HN001]
 gi|258508174|ref|YP_003170925.1| ATP synthase subunit B [Lactobacillus rhamnosus GG]
 gi|199591603|gb|EDY99680.1| F0F1-type ATP synthase, subunit b [Lactobacillus rhamnosus HN001]
 gi|257148101|emb|CAR87074.1| ATP synthase B chain [Lactobacillus rhamnosus GG]
 gi|259649492|dbj|BAI41654.1| F0F1-type ATP synthase subunit B [Lactobacillus rhamnosus GG]
          Length = 162

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 64/160 (40%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V  +     +   +     KI  D+  A + R+ +E +  +
Sbjct: 1   MSLGDTLFTLVTFLVLMIAVGKV-AWKPVSKMMAERQQKISGDLDYAEKSRKDAEALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E     + +  +I+  AK   +   +          A   K+ +  I   + +A    
Sbjct: 60  RREALQHAQADAVKIVNQAKENGEKQRQSLVDAANTEVATLKKNAQADIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              +AD S+ I +++I +++N D    + +  I  +   +
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKDLIDDYIKRLGDAN 159


>gi|319406085|emb|CBI79715.1| ATP synthase subunit b 1 (modular protein) [Bartonella sp. AR 15-3]
          Length = 210

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 75/150 (50%), Gaps = 5/150 (3%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S   F + V  + +P  +   ++   D+I  D+ +A R++++++ ++  Y++K +
Sbjct: 64  LWLAISFGFFYLFVSRIIVPR-IGGVIETRRDRIVSDLDQAMRIKQETDIVIEIYEKKLA 122

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E + +I AA +  K+ AE   + IE +    L+D E KI  ++ +A + +     +
Sbjct: 123 EARLEAKNMIQAANNEIKLKAELQRKKIEAVLEKKLEDAEDKIKKIQDKAMQNINLIAEE 182

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +     EII + ++ D++       + ++
Sbjct: 183 ITF----EIIKKLIDVDISKKSISSAVKAV 208


>gi|183220211|ref|YP_001838207.1| F0F1 ATP synthase subunit B [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910329|ref|YP_001961884.1| F0F1 ATP synthase subunit B [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|226741498|sp|B0SDA1|ATPF_LEPBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741499|sp|B0SLC4|ATPF_LEPBP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167775005|gb|ABZ93306.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167778633|gb|ABZ96931.1| ATP synthase F0, B subunit [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 174

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 36/152 (23%), Positives = 66/152 (43%), Gaps = 1/152 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++  + +V V+       +L  L+  A  I+ DI +A  LR ++E  L +YK++  K
Sbjct: 21  WTLVTFSV-VVFVLKKFAWDKILHALEERASGIQGDINKAESLRVEAEKSLKEYKDQLFK 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             EE   I+  AK  A  L  +  +              ++I   K  A   +  +I + 
Sbjct: 80  ATEEAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQIVEM 139

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           SV I  EI+ +++  +  +S  EK I+ +   
Sbjct: 140 SVLIASEILEKQLKKEDYASFVEKEIAKLDKL 171


>gi|260102576|ref|ZP_05752813.1| ATP synthase F0 [Lactobacillus helveticus DSM 20075]
 gi|260083603|gb|EEW67723.1| ATP synthase F0 [Lactobacillus helveticus DSM 20075]
          Length = 169

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I L +++       +   ++    K+ +D+  A   R+K+E +  +
Sbjct: 13  IYLGNALWYLICFAILL-LLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATKILSDAKANAQKTGKEIVASANEYAAAIRKKANEEAAKAKSDALDSA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD S+ I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELDD 169


>gi|229551975|ref|ZP_04440700.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus rhamnosus
           LMS2-1]
 gi|258539389|ref|YP_003173888.1| ATP synthase subunit B [Lactobacillus rhamnosus Lc 705]
 gi|229314710|gb|EEN80683.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus rhamnosus
           LMS2-1]
 gi|257151065|emb|CAR90037.1| ATP synthase B chain [Lactobacillus rhamnosus Lc 705]
          Length = 162

 Score = 80.3 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 64/160 (40%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V  +     +   +     KI  D+  A + R+ +E +  +
Sbjct: 1   MSLGDTLFTLVTFLVLMIAVGKV-AWKPVSKMMAERQQKISGDLDYAEKSRKDAEALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E     + +  +I+  AK   +   +          A   K+ +  I   + +A    
Sbjct: 60  RREALQHSQADAVKIVNQAKENGEKQRQSLVDAANTEVATLKKNAQADIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              +AD S+ I +++I +++N D    + +  I  +   +
Sbjct: 120 KNDVADLSLAIAQKLIGKELNADDQKDLIDDYIKRLGDAN 159


>gi|227892674|ref|ZP_04010479.1| F0F1 ATP synthase subunit B [Lactobacillus ultunensis DSM 16047]
 gi|227865545|gb|EEJ72966.1| F0F1 ATP synthase subunit B [Lactobacillus ultunensis DSM 16047]
          Length = 169

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I + ++V       +   ++    K+ +D+  A   R+K+E +  +
Sbjct: 13  IYLGNAIWYLICFAILM-LLVKHYAWGPVSDMMEKRRQKVINDLDAAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATQILSDAKSNAQNTGKEIVASANEDAAAIRKKANEEAAKAKTDALNSA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD SV I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLDD 169


>gi|315038008|ref|YP_004031576.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1112]
 gi|325956461|ref|YP_004291873.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus 30SC]
 gi|312276141|gb|ADQ58781.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1112]
 gi|325333026|gb|ADZ06934.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus 30SC]
          Length = 169

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I L ++V       +   ++    K+ +D+  A   R+K+E +  +
Sbjct: 13  IYLGNAIWYLICFAILL-LLVKHYAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATQILSDAKTNAQNTGKEIVASANEDAAAIRKKANEEAAKAKSDALNAA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD SV I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLDD 169


>gi|297618433|ref|YP_003703592.1| ATP synthase F0 subunit beta [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146270|gb|ADI03027.1| ATP synthase F0, B subunit [Syntrophothermus lipocalidus DSM 12680]
          Length = 197

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 58/152 (38%), Gaps = 1/152 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++  +   I+ Y    + +++ L+   + I   +  A  LR + E +  + +   ++
Sbjct: 45  WTAVNFFVLFAIL-YKFGYTPIVNMLEQRTNTIESSLKHAEDLRAEVEQMRKEAQTNLAE 103

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E +EI+  A   A+    +     +Q +         +I   K +A   L    A  
Sbjct: 104 ARREAQEIVARATKVAEEAKNDIIAKAQQDARAEKDKALAEIKAEKEQALTELRDTAATL 163

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           ++    +++ + + ++ +  + ++ +      
Sbjct: 164 AIMAAEKVLGRALTEEDHKGMVKEFVKEAGDL 195


>gi|284046070|ref|YP_003396410.1| ATP synthase F0 B subunit [Conexibacter woesei DSM 14684]
 gi|283950291|gb|ADB53035.1| ATP synthase F0, B subunit [Conexibacter woesei DSM 14684]
          Length = 194

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ L+++     P  +   LD    +I + I  A R R++++ +L +Y+++ + 
Sbjct: 36  WTLLAFVVALLVLRKYAWPQ-ITRILDQRQQQIEESIDAADRTRQEADELLAEYRQRLTD 94

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  EI+  A+   ++   EG    +      L+   + I      A + +  ++AD 
Sbjct: 95  ARAQADEIVAKAERAGEVAEREGLDAAKVKREELLEQTRRDIQAETNRAIQEIRREVADL 154

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           +V+   ++  + ++ D    + E+ +S + 
Sbjct: 155 TVQATEKVTRKTLSPDDQKRLVEEALSELD 184


>gi|328468720|gb|EGF39702.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus MTCC 5463]
          Length = 169

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I L +++       +   ++    K+ +D+  A   R+K+E +  +
Sbjct: 13  IYLGNALWYLICFAILL-LLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATKILSDAKANAQKTVKEIVASANEYAAAIRKKANEEAAKAKSDALDSA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD S+ I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELDD 169


>gi|331701225|ref|YP_004398184.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
 gi|329128568|gb|AEB73121.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
          Length = 169

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 70/158 (44%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +   V ++ ++ +  +V +     +   +   +DKI +DI  A+  R K+  +  +
Sbjct: 11  LYVGDMLFVMITFLVLM-WLVKIVAWKPITKMMQDRSDKIVNDIDSAKESRTKAAELAQK 69

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + +  K  ++   II  AK   +   E+  ++    ++      E+ I   + EA    
Sbjct: 70  RQAELDKTRDDANTIINTAKQNGQRQQEQIVEDARNEASNLKSSAEKDIEQERQEALANS 129

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              +A  SVEI  +IIS+++N+D    + +  I  +  
Sbjct: 130 RKDVASLSVEIASKIISKELNEDDQKGLVDSYIEGLGK 167


>gi|227514477|ref|ZP_03944526.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus fermentum
           ATCC 14931]
 gi|227087163|gb|EEI22475.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus fermentum
           ATCC 14931]
          Length = 168

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 69/156 (44%), Gaps = 1/156 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S +I +  +V+      +   +   ADKI +DI  A + RE+++ +  +
Sbjct: 10  LYLGDMLFYLVSFLI-MAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAK 68

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+     +E   I+  AK   +    E     +Q +       ++     + +A R  
Sbjct: 69  RQEELKGSRQEAATIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQARQDALRGA 128

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              IA+ S+EI  ++I +++N D   ++ +  I  +
Sbjct: 129 KKDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164


>gi|260663292|ref|ZP_05864183.1| ATP synthase F0, B subunit [Lactobacillus fermentum 28-3-CHN]
 gi|260552144|gb|EEX25196.1| ATP synthase F0, B subunit [Lactobacillus fermentum 28-3-CHN]
          Length = 168

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 69/156 (44%), Gaps = 1/156 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S +I +  +V+      +   +   ADKI +DI  A + RE+++ +  +
Sbjct: 10  LYLGDMLFYLVSFLI-MAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAK 68

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+     +E   I+  AK   +    E     +Q +       ++     + +A R  
Sbjct: 69  RQEELKGSRQEAATIVDNAKQAGESQRAEIIARAQQDAQNLKNQAQKDAEQARQDALRGA 128

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              IA+ S+EI  ++I +++N D   ++ +  I  +
Sbjct: 129 KEDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164


>gi|240850061|ref|YP_002971454.1| ATP synthase subunit B' [Bartonella grahamii as4aup]
 gi|240267184|gb|ACS50772.1| ATP synthase subunit B' [Bartonella grahamii as4aup]
          Length = 188

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 74/146 (50%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +F + +  + +P  +   ++   D+I  D+ +A R++++++ ++  Y+ K +
Sbjct: 42  FWLAISFGLFYLFISRVIVPR-IGGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I   A    K  AE   + IE+     L D E++I  ++ +A + + +   +
Sbjct: 101 EARLKAHAIAQVASEELKEKAELERKEIEESLEKKLADAEKQIAKIRDKAMQNVGSIAEE 160

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            ++EIV+++I   ++ +   S+ +  
Sbjct: 161 VALEIVKKLIDVDISKEAVRSVVKTA 186


>gi|184154913|ref|YP_001843253.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956]
 gi|226741492|sp|B2GAU1|ATPF_LACF3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|183226257|dbj|BAG26773.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956]
          Length = 168

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 69/156 (44%), Gaps = 1/156 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S +I +  +V+      +   +   ADKI +DI  A + RE+++ +  +
Sbjct: 10  LYLGDMLFYLVSFLI-MAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAK 68

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+     +E   I+  AK   +    E     +Q +       ++     + +A R  
Sbjct: 69  RQEELKGSRQEAARIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQARQDALRGA 128

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              IA+ S+EI  ++I +++N D   ++ +  I  +
Sbjct: 129 KKDIANLSIEIASKLIHKQLNADDQQALIDTYIEGL 164


>gi|312142783|ref|YP_003994229.1| ATP synthase F0, B subunit [Halanaerobium sp. 'sapolanicus']
 gi|311903434|gb|ADQ13875.1| ATP synthase F0, B subunit [Halanaerobium sp. 'sapolanicus']
          Length = 166

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
                +  + + ++    + S +   L+  A  +  +I +A ++RE+++ +  +Y+ K  
Sbjct: 9   LWQIFNFFVLMYLLKRY-LYSPIKDILEKRAAHVNTEIDDAEKMREEAKKLKEKYQAKLR 67

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  A+ RA + A+   +  E+ +        ++I   K E    L  K+A 
Sbjct: 68  DARGEAQNIIDKAEDRANVKAKNIIKEAEEKAENIKAKKMEEIEKAKKETMAELRNKVAS 127

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++     +I +++++D +  +  + I  + +
Sbjct: 128 MTILATNRLIQEQLDEDKHQVMINQFIDQLDA 159


>gi|15673750|ref|NP_267924.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116512627|ref|YP_811534.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125624729|ref|YP_001033212.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281492360|ref|YP_003354340.1| ATP synthase F0 subunit B [Lactococcus lactis subsp. lactis KF147]
 gi|61219599|sp|P0A2Z0|ATPF_LACLA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219602|sp|P0A2Z1|ATPF_LACLM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123320232|sp|Q02XA1|ATPF_LACLS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6048349|gb|AAF02204.1|AF059739_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|12724791|gb|AAK05866.1|AE006407_2 ATP synthase subunit b [Lactococcus lactis subsp. lactis Il1403]
 gi|116108281|gb|ABJ73421.1| ATP synthase F0 subcomplex B subunit [Lactococcus lactis subsp.
           cremoris SK11]
 gi|124493537|emb|CAL98518.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281376024|gb|ADA65515.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. lactis KF147]
 gi|300071526|gb|ADJ60926.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 168

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 66/153 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + 
Sbjct: 16  NIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAEL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +  +EE   II  A   A     +      + +    K  ++ I   + EA   +   +A
Sbjct: 76  AGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D SV+I  ++I Q ++      + +  ++ +  
Sbjct: 136 DISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|315304774|ref|ZP_07874944.1| ATP synthase F0, B subunit [Listeria ivanovii FSL F6-596]
 gi|313626853|gb|EFR95816.1| ATP synthase F0, B subunit [Listeria ivanovii FSL F6-596]
          Length = 170

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F ++F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDSFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKLLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|239831260|ref|ZP_04679589.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
 gi|239823527|gb|EEQ95095.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
          Length = 244

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 69/146 (47%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 98  LWLAITFGLFYLFMSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 156

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A     + E      LK+ E++I  +K +A   +     +
Sbjct: 157 QARTKAASIAEAAREKGKGEANAERASAEAALEGKLKEAEERIAAIKAKAMNDVGNIAEE 216

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            + EIV +++  K +    ++  +  
Sbjct: 217 TTAEIVEQLLGTKADKASVTAAVKAA 242


>gi|327183288|gb|AEA31735.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1118]
          Length = 169

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I L ++V       +   ++    K+ +D+  A   R+K+E +  +
Sbjct: 13  IYLGNAIWYLICFAILL-LLVKHYAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATQILSDAKTNAQNTGKEIVASANEDAAAIRKKANEEAAKAKSDALNAA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD S+ I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISIAIAEKVIAKNLSAEDQKDLVDQFIKGLDD 169


>gi|332687032|ref|YP_004456806.1| ATP synthase subunit B [Melissococcus plutonius ATCC 35311]
 gi|332371041|dbj|BAK21997.1| ATP synthase B chain [Melissococcus plutonius ATCC 35311]
          Length = 175

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 65/156 (41%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       +   L    DKI +D+  A + R  +  +  + +++ 
Sbjct: 18  TIIVVTGAFLILMLLLKKFAWGAVTDMLKKREDKIANDLDSAEQSRIAAAKMEQERQQQL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + +  EII  AK   +   ++         +   +     I     EA   +   ++
Sbjct: 78  LSSKSDAAEIIKNAKESGEQTRQKLLNEANGEISHLKEKARGDISQEHDEAMASIKTDVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
             S+EI  +I+++++++  + ++    I S+   ++
Sbjct: 138 KLSIEIAEKILNKELSEASHEALINSYIESLGKSNE 173


>gi|289435794|ref|YP_003465666.1| ATP synthase F0, B subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172038|emb|CBH28584.1| ATP synthase F0, B subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 170

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F ++F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDSFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|15963433|dbj|BAB69467.1| H+-ATPase b subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 65/153 (42%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + 
Sbjct: 16  NIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAEL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +  +EE   II  A   A     +      +      K  ++ I   + EA   +   +A
Sbjct: 76  AGSKEEAANIIQVANDTASQNRAKVLATANRRDTSLKKRAQEDIEQERKEALNTVKGDVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D SV+I  ++I Q ++      + +  ++ +  
Sbjct: 136 DISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|47096956|ref|ZP_00234532.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854]
 gi|217963364|ref|YP_002349042.1| ATP synthase F0, B subunit [Listeria monocytogenes HCC23]
 gi|254900329|ref|ZP_05260253.1| F0F1 ATP synthase subunit B [Listeria monocytogenes J0161]
 gi|254913432|ref|ZP_05263444.1| ATP synthase F0 [Listeria monocytogenes J2818]
 gi|254937813|ref|ZP_05269510.1| ATP synthase F0 [Listeria monocytogenes F6900]
 gi|290892696|ref|ZP_06555688.1| ATP synthase F0 [Listeria monocytogenes FSL J2-071]
 gi|47014666|gb|EAL05623.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854]
 gi|217332634|gb|ACK38428.1| ATP synthase F0, B subunit [Listeria monocytogenes HCC23]
 gi|258610417|gb|EEW23025.1| ATP synthase F0 [Listeria monocytogenes F6900]
 gi|290557756|gb|EFD91278.1| ATP synthase F0 [Listeria monocytogenes FSL J2-071]
 gi|293591439|gb|EFF99773.1| ATP synthase F0 [Listeria monocytogenes J2818]
 gi|307572060|emb|CAR85239.1| ATP synthase F0, B subunit [Listeria monocytogenes L99]
 gi|313606755|gb|EFR83455.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL F2-208]
          Length = 170

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDAFFTLFAFSILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|116493069|ref|YP_804804.1| F0F1-type ATP synthase, subunit b [Pediococcus pentosaceus ATCC
           25745]
 gi|122265467|sp|Q03EL0|ATPF_PEDPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116103219|gb|ABJ68362.1| ATP synthase F0 subcomplex B subunit [Pediococcus pentosaceus ATCC
           25745]
          Length = 173

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 61/147 (41%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           L I L+ ++       + + L   AD+I +DI  A + R ++E +  Q KE       E 
Sbjct: 26  LFIVLMALIAKFAWGPVNAMLKERADRISNDIDSAEQSRIEAEKLAKQRKEALDNSHAEA 85

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
             II  AK       E    N +  +       +Q I   + +A +     IA  S+EI 
Sbjct: 86  TSIINNAKDSGAKERELIIGNAQNEAKSLKDKAKQDIEQERADALKSAQDDIASLSIEIA 145

Query: 133 REIISQKMNDDVNSSIFEKTISSIQSC 159
            ++I ++++++    + +  I  +   
Sbjct: 146 SKVIKKELDENSQKDLIDSYIEGLGDS 172


>gi|116328617|ref|YP_798337.1| F0F1 ATP synthase subunit B [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331346|ref|YP_801064.1| F0F1 ATP synthase subunit B [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122280908|sp|Q04S14|ATPF_LEPBJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122283596|sp|Q04ZU1|ATPF_LEPBL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116121361|gb|ABJ79404.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector
           [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116125035|gb|ABJ76306.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector
           [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
          Length = 173

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ +V+V+      ++L  LD  A  +++DI +A  LR ++E +L  Y+ + + 
Sbjct: 21  WTLITFLV-VVLVLKKFAWDVILKALDERAQAVQNDIEKASELRLEAEALLKDYEARLNS 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E   I+  A+  A  L  +  +   Q          ++I   K +A   L  +  + 
Sbjct: 80  AKDEANAIVAEARSDALKLKNKLLEETNQEVKAQKDQAVKEIELAKGKALEQLQTQFVEM 139

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++ I  +++ +++  +   +  E  ++ +    
Sbjct: 140 TITIAGKVLEKQLKAEDYKAFIETELNKLGKLS 172


>gi|32476313|ref|NP_869307.1| protein ATP synthase B chain [Rhodopirellula baltica SH 1]
 gi|32446858|emb|CAD78764.1| probable protein ATP synthase B chain [Rhodopirellula baltica SH 1]
          Length = 261

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 72/154 (46%), Gaps = 2/154 (1%)

Query: 9   VFMSLIIFLVIVVY--LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
              +LIIFL ++      +   +L  L A  +KIR+D+  A +   +++ +L  Y+ K  
Sbjct: 108 AIWNLIIFLCVLAILSKFVWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLD 167

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   + + ++  A+  A+   ++     +  +A   +     I   K  A   +  + + 
Sbjct: 168 EAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSK 227

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++++ R ++ ++++ D ++ +  +++  + S +
Sbjct: 228 LAMQVARSVVGRELSADDHADLIRQSMERLPSQN 261


>gi|257867451|ref|ZP_05647104.1| H+ ATPase [Enterococcus casseliflavus EC30]
 gi|257873781|ref|ZP_05653434.1| H+ ATPase [Enterococcus casseliflavus EC10]
 gi|257877531|ref|ZP_05657184.1| H+ ATPase [Enterococcus casseliflavus EC20]
 gi|325568948|ref|ZP_08145241.1| ATP synthase F0 sector subunit B [Enterococcus casseliflavus ATCC
           12755]
 gi|257801507|gb|EEV30437.1| H+ ATPase [Enterococcus casseliflavus EC30]
 gi|257807945|gb|EEV36767.1| H+ ATPase [Enterococcus casseliflavus EC10]
 gi|257811697|gb|EEV40517.1| H+ ATPase [Enterococcus casseliflavus EC20]
 gi|325157986|gb|EGC70142.1| ATP synthase F0 sector subunit B [Enterococcus casseliflavus ATCC
           12755]
          Length = 174

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 70/156 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V    I+ L+ ++       + S +    DKI +D+  A + R  +  +  + +EK 
Sbjct: 17  NIIVVSGSILLLLFLLKHFAWDAISSMMQKREDKIANDLDSAEQSRLNAAKLEKERQEKL 76

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++   E  EII +AK   ++  +      ++  A   +     I   K  A + +   +A
Sbjct: 77  ARSHSEAAEIIKSAKDSGELSRQNILSETKEEVARLKEKANSDITLEKETALKEVKDDVA 136

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           + S++I  +I+ +++  + + S+  + I  + S ++
Sbjct: 137 ELSLQIAEKILGRELTPENHESLINQYIEGLGSVNE 172


>gi|256848009|ref|ZP_05553453.1| ATP synthase F0, B subunit [Lactobacillus coleohominis 101-4-CHN]
 gi|256715069|gb|EEU30046.1| ATP synthase F0, B subunit [Lactobacillus coleohominis 101-4-CHN]
          Length = 167

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 70/158 (44%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +S II L ++V+      +   ++  A+KI DDI  A + R+ +  +  Q
Sbjct: 10  LYMGDMLFYLISFII-LALLVWHFAWKPVTEMMEKRANKIADDIDSAAKDRKDAAKLAAQ 68

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + +    ++E  +I+  A+   + L  +      Q +    +  ++     + +A    
Sbjct: 69  RQAELQGSKQEATQIVDEARKNGENLRNQIVDEAHQNAQSIQEQAQRDAEQARQDALNGA 128

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              +A+ S+EI  ++I++++N D    + +  I  +  
Sbjct: 129 KDDVANLSLEIAAKLINKQLNADDQQQLIDSYIEGLSK 166


>gi|49473961|ref|YP_032003.1| F0F1 ATP synthase subunit B' [Bartonella quintana str. Toulouse]
 gi|81696062|sp|Q6G0H1|ATPF1_BARQU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|49239464|emb|CAF25815.1| ATP synthase B chain [Bartonella quintana str. Toulouse]
          Length = 188

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 73/146 (50%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +F + +  + +P  +   ++   D+I  D+ +A R++++++ ++  Y+ K +
Sbjct: 42  FWLAISFGLFYLFISRVIVPR-IGDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA    K   E   + IE      LKD E++I  ++ +A + + +   +
Sbjct: 101 QARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQIAKIRDKAMQNVGSIAEE 160

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            ++EIV+++I   ++ +   S  +  
Sbjct: 161 AALEIVKKMIDVDVSRESVRSAVKAA 186


>gi|163867853|ref|YP_001609057.1| F0F1 ATP synthase subunit B' [Bartonella tribocorum CIP 105476]
 gi|226694365|sp|A9IQI5|ATPF1_BART1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|161017504|emb|CAK01062.1| ATP synthase, B' chain [Bartonella tribocorum CIP 105476]
          Length = 188

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 72/146 (49%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S   F + +  +  P  +   ++   D+I  D+ +A R++++++ ++  Y+ + +
Sbjct: 42  FWLAISFGFFYLFISRVIAPR-IGGVIETRRDRIASDLDQAMRMKQEADTVVETYERELA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA    K  AE   + IE+     L D E++I  ++ +A + + +   +
Sbjct: 101 EARLKAHTIAQAAGEELKQKAELERKEIEERLEKKLADAEKQIAKIRDKAMQNVGSIAEE 160

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            ++ IV+++I   +N +   S+ +  
Sbjct: 161 VTLGIVKKLIDVDINKETVRSVIKTA 186


>gi|46908705|ref|YP_015094.1| F0F1 ATP synthase subunit B [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47094112|ref|ZP_00231836.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858]
 gi|226225081|ref|YP_002759188.1| H+-transporting ATP synthase chain b [Listeria monocytogenes
           Clip81459]
 gi|254825344|ref|ZP_05230345.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194]
 gi|254853938|ref|ZP_05243286.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503]
 gi|254932225|ref|ZP_05265584.1| F0F1 ATP synthase subunit B [Listeria monocytogenes HPB2262]
 gi|254993668|ref|ZP_05275858.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J2-064]
 gi|255519771|ref|ZP_05387008.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-175]
 gi|300764967|ref|ZP_07074955.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017]
 gi|81565274|sp|Q71WP5|ATPF_LISMF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46881977|gb|AAT05271.1| ATP synthase F0, B subunit [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017519|gb|EAL08328.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858]
 gi|225877543|emb|CAS06257.1| Putative H+-transporting ATP synthase chain b [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258607327|gb|EEW19935.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503]
 gi|293583782|gb|EFF95814.1| F0F1 ATP synthase subunit B [Listeria monocytogenes HPB2262]
 gi|293594587|gb|EFG02348.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194]
 gi|300514267|gb|EFK41326.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017]
 gi|308445536|gb|ADO32954.1| AtpF [Listeria monocytogenes]
 gi|332312963|gb|EGJ26058.1| ATP synthase subunit b [Listeria monocytogenes str. Scott A]
          Length = 170

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|326407255|gb|ADZ64326.1| F-type H+-transporting ATPase subunit b [Lactococcus lactis subsp.
           lactis CV56]
          Length = 168

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 67/153 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + 
Sbjct: 16  NIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAEL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ +EE   II  A   A     +      + +    K  ++ I   + EA   +   +A
Sbjct: 76  ARSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D SV+I  ++I Q ++      + +  ++ +  
Sbjct: 136 DISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|295109099|emb|CBL23052.1| ATP synthase F0 subcomplex B subunit [Ruminococcus obeum A2-162]
          Length = 167

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 71/155 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+  +  +   V ++   +   +   LD    K   +I +A + +E+++ +  +Y++  
Sbjct: 13  NFIATICNLFIQVYLIKRFLFKPINEMLDKRKAKADAEIQDAVKAKEEAQAMKAEYEKNM 72

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +E   EI++ A+  A + +EE  +          +  E+ I   K +A   +  +I 
Sbjct: 73  QEAKERANEIVMTAQKTAAVQSEEMLKEASSQVTAMKEKAEKDIAQEKRKAVNEIKGEIG 132

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             +VEI  ++I +++N++ ++ +    I ++    
Sbjct: 133 GMAVEIAGKVIEREINEEDHTKLINDFIENVGEAS 167


>gi|58337086|ref|YP_193671.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus NCFM]
 gi|227903654|ref|ZP_04021459.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus ATCC 4796]
 gi|75420243|sp|Q9RGY5|ATPF_LACAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6652829|gb|AAF22494.1|AF098522_4 F1F0-ATPase subunit b [Lactobacillus acidophilus]
 gi|58254403|gb|AAV42640.1| H+-transporting ATP synthase chain b [Lactobacillus acidophilus
           NCFM]
 gi|227868541|gb|EEJ75962.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus ATCC 4796]
          Length = 169

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I + +++       +   ++    KI  D+  A   R+K+E +  +
Sbjct: 13  IYLGNAIWYLLCFAILM-LLIKHYAWGPVSDMMEKRRQKIISDLDSAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+  ++E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEAAKAKSDALDAA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD SV I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLDD 169


>gi|161507272|ref|YP_001577226.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus DPC 4571]
 gi|226741493|sp|A8YUJ7|ATPF_LACH4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|160348261|gb|ABX26935.1| H+-transporting ATP synthase subunit b [Lactobacillus helveticus
           DPC 4571]
          Length = 169

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++        +   I L +++       +   ++    K+ +D+  A   R+K+E +  +
Sbjct: 13  IYLGNALWYLICFAILL-LLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A    
Sbjct: 72  REAALKNSRQEATQILSDAKANAQKTGKEIVASANEDAAAIRKKANEEAAKAKSDALDSA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             ++AD S+ I  ++I++ ++ +    + ++ I  +  
Sbjct: 132 RDQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELDD 169


>gi|294616245|ref|ZP_06696038.1| ATP synthase F0, B subunit [Enterococcus faecium E1636]
 gi|291590759|gb|EFF22475.1| ATP synthase F0, B subunit [Enterococcus faecium E1636]
          Length = 174

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 70/156 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     + L+ ++       +   L    DKI +D+  A + R  S  +  + +++ 
Sbjct: 17  NVIVVSGSFLILLALLKHFAWEPISDILKKREDKIANDLDSAEQSRINSAKMEQEREQQL 76

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                +  +II  AK   ++  +   ++ ++ +A      +  I   +  A   +   +A
Sbjct: 77  LASRSDAADIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKDDVA 136

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           + S++I  +I++++++ +++ S+  + I  + S ++
Sbjct: 137 ELSLQIAEKILNKELSPEMHESLINQYIEGLGSSNE 172


>gi|313631930|gb|EFR99069.1| ATP synthase F0, B subunit [Listeria seeligeri FSL N1-067]
 gi|313636295|gb|EFS02099.1| ATP synthase F0, B subunit [Listeria seeligeri FSL S4-171]
          Length = 170

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + ++    S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDXKEQSNLIQDYIERLGD 168


>gi|116873897|ref|YP_850678.1| F0F1 ATP synthase subunit B [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461425|sp|A0ALL7|ATPF_LISW6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116742775|emb|CAK21899.1| ATP synthase F0, B subunit [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 170

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|257870210|ref|ZP_05649863.1| predicted protein [Enterococcus gallinarum EG2]
 gi|257804374|gb|EEV33196.1| predicted protein [Enterococcus gallinarum EG2]
          Length = 174

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 61/138 (44%)

Query: 24  RIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRA 83
                + S +    +KI +D+  A + R  +  +  + +EK +    E  EII +AK   
Sbjct: 35  FAWDAISSMMQKREEKIANDLDSAEQSRLNAAKLEKERQEKLANSHSEAAEIIKSAKDSG 94

Query: 84  KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDD 143
           ++  +      ++  +   +     I   K  A + +   +AD S++I  +I+ +++  +
Sbjct: 95  ELSRQNILNETKEEVSRLKEKAHSDITLEKEAALKEVKDDVADLSLQIAEKILGRELTPE 154

Query: 144 VNSSIFEKTISSIQSCHQ 161
            + S+  + I  + S ++
Sbjct: 155 NHESLINQYIEGLGSVNE 172


>gi|16804571|ref|NP_466056.1| F0F1 ATP synthase subunit B [Listeria monocytogenes EGD-e]
 gi|224499886|ref|ZP_03668235.1| F0F1 ATP synthase subunit B [Listeria monocytogenes Finland 1988]
 gi|224503227|ref|ZP_03671534.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-561]
 gi|254828108|ref|ZP_05232795.1| atpF [Listeria monocytogenes FSL N3-165]
 gi|255016866|ref|ZP_05288992.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL F2-515]
 gi|284802971|ref|YP_003414836.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5578]
 gi|284996112|ref|YP_003417880.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5923]
 gi|81768746|sp|Q8Y4B8|ATPF_LISMO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|16412021|emb|CAD00611.1| atpF [Listeria monocytogenes EGD-e]
 gi|258600493|gb|EEW13818.1| atpF [Listeria monocytogenes FSL N3-165]
 gi|284058533|gb|ADB69474.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5578]
 gi|284061579|gb|ADB72518.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5923]
          Length = 170

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R +SE +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|323490917|ref|ZP_08096112.1| ATP synthase B chain [Planococcus donghaensis MPA1U2]
 gi|323395397|gb|EGA88248.1| ATP synthase B chain [Planococcus donghaensis MPA1U2]
          Length = 173

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 68/149 (45%), Gaps = 2/149 (1%)

Query: 9   VFMSLIIFLVI--VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +  +L+IF+ +  ++       L+  +    D I+ +I  A   R +S+ +L + +    
Sbjct: 20  ILATLVIFIGLMLLLKKFAWGPLMGVMQQREDLIKSEIETAENSRLESQKMLEEQRGLLK 79

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               + +EI+  AK + ++  EE        S+   +   Q+I   + +A   +  ++  
Sbjct: 80  DARTQAQEIVENAKKQGEVSREEIITTARAESSRMKEAAVQEIANERDKAISAVREEVVA 139

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
            S+    +++ ++++++ N  +  +TI+ 
Sbjct: 140 LSLLAATKVLEKEISEEDNRQLINETIAK 168


>gi|254831044|ref|ZP_05235699.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 10403S]
          Length = 170

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R +SE +L + K
Sbjct: 14  FGDAFFTLFAFSILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEREQSNLIQDYIERLGD 168


>gi|195977923|ref|YP_002123167.1| F0F1 ATP synthase subunit B [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|226695877|sp|B4U2D7|ATPF_STREM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|195974628|gb|ACG62154.1| ATP synthase B chain AtpF [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 164

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 62/154 (40%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + + L A + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQQLEKEGQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +I+ AAK   K           + +          I + K EA   +  +++
Sbjct: 71  EASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAVALTDIEHSKSEAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + ++ +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA 164


>gi|16801738|ref|NP_472006.1| F0F1 ATP synthase subunit B [Listeria innocua Clip11262]
 gi|255023753|ref|ZP_05295739.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-208]
 gi|81774204|sp|Q927W0|ATPF_LISIN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|16415213|emb|CAC97903.1| atpF [Listeria innocua Clip11262]
 gi|313622353|gb|EFR92833.1| ATP synthase F0, B subunit [Listeria innocua FSL J1-023]
          Length = 170

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKADIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|315283685|ref|ZP_07871801.1| ATP synthase F0, B subunit [Listeria marthii FSL S4-120]
 gi|313612673|gb|EFR86699.1| ATP synthase F0, B subunit [Listeria marthii FSL S4-120]
          Length = 170

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R +SE +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARIESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++   SV I  ++I + +++   S++ +  I  +  
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGD 168


>gi|148543698|ref|YP_001271068.1| ATP synthase F0, B subunit [Lactobacillus reuteri DSM 20016]
 gi|184153108|ref|YP_001841449.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194468261|ref|ZP_03074247.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227363323|ref|ZP_03847452.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227544497|ref|ZP_03974546.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300909315|ref|ZP_07126776.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|325682069|ref|ZP_08161587.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
 gi|226741494|sp|A5VIQ7|ATPF_LACRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741495|sp|B2G687|ATPF_LACRJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148530732|gb|ABQ82731.1| ATP synthase F0 subcomplex B subunit [Lactobacillus reuteri DSM
           20016]
 gi|154705566|gb|ABS84209.1| ATP synthase F0 B subunit [Lactobacillus reuteri]
 gi|183224452|dbj|BAG24969.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194453114|gb|EDX42012.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227071630|gb|EEI09924.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227185520|gb|EEI65591.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300893180|gb|EFK86539.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|324978713|gb|EGC15662.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
          Length = 172

 Score = 77.3 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 62/143 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L+++V       +   +   ADKI +DI  A R RE +E +  + + +     +E  
Sbjct: 25  FIILMLLVKHFAWKPVTDMMKKRADKIANDIDNAARSRESAEKMAAKRQAELQSSRQEAA 84

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           EI+  AK   +    +  +  ++ +    +  ++     + +A       +A+ S+EI  
Sbjct: 85  EIVSNAKKSGETQRAQIVETAQKDAQALKQQAQKDAEQARRDALNSAKDDVANLSIEIAS 144

Query: 134 EIISQKMNDDVNSSIFEKTISSI 156
           ++I +++  D    + +  I  +
Sbjct: 145 KLIQKELKADDQKELIDSYIEGL 167


>gi|225868745|ref|YP_002744693.1| ATP synthase B chain [Streptococcus equi subsp. zooepidemicus]
 gi|225702021|emb|CAW99608.1| ATP synthase B chain [Streptococcus equi subsp. zooepidemicus]
          Length = 164

 Score = 77.3 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 62/154 (40%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + + L A + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKAFAWGAIEAILQARSQQISQDIDQAEQARLNAQQLEKEGQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +I+ AAK   K           + +          I + K EA   +  +++
Sbjct: 71  EASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAAALTDIEHSKSEAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + ++ +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA 164


>gi|15082069|gb|AAK84015.1|AF393838_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 77.3 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 66/153 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
             +V     I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + 
Sbjct: 16  NIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAEL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +  +EE   II  A   A     +      + +    K  ++ I   + EA   +   +A
Sbjct: 76  AASKEEAANIIQVANDTASQNRAKVLAIANEEATSLKKRAQEDIEQERKEALNTVKGDVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D SV+I  ++I Q ++      + +  ++ +  
Sbjct: 136 DISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|224477096|ref|YP_002634702.1| F0F1 ATP synthase subunit B [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421703|emb|CAL28517.1| ATP synthase B chain [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 174

 Score = 77.3 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 67/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  ++ +I L ++        L   +D     I  DI +A + +  ++ +  + ++   
Sbjct: 23  LVTLITFLILLALL-KKFAWGPLKQVMDKREQDINKDIDDAEQAKINAQKLEEENRQTLR 81

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + + E ++I+  AK +A+   E+      Q +   ++  + +I+  K  A   +  +++ 
Sbjct: 82  ETQNEVQKILEEAKVQARDQHEQIIHEANQRANGMIETAQSEINSQKERAISEINDEVSK 141

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  +I+ + +++     + +K I  +  
Sbjct: 142 LSVLIASKILQKDISEKDQKELIDKYIKEVGD 173


>gi|225870299|ref|YP_002746246.1| ATP synthase B chain [Streptococcus equi subsp. equi 4047]
 gi|225699703|emb|CAW93431.1| ATP synthase B chain [Streptococcus equi subsp. equi 4047]
          Length = 164

 Score = 77.3 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 62/154 (40%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++    +I L++++       + + L A + +I  DI +A + R  ++ +  + +   
Sbjct: 11  NFILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQQLEKEGQANL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +I+ AAK   K           + +          I + K EA   +  +++
Sbjct: 71  EASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAAALTDIEHSKSEAISAVKTEMS 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           D +V +  +I+   ++    S + ++ +  +   
Sbjct: 131 DLTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA 164


>gi|108804478|ref|YP_644415.1| ATP synthase F0 subunit B [Rubrobacter xylanophilus DSM 9941]
 gi|122381737|sp|Q1AVH5|ATPF_RUBXD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|108765721|gb|ABG04603.1| ATP synthase F0, B subunit [Rubrobacter xylanophilus DSM 9941]
          Length = 174

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L ++ Y  +  I+   +     +I   I EA + R ++  +L +Y+ +  
Sbjct: 16  FWEVVTFLILLALL-YRYVYPIIRDQIQKRQAQIEQAIEEAEKTRAEARELLEEYRRQIE 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E R+I+  A+ +AK   E   +   +     ++   ++I   +  A R +  ++AD
Sbjct: 75  AARGEARQILDEARRQAKAQRERAREEAREEGDRIIQRAREEISRERDAALREVRREVAD 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +     +I ++++   +  +  + + S+++
Sbjct: 135 MVIMASSRVIGRELDAAEHERLINEALESLEA 166


>gi|227529633|ref|ZP_03959682.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus vaginalis
           ATCC 49540]
 gi|227350423|gb|EEJ40714.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus vaginalis
           ATCC 49540]
          Length = 172

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 61/143 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++       +   +   ADKI  DI  A + RE +E +  + + +     +E  
Sbjct: 25  FIILMLLIKHFAWKPVTDMMKKRADKIASDIDNAAKSRENAEKMAAKRQAELQNSHQEAA 84

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +I+  AK   +    +  +  +  +    +  ++     + +A       +A+ S+EI  
Sbjct: 85  DIVNNAKKSGEAQRTQIVEAAQNDAQALKQRAQEDAKQARRDALNGAKDDVANLSIEIAS 144

Query: 134 EIISQKMNDDVNSSIFEKTISSI 156
           ++I +++N D    + +  I  +
Sbjct: 145 KLIHKELNADDQKELIDSYIEGL 167


>gi|270291024|ref|ZP_06197247.1| ATP synthase F0, B subunit [Pediococcus acidilactici 7_4]
 gi|304385300|ref|ZP_07367645.1| ATP synthase F0 sector subunit B [Pediococcus acidilactici DSM
           20284]
 gi|270280420|gb|EFA26255.1| ATP synthase F0, B subunit [Pediococcus acidilactici 7_4]
 gi|304328507|gb|EFL95728.1| ATP synthase F0 sector subunit B [Pediococcus acidilactici DSM
           20284]
          Length = 173

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +     +  ++ + ++        + + L   AD+I +DI  A + +++++ +  Q
Sbjct: 15  LYVGDMLFYAILFVVLMALIAKF-AWGPVNAMLKERADRISNDIESAEQAKKEAQKLAEQ 73

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            KE       E   II  AK+      E    N +  +       +Q I   + +A +  
Sbjct: 74  RKEALDNSHAEATTIINNAKNSGAKERELIVGNAQAEAKSLKDKAKQDIEQERADALKSA 133

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              IA  S+EI  ++I ++++++    + +  I  +   
Sbjct: 134 QDDIASLSIEIASKVIKKELDENSQKELIDSYIEGLGES 172


>gi|312869576|ref|ZP_07729727.1| ATP synthase F0, B subunit [Lactobacillus oris PB013-T2-3]
 gi|311094862|gb|EFQ53155.1| ATP synthase F0, B subunit [Lactobacillus oris PB013-T2-3]
          Length = 172

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 63/147 (42%), Gaps = 1/147 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++ II + ++V       +   +   ADKI  DI  A + RE +E +  + + +     
Sbjct: 22  IVTFIILM-LLVKHFAWGPVTDMMKKRADKIASDIDNAAKSRESAEKMAAKRQAELQNSR 80

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E  +I+  AK  A+    +  +  +  +    +  +Q     + +A       +A+ S+
Sbjct: 81  QEAADIVNNAKKSAETQRAQIVEAAQNDAQALKQQAQQDAEQARRDALNGAKDDVANLSI 140

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSI 156
           EI  ++I +++  D    + +  I  +
Sbjct: 141 EIASKLIQKELKADDQKELIDSYIEGL 167


>gi|83591198|ref|YP_431207.1| ATP synthase F0, B subunit [Moorella thermoacetica ATCC 39073]
 gi|123523801|sp|Q2RFX5|ATPF_MOOTA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|1929509|gb|AAB51462.1| ATP synthase subunit b [Moorella thermoacetica]
 gi|83574112|gb|ABC20664.1| ATP synthase F0 subcomplex B subunit [Moorella thermoacetica ATCC
           39073]
          Length = 168

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 66/144 (45%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ ++ ++Y+ +   L   L     +I  ++ +A   REK+ENIL +Y+++     +E +
Sbjct: 22  LLVVMGLLYVFLYKPLGKVLADREARIEGNLNDAAAAREKAENILAEYRQQLQGARQEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            I+  A   A+    E      + +   L    ++I   K +A   + ++ A  ++    
Sbjct: 82  AILDRATKMAEETRAEIINRAREEAERTLAQARREIEGEKSKALAAIRSEAASLAILAAG 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQ 157
           +++ + +  D    +  + I+ ++
Sbjct: 142 KVLERSLTPDDQERLAREAIAEVE 165


>gi|332295439|ref|YP_004437362.1| ATP synthase subunit b [Thermodesulfobium narugense DSM 14796]
 gi|332178542|gb|AEE14231.1| ATP synthase subunit b [Thermodesulfobium narugense DSM 14796]
          Length = 161

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F   +S +IF  +     +P  + + L      I   I +AR+ RE++E +L + K++ 
Sbjct: 9   EFWTIVSFLIFFFLFAKFVVPP-INNALKEREKAIAGAIEQARKEREEAEKLLQESKKEL 67

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +    + +I+  A+  A+ + ++  Q  ++ +   +    + +   K E    L  ++ 
Sbjct: 68  EETRARSSKIVEEARAYAEEVKKDIIQKAKEEAQKIVDSAAKDLDRAKAEVIAELKVEVV 127

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + ++ +  +++ ++++ +  +    + +  I  
Sbjct: 128 NLTISLTEKLLEKELDKNAQTKFVTEYLQKIGK 160


>gi|296536542|ref|ZP_06898629.1| ATP synthase F0 sector subunit B [Roseomonas cervicalis ATCC 49957]
 gi|296263138|gb|EFH09676.1| ATP synthase F0 sector subunit B [Roseomonas cervicalis ATCC 49957]
          Length = 168

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 70/157 (44%), Gaps = 1/157 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D  F V +S +IF+V++    + +     LDA A+KIR ++ EA RLR ++E +  Q +
Sbjct: 9   LDPKFWVAISFVIFVVLLGRT-MWAKATEALDARANKIRAELDEAGRLRAEAEAMRRQAE 67

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
              +    E   +I  AK  A+ LA       E  +    +    +I   +  A   +  
Sbjct: 68  ADRAAAAAEAEGMIARAKAEAERLAAAAAAEAEASAKRRERMAMDRIAAAEAGAVAEVRQ 127

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             A  +    RE+I+  ++   ++ + ++ IS +   
Sbjct: 128 AAASIAASAAREVIATTLDATGDAKLVDQAISDLPRA 164


>gi|332637154|ref|ZP_08416017.1| ATP synthase B chain [Weissella cibaria KACC 11862]
          Length = 171

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 64/157 (40%), Gaps = 1/157 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +       V ++ ++ + +++       ++  +++ ADK+  D+  A   R+++E    +
Sbjct: 14  LALGNMLFVLVAFLVLM-LLIKHFAWGPVVKMMESRADKVSRDLDSAEEARKQAEADAAE 72

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +      +   II  AK  A    ++   +    +         +I   + EA   +
Sbjct: 73  RSAQLQTARTDANGIIADAKTAAGKQRDQIVADAHAAAQATKDQASAQIEQERAEAMAGV 132

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
              +A+ SV I ++II +++  D   ++ +  I  + 
Sbjct: 133 KNDVAELSVSIAQKIIQKELKLDDQKALIDAYIEGLG 169


>gi|323339968|ref|ZP_08080235.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
 gi|323092610|gb|EFZ35215.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
          Length = 174

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/151 (18%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++ ++ +   V       +   ++  A+KI +DI  A   R+K+E +  Q +E      
Sbjct: 22  LLTFVVLIAA-VKHFAWGPVTEMMEKRANKIANDIDSAEDARKKAEELAAQREEALKDSH 80

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E  +II  AK   +        + +        + ++ I   + EA   +   +A+ S+
Sbjct: 81  VEASKIIDRAKQNGEQQKASIVDSAQSEVMTMKDNAKKDIEQQRQEAMSGIKNDVAELSI 140

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           EI  +II +++N +   ++ +  I  +   +
Sbjct: 141 EIASKIIQKELNAEDQKALVDSYIEGLGKQN 171


>gi|114798056|ref|YP_760623.1| ATP synthase F0 subunit B family protein [Hyphomonas neptunium ATCC
           15444]
 gi|123027989|sp|Q0C0X0|ATPF_HYPNA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114738230|gb|ABI76355.1| ATP synthase F0, B subunit family protein [Hyphomonas neptunium
           ATCC 15444]
          Length = 189

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 65/139 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF+ F+ ++ FL+I   +     +L  LD  A  IR ++ EA  LRE++   L   + + 
Sbjct: 38  TFVAFLCMVTFLLIAARMGAFKTILGGLDTRASNIRKELEEAASLREQAAEALALAERRA 97

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              ++E   II  AK  AK + EE  +++ +  +        +I   + EA   +    A
Sbjct: 98  QDADKEAEAIIDQAKRDAKAMLEEARRDLAEKISRREAQAAARITRAETEATSEVRRAAA 157

Query: 126 DFSVEIVREIISQKMNDDV 144
           D +    R I+S++ + D 
Sbjct: 158 DAATAAARRILSEQTSVDQ 176


>gi|237744084|ref|ZP_04574565.1| ATP synthase subunit B [Fusobacterium sp. 7_1]
 gi|229431313|gb|EEO41525.1| ATP synthase subunit B [Fusobacterium sp. 7_1]
          Length = 163

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 77/153 (50%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIVV-YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  + L IV  Y + P  +   ++   +KI  ++  A + RE+SE++L + + + 
Sbjct: 11  FWQIINFFLLLFIVKKYFKEP--ISKIMNKRKEKIETELVTATKNREESEHLLKEAETQI 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E  EII  A+ +A+  A        +     +K  E ++  MK +AK  L  ++ 
Sbjct: 69  NSSRKEASEIIKNAQRKAEEEARNLISEARENRENIIKATEFEVTKMKNDAKEELSREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D + E+  +II +K++D   +S+ +K IS +  
Sbjct: 129 DLAAELAEKIIKEKVDDIQETSLIDKFISEVGE 161


>gi|407182|emb|CAA81458.1| adenosine triphosphatase [Streptococcus oralis ATCC 35037]
          Length = 127

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 53/117 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ 
Sbjct: 11  NFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDEL 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +    E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  
Sbjct: 71  AGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKG 127


>gi|260494331|ref|ZP_05814462.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_33]
 gi|260198477|gb|EEW95993.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_33]
          Length = 163

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 77/153 (50%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIVV-YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  + L IV  Y + P  +   ++   +KI  ++  A + RE+SE++L + + + 
Sbjct: 11  FWQIINFFLLLFIVKKYFKEP--ISKIMNKRKEKIETELVTATKNREESEHLLKEAETQI 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E  EII  A+ +A+  A        +     +K  E ++  MK +AK  L  ++ 
Sbjct: 69  NSSRKEASEIIKNAQRKAEEEARNLINEARENRENIIKATEFEVTKMKNDAKEELSREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D + E+  +II ++++D   +S+ +K IS +  
Sbjct: 129 DLAAELAEKIIKERVDDIQETSLIDKFISEVGE 161


>gi|289643103|ref|ZP_06475233.1| ATP synthase F0, B subunit [Frankia symbiont of Datisca glomerata]
 gi|289507067|gb|EFD28036.1| ATP synthase F0, B subunit [Frankia symbiont of Datisca glomerata]
          Length = 196

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/149 (12%), Positives = 66/149 (44%), Gaps = 2/149 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  + +    + ++   +       +D+I  ++  A R + ++E++L+ Y+ + ++ +
Sbjct: 33  ILAFGLLVAFFFW-KVYPQIRRTYAERSDRIEGNLARAERTQREAEDLLVSYRRQLAEAQ 91

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E   I   A+ + + + +       +  A      E ++   + +    +  +I + ++
Sbjct: 92  DEAGRIRQDAREQGQQILDSLRAQAGEEVAEIKARGEAQLAAERAQVVAQIRREIGEIAL 151

Query: 130 EIVREIISQKMN-DDVNSSIFEKTISSIQ 157
           E+  +I+  ++  DD    + +  I+ + 
Sbjct: 152 ELATKIVGHELQRDDRQRQLIDDFIAGLD 180


>gi|259503686|ref|ZP_05746588.1| ATP synthase F0 [Lactobacillus antri DSM 16041]
 gi|259168318|gb|EEW52813.1| ATP synthase F0 [Lactobacillus antri DSM 16041]
          Length = 172

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 62/147 (42%), Gaps = 1/147 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++ II + ++V       +   +   ADKI  DI  A R RE +  +  + + +     
Sbjct: 22  IVTFIILM-LLVKHFAWGPVTDMMKKRADKIASDIDNAARSRESAAKMAAKRQAELQNSR 80

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E  +I+  AK  A+    +  +  +  +    +  +Q     + +A       +A+ S+
Sbjct: 81  QEAADIVNNAKKSAETQRAQIVEAAQNDAQALKQQAQQDAEQARRDALNGAKDDVANLSI 140

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSI 156
           EI  ++I +++  D    + +  I  +
Sbjct: 141 EIASKLIQKELKADDQKELIDSYIEGL 167


>gi|256028110|ref|ZP_05441944.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp. D11]
 gi|289766051|ref|ZP_06525429.1| ATP synthase subunit B [Fusobacterium sp. D11]
 gi|289717606|gb|EFD81618.1| ATP synthase subunit B [Fusobacterium sp. D11]
          Length = 163

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 77/153 (50%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIVV-YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  + L IV  Y + P  +   ++   +KI  ++  A + RE+SE++L + + + 
Sbjct: 11  FWQIINFFLLLFIVKKYFKEP--ISKIMNKRKEKIETELVTATKNREESEHLLKEAETQI 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E  EII  A+ +A+  A        +     +K  E ++  MK +AK  L  ++ 
Sbjct: 69  NSSRKEASEIIKNAQRKAEEEARNLISEARENRENIIKATEFEVTKMKNDAKEELSREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D + E+  +II ++++D   +S+ +K IS +  
Sbjct: 129 DLAAELAEKIIKERVDDIQETSLIDKFISEVGE 161


>gi|300024394|ref|YP_003757005.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526215|gb|ADJ24684.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 187

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 64/149 (42%), Gaps = 1/149 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ +  L ++  + +P  +   L+   D+I+ D+  A RL+++++  L  Y++  +
Sbjct: 40  FWLVLTFVALLFVMSRIALPR-VGDVLEERRDRIKRDLESAARLKDETDAALANYEKALA 98

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
                   I    + +     E     ++   A+ L+D E +I   K +A   +     +
Sbjct: 99  DARSNASGIAKETREKLAAETEAERHRVDAQIAVKLQDAEARISTTKSKAVSAIGEVATE 158

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
            +  +V ++I   ++ +    + +   + 
Sbjct: 159 TARAVVSKLIGHDVSPEDVKKVLQPAPAE 187


>gi|327540202|gb|EGF26792.1| ATPase, F0 complex, subunit B/B [Rhodopirellula baltica WH47]
          Length = 242

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 72/154 (46%), Gaps = 2/154 (1%)

Query: 9   VFMSLIIFLVIVVY--LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
              +LIIFL ++      +   +L  L A  +KIR+D+  A +   +++ +L  Y+ K  
Sbjct: 89  AIWNLIIFLCVLAILSKFVWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLD 148

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   + + ++  A+  A+   ++     +  +A   +     I   K  A   +  + + 
Sbjct: 149 EAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSK 208

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++++ R ++ ++++ D ++ +  +++  + S +
Sbjct: 209 LAMQVARSVVGRELSADDHADLIRQSMERLPSQN 242


>gi|300174069|ref|YP_003773235.1| ATP synthase F0 subunit B [Leuconostoc gasicomitatum LMG 18811]
 gi|299888448|emb|CBL92416.1| ATP synthase F0, B subunit [Leuconostoc gasicomitatum LMG 18811]
          Length = 169

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S ++ ++I+  +     L   LD  ADKI  DI  A   R+ +E + +Q + + +
Sbjct: 18  LFIIISFLLLMLILKKV-AYGPLTKVLDERADKISADIDGAEIARQDAEKLAVQRQSELA 76

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              ++  +++  AK  A+  ++         + L  K  +     +K +A       +A 
Sbjct: 77  DTRQQATKVVADAKASAQKQSDSLISTASDRATLINKQAQTDAEKLKEDAISNAKNDVAA 136

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  +++ ++++ +   ++ +  IS +++
Sbjct: 137 LSVAIASKLMQKELSLNDQQALIDAYISDLET 168


>gi|197104053|ref|YP_002129430.1| ATP synthase F0, B subunit [Phenylobacterium zucineum HLK1]
 gi|226694348|sp|B4RF13|ATPF_PHEZH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|196477473|gb|ACG77001.1| ATP synthase F0, B subunit [Phenylobacterium zucineum HLK1]
          Length = 167

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 78/159 (49%), Gaps = 1/159 (0%)

Query: 4   DETFLVFMSLIIFLVIVVY-LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           +  F V   L+IFL IV +  +    + + LDA A  I+ ++ EA R+R+++  +L   +
Sbjct: 9   EAEFWVGAGLLIFLGIVFFGAKAHKAIAAALDAKAASIQANLDEAARIRDEARRLLEGLQ 68

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            + ++ E + +E++  A+ + +    E    +E+      +  EQKI   + +A   + A
Sbjct: 69  AERAEAERQAKEMLATAEVQVRQFEAEAKAKLEEAIERRRRMAEQKIATAEAQAAAEVKA 128

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
             A+ + ++   +++Q++       + ++ I  + S  Q
Sbjct: 129 AAAELAAQMAESVLAQRLTGAKADPLVDRAIGQLASKLQ 167


>gi|326693455|ref|ZP_08230460.1| ATP synthase F0, B subunit [Leuconostoc argentinum KCTC 3773]
          Length = 169

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S ++ +VI+  +     L   LD  A KI  DI  A + R+++E +  Q + + +
Sbjct: 18  LFIIISFLVLMVILKKV-AYGPLTKVLDERAAKISSDIDGAEKARQEAEKLAAQRQSELA 76

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              ++  +++  AK  A+  +E       + + L  +  +     +K +A       +A 
Sbjct: 77  DTRQQATKVVADAKASAQKQSEALLAAASERATLINQQAQTDAEKLKEDAISNAKDDVAA 136

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  +++ ++++ D   ++ +  IS +++
Sbjct: 137 LSVAIASKLMQKELSLDDQQALIDAYISDLET 168


>gi|253579151|ref|ZP_04856421.1| ATP synthase F0 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849249|gb|EES77209.1| ATP synthase F0 [Ruminococcus sp. 5_1_39BFAA]
          Length = 167

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 71/155 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+  +  +   V ++   +   +   L+    K    I +A + +E+++ +  +Y++  
Sbjct: 13  NFIATICNLFIQVYLIKRFLFKPINEMLEKRKAKADAQIQDAVKAKEEAQAMKAEYEKNM 72

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +    +I++ A+  A I +EE  +          +  E+ I   K +A   +  +I 
Sbjct: 73  QEAKNRANDIVMTAQKTAAIQSEEMLKEASSQVTAMKEKAEKDIAQEKRKAVNEIKGEIG 132

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             +VEI  ++I ++++++ ++ + ++ I ++    
Sbjct: 133 GMAVEIAGKVIEREISEEDHAKLIDEFIENVGEAS 167


>gi|325107759|ref|YP_004268827.1| ATP synthase subunit b [Planctomyces brasiliensis DSM 5305]
 gi|324968027|gb|ADY58805.1| ATP synthase subunit b [Planctomyces brasiliensis DSM 5305]
          Length = 233

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 63/136 (46%)

Query: 23  LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR 82
                 +   LD     IR +I +A   R +SE +L +   +   V++E REI+  A+  
Sbjct: 96  KFAWGPVTEGLDQREANIRRNIEDAEASRVRSEELLAERSAQLDAVQDEVREILAEARRD 155

Query: 83  AKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMND 142
           A+    E   + ++ +    +    +++  + +A   L++ +++        ++ + +ND
Sbjct: 156 AEHTKSEILADAQKEAEATKRRAIDEVNRARDQALNDLFSTMSNQVATATEHVLGRAIND 215

Query: 143 DVNSSIFEKTISSIQS 158
           +  + + +++++ + +
Sbjct: 216 EDRTRLIDQSLAELSA 231


>gi|226741483|sp|A4ITJ3|ATPF_GEOTN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 180

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 68/145 (46%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++       L+  +    + I ++I +A + R+++E +L + +E   +  +E +
Sbjct: 31  FILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSRQEAQ 90

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            I+  A+  A+   E+   +    +    +  +Q+I   K +A   L  ++A  SV I  
Sbjct: 91  TILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSVLIAS 150

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I +++ +     + E  I  IQ 
Sbjct: 151 KVIERELTEQDQRKLIEAYIKDIQE 175


>gi|89897662|ref|YP_521149.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219670791|ref|YP_002461226.1| ATP synthase F0 subunit beta [Desulfitobacterium hafniense DCB-2]
 gi|122480523|sp|Q24MN7|ATPF_DESHY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|89337110|dbj|BAE86705.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219541051|gb|ACL22790.1| ATP synthase F0, B subunit [Desulfitobacterium hafniense DCB-2]
          Length = 164

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 72/159 (45%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +HFD T +V +   + LV ++     + L++ ++    +I  +I  A + R ++E I  +
Sbjct: 4   IHFDLTLVVQVLSFLLLVYILRRFAWNPLINMMEERRSQIEANIANAEKERLQAEQIKRE 63

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+E+  K  +E +E+I  A   ++  A E        +    +     I   +  A   +
Sbjct: 64  YQEEMRKARQEAQEVIAKATKLSEQRAAEILAAAHGEAEKIKQSALADIERERDRAIAQV 123

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            A++AD SV +  +II + ++      + E+ I  +   
Sbjct: 124 QAQVADLSVAVAEKIIRKNLDVRGQEDMIEQFIQEVGEL 162


>gi|323463887|gb|ADX76040.1| ATP synthase F0, B subunit [Staphylococcus pseudintermedius ED99]
          Length = 172

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 71/151 (47%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V ++  + L+ ++       L   +D     I  DI +A R +  ++ +  + ++K  +
Sbjct: 21  IVTVATFLILLALLRKFAWGPLKKVMDDRERSINQDIDDAERAKLNAQRLEEENRQKLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E  +I+  AK +A+   EE      Q +   L+  + +I   K  A   +  ++++ 
Sbjct: 81  TQDEVHKILEDAKLQARRQQEEILHEANQRANGMLETAQSEIKSEKERALAEINNQVSEL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           SV I  +++ +++++    ++ EK +  +  
Sbjct: 141 SVLIASKVLRKEISEQDQKALIEKYVKEVGD 171


>gi|196249756|ref|ZP_03148452.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16]
 gi|196210632|gb|EDY05395.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16]
          Length = 180

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 69/145 (47%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++ +     L+  +    + I ++I +A + R+++E +L + +E   +  +E +
Sbjct: 31  FILLMLLLRIFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSRQEAQ 90

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            I+  A+  A+   E+   +    +    +  +Q+I   K +A   L  ++A  SV I  
Sbjct: 91  TILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSVLIAS 150

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I +++ +     + E  I  IQ 
Sbjct: 151 KVIERELTEQDQRKLIEAYIKDIQE 175


>gi|27468622|ref|NP_765259.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis ATCC 12228]
 gi|57867660|ref|YP_189278.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis RP62A]
 gi|293366071|ref|ZP_06612759.1| ATP synthase F0 sector subunit B [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81673862|sp|Q5HMB5|ATPF_STAEQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81842667|sp|Q8CNJ3|ATPF_STAES RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|27316169|gb|AAO05303.1|AE016749_249 ATP synthase B chain [Staphylococcus epidermidis ATCC 12228]
 gi|57638318|gb|AAW55106.1| ATP synthase F0, B subunit [Staphylococcus epidermidis RP62A]
 gi|291319794|gb|EFE60152.1| ATP synthase F0 sector subunit B [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329734124|gb|EGG70442.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU045]
          Length = 171

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 72/154 (46%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            TF+  ++ +I + I++       L   +D     I  DI +A + +  ++ +  + ++ 
Sbjct: 18  TTFVTLVTFVILI-ILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKT 76

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  ++
Sbjct: 77  LKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQV 136

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++ SV I  +++ +++++     + EK +     
Sbjct: 137 SELSVLIASKVLRKEISEQDQKELVEKYLKEAGD 170


>gi|226694483|sp|Q7UFB9|ATPF2_RHOBA RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
          Length = 242

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 72/154 (46%), Gaps = 2/154 (1%)

Query: 9   VFMSLIIFLVIVVY--LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
              +LIIFL ++      +   +L  L A  +KIR+D+  A +   +++ +L  Y+ K  
Sbjct: 89  AIWNLIIFLCVLAILSKFVWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLD 148

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   + + ++  A+  A+   ++     +  +A   +     I   K  A   +  + + 
Sbjct: 149 EAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSK 208

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++++ R ++ ++++ D ++ +  +++  + S +
Sbjct: 209 LAMQVARSVVGRELSADDHADLIRQSMERLPSQN 242


>gi|13476165|ref|NP_107735.1| F0F1 ATP synthase subunit B' [Mesorhizobium loti MAFF303099]
 gi|81776792|sp|Q986D2|ATPF1_RHILO RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|14026925|dbj|BAB53521.1| FoF1 ATP synthase, subunit B [Mesorhizobium loti MAFF303099]
          Length = 193

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 66/144 (45%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   +D   D+I  D+ +A +L+ +++  +  Y+++ +
Sbjct: 47  LWLAITFGLFYLFLKKVAMPR-IGGIIDVRNDRISQDLDQASKLKGEADAAVAAYEQELA 105

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + ++    I   A   AK  AE   + IE      L + E +I  +K  A + + +   D
Sbjct: 106 EAKKNASSIGQQAADAAKAEAETARKKIEAALDEKLGEAEARISSIKANAMKEVGSIAED 165

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV  ++  K +    ++  +
Sbjct: 166 TASAIVEALVGGKASKAEIAAAVK 189


>gi|319784763|ref|YP_004144239.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170651|gb|ADV14189.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 199

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 66/144 (45%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   +D   D+I  D+ +A RL+ +++  +  Y+++ +
Sbjct: 53  LWLAITFGLFYLFLKRVVMPR-VGGIIDVRNDRITQDLDQAARLKGEADAAVAAYEQELA 111

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + + +   I   A   AK  A+   + +E      L + E +I  +K  A + + +   D
Sbjct: 112 EAKTKANAIGQQANDAAKAEADTARKKVEAALDAKLGEAEARISSIKANAMKEVGSIAED 171

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV  ++  K +    ++  +
Sbjct: 172 TASAIVEALVGGKASKAEIAAAVK 195


>gi|153809941|ref|ZP_01962609.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174]
 gi|149834119|gb|EDM89199.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174]
          Length = 167

 Score = 74.6 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 72/155 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+  +  +   V ++   +   +   L+    K   +I +A + +E++E +  +Y++  
Sbjct: 13  NFIATICNLFIQVYLIKRFLFKPVNEMLEKRRAKADAEIQDAVKAKEEAEVMKAEYEKNM 72

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +E+  +I+L A+  A + +EE  +          +  E+ I   + +A   +  +I 
Sbjct: 73  QEAKEKANDIVLTAQKTAAVQSEEMLKEASSQVTAMKEKAEKDIAQERRKAVNEIKGEIG 132

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             +VEI  ++I +++N++ ++ +    I ++    
Sbjct: 133 GMAVEIAGKVIEREINEEDHTKLINDFIENVGEAS 167


>gi|114567892|ref|YP_755046.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|122317241|sp|Q0AUC9|ATPF_SYNWW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114338827|gb|ABI69675.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 173

 Score = 74.6 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ L  ++Y      + + L+   + I   +  A  ++ + E +  +     ++
Sbjct: 21  WSAVNFLVLLA-LMYKFAYGPINNMLEQRTNAIEGSLKHAEEVKLEVEQMRKETASNLAE 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E +EI+  A   A+    E     ++ S L       +I     +AK  L       
Sbjct: 80  SRKEAQEIVARATKAAEESKNEIIAKAKEESTLIKNKAAAEIQAATEQAKLELKDSAVSL 139

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           ++    +++S+ +NDD + ++ ++ ++     
Sbjct: 140 AILAAEKVLSRAINDDDHKNLVKQFVNEAGDL 171


>gi|325291358|ref|YP_004267539.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324966759|gb|ADY57538.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 185

 Score = 74.6 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 69/157 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + FD T    M   + LV ++       L+  ++     I D++  A   R+++E I  +
Sbjct: 25  IGFDYTLPAQMLSFLILVYILAKFAWRPLMDMMEKRRQFIEDNLSRAENERKEAEKIKKE 84

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+E+  K  +E +EII  A   ++  A E        S    +     I   +  A   +
Sbjct: 85  YQEEMRKARQEAQEIINKATKISEERASEILAEARIDSEKTKQAALADIQRERDNAVLEV 144

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A++AD SV +  +I+  K+N +   ++ ++ I  + 
Sbjct: 145 KAQVADMSVAVAEKILRAKLNLEGQETLIDQFIQEVG 181


>gi|325832082|ref|ZP_08165179.1| ATP synthase F0, B subunit [Eggerthella sp. HGA1]
 gi|325486403|gb|EGC88855.1| ATP synthase F0, B subunit [Eggerthella sp. HGA1]
          Length = 206

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 67/156 (42%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  + + I L IV+         + L+     I+D + ++ + R +SE +L +YK +
Sbjct: 49  AEFIPMLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKSEQARVESERVLEEYKRQ 108

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               + +  +I+  AK   + +  +     +  +   ++     I   K  A   L   +
Sbjct: 109 LEDAKAQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHNAIEAEKKAAISELQGSV 168

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           AD S+ +   +I + +ND  +  I E+ ++   S +
Sbjct: 169 ADLSISVASRLIGEDLNDAEHRKIIERYVNEAGSFN 204


>gi|162457649|ref|YP_001620016.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce
           56']
 gi|161168231|emb|CAN99536.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce
           56']
          Length = 333

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 62/155 (40%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             FL  +     L ++V       +   L      I  ++  A RL++++E  L +Y++K
Sbjct: 163 PPFLASVLNFGLLALIVVRFGRKPIAEALKKRKQTITQELDNASRLKQEAELRLEEYEDK 222

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +++EE   E+      +A++         EQ      +D E +       A+ +L  + 
Sbjct: 223 LTRLEETLAELKAEHAAQAEVEKAHVLAEAEQRRVRMRRDAEFRAEQELKAARAMLLQEA 282

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +V    E++ Q++       + E  + +I + 
Sbjct: 283 VQNAVVAAEELLRQRIGQQDLDRVNEDYLKAIPAA 317


>gi|153007847|ref|YP_001369062.1| F0F1 ATP synthase subunit B' [Ochrobactrum anthropi ATCC 49188]
 gi|226694372|sp|A6WW79|ATPF1_OCHA4 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|151559735|gb|ABS13233.1| H+transporting two-sector ATPase B/B' subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 205

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 70/146 (47%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFMSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELT 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+      E      LK+ E++I  +K +A   +     +
Sbjct: 118 QARTKAASIAEAAREKGKGEADAERATAEAALERKLKEAEERIAAIKAKAMNDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            + EIV +++  K +    ++  + +
Sbjct: 178 TTAEIVEQLLGTKADKASVTAAVKAS 203


>gi|2984783|gb|AAC08031.1| ATP synthase subunit B [Brucella melitensis]
          Length = 129

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 47/93 (50%)

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A   
Sbjct: 34  RKPEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRASAV 93

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +V     I+++K++     ++F   ++ ++S
Sbjct: 94  DLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 126


>gi|319893058|ref|YP_004149933.1| ATP synthase B chain [Staphylococcus pseudintermedius HKU10-03]
 gi|317162754|gb|ADV06297.1| ATP synthase B chain [Staphylococcus pseudintermedius HKU10-03]
          Length = 172

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 70/151 (46%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V +   + L+ ++       L   +D     I  DI +A R +  ++ +  + ++K  +
Sbjct: 21  IVTVVTFLILLALLRKFAWGPLKKVMDDRERSINQDIDDAERAKLNAQRLEEENRQKLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E  +I+  AK +A+   EE      Q +   L+  + +I   K  A   +  ++++ 
Sbjct: 81  TQDEVHKILEDAKLQARRQQEEILHEANQRANGMLETAQSEIKSEKERALAEINNQVSEL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           SV I  +++ +++++    ++ EK +  +  
Sbjct: 141 SVLIASKVLRKEISEQDQKALIEKYVKEVGD 171


>gi|289550277|ref|YP_003471181.1| ATP synthase B chain [Staphylococcus lugdunensis HKU09-01]
 gi|315660263|ref|ZP_07913118.1| ATP synthase F0 sector subunit B [Staphylococcus lugdunensis
           M23590]
 gi|289179809|gb|ADC87054.1| ATP synthase B chain [Staphylococcus lugdunensis HKU09-01]
 gi|315494690|gb|EFU83030.1| ATP synthase F0 sector subunit B [Staphylococcus lugdunensis
           M23590]
          Length = 174

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 70/153 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V ++    L+ ++       L   +D     I  DI +A + +E ++ +  + ++  
Sbjct: 21  TIIVTLATFAILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKENAQKLEEENQKTL 80

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE + I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 81  KETQEEVQRILEDAKVQARKQQEEIIHEANVRANGMIETAQSEINSQKERALADINNQVS 140

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++    ++ +K I     
Sbjct: 141 ELSVLIASKVLQKEISEQDQKALVDKYIKEAGD 173


>gi|123055954|sp|Q0ZS23|ATPF_CLOPD RecName: Full=ATP synthase subunit b, sodium ion specific; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I; AltName: Full=F-type ATPase
           subunit b; Short=F-ATPase subunit b
 gi|77964177|gb|ABB13422.1| ATP synthase subunit b [Clostridium paradoxum]
          Length = 169

 Score = 74.2 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 68/145 (46%)

Query: 15  IFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE 74
           I + +++   +   +  F++   + I + I EA   ++++  +  +Y+ K +  +EE +E
Sbjct: 21  IVMYLILKKLLFKPVTKFMNDRQESIANSIKEAEETKKEAYALKAEYEAKINASKEEGQE 80

Query: 75  IILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE 134
           II  A  +A++ A+E  +N +  +   ++    +I   K +    L  +I++ ++    +
Sbjct: 81  IIKEASRKAEMRADEIIKNAQNEANRLMEKAHIEIEREKQKVVNELKDEISNIAILAASK 140

Query: 135 IISQKMNDDVNSSIFEKTISSIQSC 159
           +I   ++ + +  +    I  +   
Sbjct: 141 VIEADIDKNKHEKLISDFIKEVGEA 165


>gi|257790795|ref|YP_003181401.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|317488493|ref|ZP_07947044.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
 gi|257474692|gb|ACV55012.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|316912425|gb|EFV33983.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
          Length = 206

 Score = 74.2 bits (181), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 67/156 (42%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  + + I L IV+         + L+     I+D + ++ + R +SE +L +YK +
Sbjct: 49  AEFIPMLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKSEQARVESERVLEEYKRQ 108

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               + +  +I+  AK   + +  +     +  +   ++     I   K  A   L   +
Sbjct: 109 LEDAKAQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHNAIEAEKKAAISELQGSV 168

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           AD SV +   +I + +ND  +  I E+ ++   S +
Sbjct: 169 ADLSVSVASRLIGEDLNDAEHRKIIERYVNEAGSFN 204


>gi|256827617|ref|YP_003151576.1| ATP synthase, F0 subunit b [Cryptobacterium curtum DSM 15641]
 gi|256583760|gb|ACU94894.1| ATP synthase, F0 subunit b [Cryptobacterium curtum DSM 15641]
          Length = 199

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 73/158 (46%), Gaps = 1/158 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            DE   + ++ II  +I+     P +    L    + I++ + ++   R++SE +L QYK
Sbjct: 41  MDEFIPMLVAFIILWIILAKFGWP-LFDKMLVKRENTIKESLEKSEEARQESERVLAQYK 99

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++ +    +I+  AK        +     ++ ++  +   +  I   K  A   L  
Sbjct: 100 QELAEAKATAAQIVADAKAAGTAAKADITAQAQREASDMIAKAQVAIDAEKKAAIAELQG 159

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +AD S+ +  ++I   ++DD + ++ E+ ++   S +
Sbjct: 160 SVADVSIAVASKLIGSDLSDDEHRALIERYVNEAGSFN 197


>gi|33329383|gb|AAQ10086.1| ATP synthase subunit b [Bacillus sp. TA2.A1]
          Length = 168

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 65/137 (47%)

Query: 22  YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH 81
                  L++ ++  A++I  D+ EA+R R ++E +L + +    + +++ + I+  A++
Sbjct: 27  RKYAFGPLMNVMEKRANQIEKDLEEAKRNRAEAEKLLAEQRANLEQAKKDAKTILENARN 86

Query: 82  RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN 141
            ++  AEE  +  +     Y     ++I   K +A   L  ++   SV +  ++I ++++
Sbjct: 87  TSEKQAEEIIRAAKAEVDQYKSVARKEIEREKEKAVEALRKEMGQLSVLLASKVIEKELD 146

Query: 142 DDVNSSIFEKTISSIQS 158
                 + +  +  + +
Sbjct: 147 PKQQQQLIDDFLKEVGT 163


>gi|253681112|ref|ZP_04861915.1| ATP synthase F0, B subunit [Clostridium botulinum D str. 1873]
 gi|253562961|gb|EES92407.1| ATP synthase F0, B subunit [Clostridium botulinum D str. 1873]
          Length = 159

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 80/150 (53%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ L I+ Y  +   +   +D    +I +DI +A+  +EK++ + +  ++++  
Sbjct: 10  WTIINFVVLLGILSYF-LFKPVNLVIDRRNSEIENDINQAKTDKEKAKELRIANEKEYKA 68

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E + I+   K +A+ +++E   +  + + L ++  +++I   + +A+  +  K  + 
Sbjct: 69  AKKEGKTIVENYKVKAENVSQEIISDAHKEAELIIQRAKKEIQREREKAEDEVKNKTIEL 128

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           ++E+ ++ + + +++ V+  + +  IS + 
Sbjct: 129 ALELSKKALERSIDEKVHRELIDNFISKVG 158


>gi|257452845|ref|ZP_05618144.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp.
           3_1_5R]
 gi|257466790|ref|ZP_05631101.1| ATP synthase B chain, sodium ion specific [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 168

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 69/153 (45%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y + P  +   L     KI  ++  A   +E+++    Q +   
Sbjct: 16  FWQIINFFILVFVFNKYFKTP--IQRILTERKKKITSELHSATLSKEEAKVSAKQAETAL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E  EI+  A++RA+ +  E   +        L++  +++  +K +A+R L+ ++ 
Sbjct: 74  KEARDEAHEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKAKARRDLHQEVT 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +VE+  +++ + ++    + + +  I  +  
Sbjct: 134 SLAVELAEKLMKKNIDKQTATDLIDDFIERVGD 166


>gi|255324523|ref|ZP_05365640.1| ATP synthase F0, B subunit [Corynebacterium tuberculostearicum
           SK141]
 gi|255298429|gb|EET77729.1| ATP synthase F0, B subunit [Corynebacterium tuberculostearicum
           SK141]
          Length = 189

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 68/159 (42%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  I+ L++   L +P      L    D+I   +  A+  + +++  L +Y  + +
Sbjct: 32  FWSLLCFIVILLLFWKLVLP-KYTKMLQEREDRIEGGLNRAKAQQAEAKAALEKYNAQLA 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  EI   A+ R K +  E   N E+ S   + + E+++   + +    L +++  
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTNAEEESRRIVANGEKQLEASRSQVVTELRSEMGQ 150

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
            S+ +  +I+  ++ +    SS  +  +S + S     K
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDSVAPAGK 189


>gi|258512720|ref|YP_003186154.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479446|gb|ACV59765.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 167

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 70/154 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF+  +   + +  ++       L   L+     I   I EA + RE++E +L + +   
Sbjct: 12  TFIFSVISFLIVFFIIQRFAFKPLARMLEQRRIHIETQISEAEKSREEAERLLAEQQRLL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E R ++  A+ RA   A E  Q  E+ +A  L++  Q I   + EA   +  ++A
Sbjct: 72  EEARKEARNLLDQARIRADEQAREIVQKAEEEAARILEESRQAIVRERDEALAAVTKRVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           + SVE+  +++   +  +++  +  +  S +   
Sbjct: 132 ELSVELTTKLLRDHVTAELHKELVAEAESKLGEL 165


>gi|294501864|ref|YP_003565564.1| ATP synthase F0 subunit B [Bacillus megaterium QM B1551]
 gi|114616|sp|P20601|ATPF_BACMQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|142557|gb|AAA82522.1| ATP synthase b subunit [Bacillus megaterium]
 gi|294351801|gb|ADE72130.1| ATP synthase F0, B subunit [Bacillus megaterium QM B1551]
          Length = 172

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 65/146 (44%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           + + L+ ++       ++  +    + I  +I EA +  E+++ ++ + +E   +  +E 
Sbjct: 25  MFLILLALLQKFAFGPVMGIMKKREEHIAGEIDEAEKQNEEAKKLVEEQREILKQSRQEV 84

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
           + ++  A+  A+   EE      + S       +Q+I   K +A   L  ++A  SV I 
Sbjct: 85  QVMMENARKSAEDKKEEIVAAAREESERLKAAAKQEIEQQKDQAVAALREQVASLSVLIA 144

Query: 133 REIISQKMNDDVNSSIFEKTISSIQS 158
            ++I +++++     +  + I  +  
Sbjct: 145 SKVIEKELSEQDQEKLIHEYIQEVGD 170


>gi|295707212|ref|YP_003600287.1| ATP synthase F0 subunit B [Bacillus megaterium DSM 319]
 gi|294804871|gb|ADF41937.1| ATP synthase F0, B subunit [Bacillus megaterium DSM 319]
          Length = 172

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 65/146 (44%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           + + L+ ++       ++  +    + I  +I EA +  E+++ ++ + +E   +  +E 
Sbjct: 25  MFLILLALLQKFAFGPVMGIMKKREEHIAGEIDEAEKQNEEAKKLVEEQREILKQSRQEV 84

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
           + ++  A+  A+   EE      + S       +Q+I   K +A   L  ++A  SV I 
Sbjct: 85  QVMMENARKSAEDKKEEIIAAAREESERLKAAAKQEIEQQKDQAVAALREQVASLSVLIA 144

Query: 133 REIISQKMNDDVNSSIFEKTISSIQS 158
            ++I +++++     +  + I  +  
Sbjct: 145 SKVIEKELSEQDQEKLIHEYIQEVGD 170


>gi|222085044|ref|YP_002543573.1| ATP synthase protein [Agrobacterium radiobacter K84]
 gi|221722492|gb|ACM25648.1| ATP synthase protein [Agrobacterium radiobacter K84]
          Length = 197

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 65/131 (49%), Gaps = 1/131 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++ +IF + +  + IP  + S L++  D+I  DI EA RL+ +++  +  Y+ + +
Sbjct: 47  LWLVITFVIFYLAMQKIVIPR-VGSILESRHDRIAQDIEEASRLKSEADAAVATYESELA 105

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  AEE  + IE   +  LK  E +I  +K +A   + A   +
Sbjct: 106 AARAKANTIGATARDAAKAKAEEDRKAIEASLSQKLKTAEARIGEIKTKAFADVGAIAEE 165

Query: 127 FSVEIVREIIS 137
            +  +V +++ 
Sbjct: 166 TASAVVEQLVG 176


>gi|121602545|ref|YP_988697.1| F0F1 ATP synthase subunit B' [Bartonella bacilliformis KC583]
 gi|120614722|gb|ABM45323.1| ATP synthase F0, B subunit family protein [Bartonella bacilliformis
           KC583]
          Length = 161

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 66/146 (45%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S   F   +  + +P  +   ++   D+I  D+  A RL+++++ ++  Y+ K +
Sbjct: 15  FWLVISFGFFYFFIARVIVPR-IGCTIEIRRDRIASDLDRAMRLKQEADTVVEIYERKLA 73

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I     +  K   +   + IE      L D E +I  ++ +A + + +   +
Sbjct: 74  EARLQAYAIAQKTSNEIKEKTKLERKEIETSLDKKLADAEGQIAKIRNKAVQNIGSIAEE 133

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
              EIV+++I  +++ +  S   +  
Sbjct: 134 VVPEIVKKLIGVEVSKESVSLAVKAA 159


>gi|218282100|ref|ZP_03488399.1| hypothetical protein EUBIFOR_00974 [Eubacterium biforme DSM 3989]
 gi|218216893|gb|EEC90431.1| hypothetical protein EUBIFOR_00974 [Eubacterium biforme DSM 3989]
          Length = 171

 Score = 73.8 bits (180), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 65/143 (45%)

Query: 16  FLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREI 75
            +V+         LL+ +    D I+++I  +  +++++E++  +Y EK   V +E   I
Sbjct: 26  LIVMFAKKFFWDKLLTLIQKRQDLIQENIDSSVAIKKQAEDVKEKYDEKLRNVSQEAHTI 85

Query: 76  ILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREI 135
           +++A+  A    ++  +     +    K+  + I   K +A++ +   I+D ++    ++
Sbjct: 86  LVSARAHADQEKQQIIKEANDEALRIKKNANEDIERQKRDAQKEMKKAISDVALSAASQL 145

Query: 136 ISQKMNDDVNSSIFEKTISSIQS 158
           I ++M++       E  I     
Sbjct: 146 IKKEMDEKTQKQFVEDFIEQAGD 168


>gi|330718992|ref|ZP_08313592.1| F0F1-type ATP synthase, subunit b [Leuconostoc fallax KCTC 3537]
          Length = 168

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++ ++ + ++  +     L++ LD  ADKI  D+  A   R+++E +  + + + +
Sbjct: 16  LFVLIAFLLLMWVLSKV-AYGPLMNILDQRADKISSDLDGAETARQQAEELASKRQGELA 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +++  AK  A+  ++         +       E +   +K +A       +A 
Sbjct: 75  NARNEATKVVADAKASAQKQSDVLVSQASDRAQAINSQAEVEAQKLKDDAISSAKNDVAA 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SV I  +++ ++++ +   ++ +  IS ++  
Sbjct: 135 LSVAIASKLMQKELSLNDQQALIDAYISDLEKS 167


>gi|257069068|ref|YP_003155323.1| ATP synthase F0 subcomplex B subunit [Brachybacterium faecium DSM
           4810]
 gi|256559886|gb|ACU85733.1| ATP synthase F0 subcomplex B subunit [Brachybacterium faecium DSM
           4810]
          Length = 179

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 71/154 (46%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +   + L+IF  + +   +P +  + LD  A+KI   I  A +++E+ + +    +++ +
Sbjct: 22  WWSLIFLVIFAGVFMKFVLPRM-NAVLDERAEKIEGGIRNAEKVQEQVDQLKSDQEQELA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I   A+   + + +E     +  S   L    Q++   ++ A   L  ++  
Sbjct: 81  AARQEAASIREKARADGQKIVDEARARADAESERVLAAGRQQLSAERIAASTELRGEVGT 140

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
            + ++  +I+ + + +D+ +  + ++ +  ++S 
Sbjct: 141 LASDLASKIVGESLSDDERSRRVIDRFLDDLESS 174


>gi|299821857|ref|ZP_07053745.1| ATP synthase F0 sector subunit B [Listeria grayi DSM 20601]
 gi|299817522|gb|EFI84758.1| ATP synthase F0 sector subunit B [Listeria grayi DSM 20601]
          Length = 176

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +     ++ II L  ++ +     L+  +    + I  +I  A   R ++E +L + K+ 
Sbjct: 23  DVLFTLVAFIILLA-LIRIFAWKPLMGIMKEREEHIASEIDAAEESRAQAEGLLEEQKQV 81

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +   E + +I  AK   +   E   Q     S    ++ +  I   K +A   L  ++
Sbjct: 82  LKEARVEAQNMIENAKQLGEKERESIIQTARSESERLKEEAKSDIAREKEDAIAALRDQV 141

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              SV I  ++I + ++++  SS+ E+ I  +  
Sbjct: 142 GSLSVLIASKVIEKNLDEEAQSSLIEEYIERLDD 175


>gi|193215091|ref|YP_001996290.1| F0F1 ATP synthase subunit B [Chloroherpeton thalassium ATCC 35110]
 gi|226741338|sp|B3QZF0|ATPF_CHLT3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193088568|gb|ACF13843.1| ATP synthase F0, B subunit [Chloroherpeton thalassium ATCC 35110]
          Length = 175

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ ++ L++++       +LS L+     I+  I  A   ++ +E +L + K+  +
Sbjct: 22  FWTAVTFLL-LLLLLKKLAWGPILSALEEREKSIQSAIDRANSAKDDAEKLLSKNKDAMN 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K E E   II   K  A+ +  E     ++ +       + +I   K +A   L  ++A 
Sbjct: 81  KAEVEADRIIKEGKEYAEKMRNEIVTKAQEEAKKIAAQAKAEIEQEKQQALNALRDEVAT 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V+   +II   ++ + + ++ E  +  + +
Sbjct: 141 LAVKGAEKIIRMNLDAEKHKAVVEGMLEDLST 172


>gi|56421897|ref|YP_149215.1| F0F1 ATP synthase subunit B [Geobacillus kaustophilus HTA426]
 gi|81346273|sp|Q5KUI9|ATPF_GEOKA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56381739|dbj|BAD77647.1| F0F1-type ATP synthaseB chain [Geobacillus kaustophilus HTA426]
          Length = 177

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +  + + I L+ ++       L++ +    + I ++I +A + R+++E +L + +E  
Sbjct: 20  TIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELM 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E + +I  A+  A+   E+   +    +    +  +++I   K +A   L  ++A
Sbjct: 80  KQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEVAKKEIEREKEQAMAALREQVA 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             SV I  ++I +++ +     + E  I  +Q  
Sbjct: 140 SLSVLIASKVIEKELTEQDQRKLIEAYIKDVQEA 173


>gi|329955016|ref|ZP_08295997.1| ATP synthase F0, B subunit [Bacteroides clarus YIT 12056]
 gi|328526306|gb|EGF53321.1| ATP synthase F0, B subunit [Bacteroides clarus YIT 12056]
          Length = 166

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 69/156 (44%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  VI+     P I+   ++     I   +  AR+   +   +  + +   +
Sbjct: 12  FWMLLSFGVVFVILAKYGFP-IITKMVEGRRTYIDQSLEVARQANAQLAKLKEESEALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  ++ E ++   L D++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRIMREAMHERDKIIVEARKHAEAVAQKELDDVKQQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDDV-NSSIFEKTISSIQSCHQ 161
            SV+I  +II + +++      + ++ +  + + + 
Sbjct: 131 LSVDIAEKIIRRNLDEKQDQMEMIDRMLDEMLTPNH 166


>gi|319936639|ref|ZP_08011052.1| ATP synthase subunit B [Coprobacillus sp. 29_1]
 gi|319808196|gb|EFW04761.1| ATP synthase subunit B [Coprobacillus sp. 29_1]
          Length = 167

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 77/152 (50%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T ++ +     ++      + + + ++ +  A+ I   I EA+ + EK++  +++ +E+
Sbjct: 14  TTVIIQLCSTGIMLFFFKKFLWTPMQAYFEKRANFIESTINEAKEMNEKAKTFMVESEEQ 73

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +  +E R I+  AK  A  + ++   + ++ ++  LK  E++I   K +AK  +  ++
Sbjct: 74  ARESAKEYRGIVERAKADALKVRDDIVADAKKEASNKLKQAEREIEAEKQQAKEEMKEEM 133

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              ++E+  +++S++MN   N  + E  +  +
Sbjct: 134 VGIAIEVAAKVLSKEMNSKENQQMVEDFVEKV 165


>gi|260460367|ref|ZP_05808619.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259034012|gb|EEW35271.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 199

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 66/144 (45%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   +D   D+I  D+ +A +L+ +++  +  Y+++ +
Sbjct: 53  LWLAITFGLFYLFLKRVVVPR-VGGIIDVRNDRISQDLDQAAKLKGEADAAVAAYEQELA 111

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + ++    I   A   AK  A+   + IE      L + E +I  +K  A + + +   D
Sbjct: 112 EAKKNANSIGQQAADAAKAEADTARKKIEAALDEKLGEAEARISSIKANAMKEVGSIAED 171

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV  ++  K +    ++  +
Sbjct: 172 TASAIVEALVGGKASKAEIAAAVK 195


>gi|307244030|ref|ZP_07526149.1| ATP synthase F0, B subunit [Peptostreptococcus stomatis DSM 17678]
 gi|306492554|gb|EFM64588.1| ATP synthase F0, B subunit [Peptostreptococcus stomatis DSM 17678]
          Length = 168

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 68/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
                ++ ++ L +++   +   ++  +DA    I+++I   ++ +E+      +Y+ K 
Sbjct: 12  ELFFTLANVLILFLILRKVLFKKIIDVMDARDADIKNNIEAGQKAKEEGMKFKSEYETKI 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
               +E + I+  A+ RA+  ++      ++ +    +    +I   K +A   + ++I+
Sbjct: 72  QDARDEGQMIVDFARKRAEEKSDTIISEAKKEAEYIKQKANNEIAKEKEQAFNNIKSEIS 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           + +V    ++I + ++   +  + E  I  +   
Sbjct: 132 EIAVLAASKVIEKDIDKAKHEDLIENFIKEVGEA 165


>gi|315917938|ref|ZP_07914178.1| ATP synthase subunit B [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059386|ref|ZP_07923871.1| ATP synthase subunit B [Fusobacterium sp. 3_1_5R]
 gi|313685062|gb|EFS21897.1| ATP synthase subunit B [Fusobacterium sp. 3_1_5R]
 gi|313691813|gb|EFS28648.1| ATP synthase subunit B [Fusobacterium gonidiaformans ATCC 25563]
          Length = 163

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 69/153 (45%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y + P  +   L     KI  ++  A   +E+++    Q +   
Sbjct: 11  FWQIINFFILVFVFNKYFKTP--IQRILTERKKKITSELHSATLSKEEAKVSAKQAETAL 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E  EI+  A++RA+ +  E   +        L++  +++  +K +A+R L+ ++ 
Sbjct: 69  KEARDEAHEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKAKARRDLHQEVT 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +VE+  +++ + ++    + + +  I  +  
Sbjct: 129 SLAVELAEKLMKKNIDKQTATDLIDDFIERVGD 161


>gi|293375569|ref|ZP_06621843.1| ATP synthase F0, B subunit [Turicibacter sanguinis PC909]
 gi|325836793|ref|ZP_08166260.1| ATP synthase F0, B subunit [Turicibacter sp. HGF1]
 gi|292645786|gb|EFF63822.1| ATP synthase F0, B subunit [Turicibacter sanguinis PC909]
 gi|325491171|gb|EGC93460.1| ATP synthase F0, B subunit [Turicibacter sp. HGF1]
          Length = 166

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 63/156 (40%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F + +   + L  V+     + +  FL    + + ++I  A  L+  +  +    + + 
Sbjct: 11  NFTLQILSTLVLFFVIKHFAWAPMKEFLRKRQELVSEEINHAEMLKADAIALKQSAEAQV 70

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
               +E REI+  +K +A+ + +E   +    +   L      I   +      +   I 
Sbjct: 71  QVARDEAREIVENSKKQAQNIHDEIVTSARMEAQQKLAKASADIEQERKAVYASIREDIV 130

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           + +V    ++I ++++   +  +F + +S +   H+
Sbjct: 131 ELAVSSAEKMIEKEIDAKAHDELFNQFVSKVGGSHE 166


>gi|73662086|ref|YP_300867.1| F0F1 ATP synthase subunit B [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|88909588|sp|Q49Z54|ATPF_STAS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|72494601|dbj|BAE17922.1| F0F1-type ATP synthase b subunit' [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 175

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 70/153 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   + L+ ++       L   +D     I  DI +A + +  ++ +  Q K+  
Sbjct: 22  TIIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDIDDAEQAKLNAQKLEEQNKQTL 81

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  +K +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 82  KETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIETAQNEINSEKERAIADINNQVS 141

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ ++++D    ++ EK I     
Sbjct: 142 ELSVLIASKVLQKEISDKDQKALVEKYIKEAGD 174


>gi|227821028|ref|YP_002824998.1| F0F1 ATP synthase subunit B' [Sinorhizobium fredii NGR234]
 gi|227340027|gb|ACP24245.1| FoF1 ATP synthase subunit B [Sinorhizobium fredii NGR234]
          Length = 203

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 66/149 (44%), Gaps = 1/149 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + IP  +   L+   D+I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 56  LWLAITFGLFYLLMSKVIIPR-IGGILEKRHDRIAQDLDEASRLKGEADAAIASYEQELA 114

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  A      +E      +   E +I  +K +A   + A   +
Sbjct: 115 NARAKGHSIADTAREEAKSKATADRAAVEAELTKKITAAETRIADIKSKALADVGAIAEE 174

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
            +  +V+++I   +     ++  + +  +
Sbjct: 175 TATAVVKQLIGGNVTKTEIAAAVKASAGN 203


>gi|254302783|ref|ZP_04970141.1| F-type two-sector ATPase, F(1) beta subunit [Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953]
 gi|148322975|gb|EDK88225.1| F-type two-sector ATPase, F(1) beta subunit [Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953]
          Length = 163

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 77/153 (50%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIVV-YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  + L IV  Y + P  +   ++    KI  ++ EA + ++++E +L + + + 
Sbjct: 11  FWQIINFFLLLFIVKKYFKEP--ISKIINERKQKIEAELVEATKNKKEAEQLLKEAETQI 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E  EI+ AA+ +A+  A    +   +     LK  E +I  +K +AK  L  ++ 
Sbjct: 69  NSSRKEATEIVKAAQRKAEEEAHNLIKEARENRENILKITELEITKIKNDAKEELGREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + + E+  +II +K++D    S+ +K I+ +  
Sbjct: 129 NLAAELAEKIIKEKVDDAQEISLIDKFIAEVGE 161


>gi|254713046|ref|ZP_05174857.1| F0F1 ATP synthase subunit B' [Brucella ceti M644/93/1]
 gi|254716601|ref|ZP_05178412.1| F0F1 ATP synthase subunit B' [Brucella ceti M13/05/1]
 gi|261218400|ref|ZP_05932681.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261320751|ref|ZP_05959948.1| ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|260923489|gb|EEX90057.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293441|gb|EEX96937.1| ATP synthase subunit B [Brucella ceti M644/93/1]
          Length = 208

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIADYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++    +    S   +
Sbjct: 178 TTATIVEQLLGLTADKASVSEAVK 201


>gi|295425480|ref|ZP_06818173.1| ATP synthase F0 sector subunit B [Lactobacillus amylolyticus DSM
           11664]
 gi|295064819|gb|EFG55734.1| ATP synthase F0 sector subunit B [Lactobacillus amylolyticus DSM
           11664]
          Length = 168

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 64/157 (40%), Gaps = 1/157 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           +   T    +   I + ++V       +   ++    K+ +D+  A   R+K+E +  + 
Sbjct: 13  YIGNTIWYLVVFAILM-LLVKHYAWGPVSDMMEKRRQKVIEDLDSAESNRKKAEILANER 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           +       +E  +I+  AK  A+ +  +   +    +A   +  E      K +A     
Sbjct: 72  EAALKNSRQEATQILSDAKTNAQKIGSQIVADANNDAASIREKAEADAKKAKADAINDAR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++AD SV I  +II++ ++ +    + ++ I  +  
Sbjct: 132 REVADISVAIAEKIIAKNLSAEDQKDLVDQFIKGLND 168


>gi|170017979|ref|YP_001728898.1| ATP synthase F0, B subunit [Leuconostoc citreum KM20]
 gi|226741501|sp|B1MW89|ATPF_LEUCK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|169804836|gb|ACA83454.1| ATP synthase F0, B subunit [Leuconostoc citreum KM20]
          Length = 169

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S ++ +VI+  +     L   LD  A+KI  DI  A   R+++EN+  Q + + +
Sbjct: 18  LFIIISFLVLMVILKKV-AYGPLTKVLDERAEKISTDIDGAESARQEAENLAAQRQSELA 76

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              ++  +++  AK  A+  ++       + +    +  +     +K +A       +A 
Sbjct: 77  DTRQQATKVVADAKASAQKQSDALVAVAAERANTINQQAQTDAEKLKEDAIANAKNDVAA 136

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  +++ ++++ +   ++ +  IS +++
Sbjct: 137 LSVAIASKLMQKELSLNDQQALIDAYISDLET 168


>gi|149183574|ref|ZP_01861996.1| ATP synthase (subunit b) [Bacillus sp. SG-1]
 gi|148848715|gb|EDL62943.1| ATP synthase (subunit b) [Bacillus sp. SG-1]
          Length = 170

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 60/143 (41%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           + I L+ ++       L+  +    D I  +I  A   R ++ N+L + ++   +  +E 
Sbjct: 23  MFIVLLALLKKFAWGPLMGIMKEREDHIASEINAAEESRTEANNLLEEQRQLLKEARQEA 82

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
           + +I  +K + +   EE             +  +++I   K +A   L  +++  SV I 
Sbjct: 83  QTMIENSKKQGEQQREEIIATARAEGERLKEAAKREIETQKEQAVTALREQVSSLSVLIA 142

Query: 133 REIISQKMNDDVNSSIFEKTISS 155
            ++I ++++ +    +    I  
Sbjct: 143 SKVIEKELSAEDQQKLINDYIQE 165


>gi|242241513|ref|ZP_04795958.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis W23144]
 gi|242235056|gb|EES37367.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis W23144]
 gi|319399590|gb|EFV87845.1| ATP synthase F0, B subunit [Staphylococcus epidermidis FRI909]
          Length = 171

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 72/153 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V ++  + L+I++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TTIVTLATFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++     + EK +     
Sbjct: 138 ELSVLIASKVLRKEISEQDQKELVEKYLKEAGD 170


>gi|262276821|ref|ZP_06054614.1| H+-transporting two-sector ATPase [alpha proteobacterium HIMB114]
 gi|262223924|gb|EEY74383.1| H+-transporting two-sector ATPase [alpha proteobacterium HIMB114]
          Length = 163

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 33/162 (20%), Positives = 80/162 (49%), Gaps = 4/162 (2%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD +F V ++  +F++++V+ ++P I+L  +D   +++++ I EA  L+  SE +L + K
Sbjct: 2   FDASFWVAIAFFLFVLLLVFKKVPQIVLGQIDNKINELKNKINEAEELKSNSEKLLSEAK 61

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  K +EE   I+  A+  +        + ++       K  + KI   K +A   +  
Sbjct: 62  SKLEKSDEENSNILAKAQKISDDEISTSLEKMKISLENKEKAAQNKIEQAKNDAINQVKK 121

Query: 123 KIADFSVEIVREIISQKMNDDVNSSI----FEKTISSIQSCH 160
                ++E V +++++ ++      I     +++I  +++ +
Sbjct: 122 VATKVALETVEKVLTENLDSKKQEEINLSKVKQSIEKLKNIN 163


>gi|260586968|ref|ZP_05852881.1| ATP synthase F0, B subunit [Blautia hansenii DSM 20583]
 gi|331083915|ref|ZP_08333024.1| ATP synthase F0 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260542652|gb|EEX23221.1| ATP synthase F0, B subunit [Blautia hansenii DSM 20583]
 gi|330403340|gb|EGG82900.1| ATP synthase F0 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 166

 Score = 73.0 bits (178), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 77/163 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M      +  +  +I L +++   +   +L  ++     I  ++ EAR  REK+E + +Q
Sbjct: 2   MSLGWNLVWTIINLIVLYLLMKKFLIGPVLGIMEKRKACIAKEMEEARVSREKAEELKVQ 61

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y++  +  +EE+ +I+  AK  A+   E   +N    +A  ++  +      +  A +  
Sbjct: 62  YEKSLAMAKEESSQILENAKTDARQARESIVKNANDEAAKIIEAAQNTARQEQENAMQGA 121

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
             +IA  +++  ++++ +K N++ N  +++K ++        D
Sbjct: 122 KKEIAQLAMQAAKKLLLEKSNENSNDMLYDKFLAKAGDADDTD 164


>gi|116618949|ref|YP_819320.1| F0F1-type ATP synthase, subunit b [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|122270851|sp|Q03V25|ATPF_LEUMM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116097796|gb|ABJ62947.1| ATP synthase F0 subcomplex B subunit [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
          Length = 167

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++ ++ ++I+  +     L   LD  ADKI  DI  A   R+++E +  Q + + +
Sbjct: 16  LFIIIAFLLLMLILKKV-AYGPLTKVLDERADKISSDIDGAEVARQEAEKLASQRQAELA 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +   +++  AK  A+  ++         +A   +  +     +K +A       +A 
Sbjct: 75  ETRQNATKVVNDAKASAQKQSDLIVSAANDRAASVSQQAQTDAQKLKEDAISGAKNDVAA 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  +++ ++++ +   ++ +  IS +++
Sbjct: 135 LSVAIASKLMQKELSLNDQQALIDAYISDLET 166


>gi|153007322|ref|YP_001381647.1| ATP synthase F0 subunit B [Anaeromyxobacter sp. Fw109-5]
 gi|226741090|sp|A7HIW7|ATPF_ANADF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|152030895|gb|ABS28663.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 175

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 63/153 (41%), Gaps = 1/153 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ L ++        ++  L      IR+ I  A+R R ++E +L + K   
Sbjct: 20  TLWTGITFLVLLFVLGKF-AWGPIVKMLAERERTIREAIDSAKRERTEAERLLAEQKALL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K   E  E+    +   + + +E      + +   +    ++I   K +A   L A +A
Sbjct: 79  GKAAREAAELARRNQQEVEAMRQELTARARKEADDLVATARKQIEEEKTKAMSELRAVVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +++    ++   ++D     + E  I+ + +
Sbjct: 139 DLAIDAASRLVKANLDDASQRKLVEDYIAQLPA 171


>gi|311740607|ref|ZP_07714434.1| ATP synthase F0 sector subunit B [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304127|gb|EFQ80203.1| ATP synthase F0 sector subunit B [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 189

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 68/159 (42%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  I+ L++   L +P      L    D+I   +  A+  + +++  L +Y  + +
Sbjct: 32  FWSLLCFIVILLLFWKLVLP-KYTKMLQEREDRIEGGLKRAKAQQAEAKAALEKYNAQLA 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  EI   A+ R K +  E   N E+ S   + + E+++   + +    L +++  
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTNAEEESRRIVANGEKQLEASRSQVVTELRSEMGQ 150

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
            S+ +  +I+  ++ +    SS  +  +S + S     K
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDSVAPAGK 189


>gi|291165815|gb|EFE27863.1| ATP synthase F0, B subunit [Filifactor alocis ATCC 35896]
          Length = 172

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 71/153 (46%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +  + I++L +  +L  P  +   +D    +I + +  A+R  E +     QY+EK  
Sbjct: 18  FTILNTFILYLGLKHFLFEP--VKKMMDERTAEIEEQLDSAKRTEELANETYEQYQEKMR 75

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             +EE  ++IL A+H A+   ++  ++  + +    K  E+ I   K +    +  +I +
Sbjct: 76  NAKEEGMKLILEARHNAQAQYDDIVKSARKEAESVKKKSEEDILREKEKVMDGMKDEIGE 135

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ I  ++I + +   +   + ++ I ++   
Sbjct: 136 MAILIAEQVIKKNIEPQIQGELIDELIQNVGDS 168


>gi|227431394|ref|ZP_03913445.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
 gi|227352857|gb|EEJ43032.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
          Length = 167

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++ ++ ++I+  +     L   LD  ADKI  DI  A   R+++E +  Q + + +
Sbjct: 16  LFIIIAFLLLMLILKKV-AYGPLTKVLDERADKISSDIDGAEVARQEAEELASQRQAELA 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +   +++  AK  A+  ++         +A   +  +     +K +A       +A 
Sbjct: 75  ETRQNATKVVNDAKASAQKQSDLIVSAANDRAASVSQQAQTDAQKLKEDAISGAKNDVAA 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  +++ ++++ +   ++ +  IS +++
Sbjct: 135 LSVAIASKLMQKELSLNDQQALIDAYISDLET 166


>gi|253582458|ref|ZP_04859680.1| ATP synthase, B chain [Fusobacterium varium ATCC 27725]
 gi|251835603|gb|EES64142.1| ATP synthase, B chain [Fusobacterium varium ATCC 27725]
          Length = 168

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 71/153 (46%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y + P  L   L+A   KI  D+ EA   +E +  +  + ++  
Sbjct: 16  FWQIINFFILVFVFNKYFKKP--LGKMLEARKTKITSDLNEANANKEAAMKLQKEAEDIL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K + +  EI+  A+H+A    E      ++     +K  E +   MK + ++ L  ++ 
Sbjct: 74  KKAKYQANEILKTAEHKADERRENILNEAKEQRDKIIKTAELEAVKMKSDVRKELQDEVK 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +V +  ++I +K+N  + S++ ++ I  +  
Sbjct: 134 DLAVRLAEKLIEEKINPKLESTLIDEFIEEVGE 166


>gi|169826596|ref|YP_001696754.1| ATP synthase B chain [Lysinibacillus sphaericus C3-41]
 gi|226741517|sp|B1HM52|ATPF_LYSSC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|168991084|gb|ACA38624.1| ATP synthase B chain [Lysinibacillus sphaericus C3-41]
          Length = 173

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 68/156 (43%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +   +  +++ + L+ ++       L+  +    + +  +I  A + R++S   L + K 
Sbjct: 17  NGDIIATLAIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKESHQFLEEQKS 76

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
              +   E + I+  AK + ++  +E        +    +   ++I   K +A   +  +
Sbjct: 77  LLKEARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVRDE 136

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +   SV    +++S+++++  N ++ E+TI+     
Sbjct: 137 VVSLSVLAASKVLSKEISEADNRALIEETIAKAGEA 172


>gi|19703704|ref|NP_603266.1| ATP synthase B chain, sodium ion specific [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
 gi|296327992|ref|ZP_06870527.1| ATP synthase F0 sector subunit B [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|81763578|sp|Q8RGD8|ATPF_FUSNN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|19713828|gb|AAL94565.1| ATP synthase B chain, sodium ion specific [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
 gi|296154948|gb|EFG95730.1| ATP synthase F0 sector subunit B [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 163

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 76/153 (49%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIVV-YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  + L IV  Y + P  +   ++    KI  ++ EA + ++++E +L   + + 
Sbjct: 11  FWQIINFFLLLFIVKKYFKEP--ISKIINERKQKIEAELVEATKNKKEAEQLLKDAEAQI 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E  EI+ AA+ +A+  A    +   +     LK  E +I  +K +AK  L  ++ 
Sbjct: 69  NASRKEATEIVKAAQRKAEEEAHNLIREARENRENILKTTELEITKIKNDAKEELGREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + + E+  +II +K++D    S+ +K I+ +  
Sbjct: 129 NLAAELAEKIIKEKVDDAQEISLIDKFIAEVGE 161


>gi|332880274|ref|ZP_08447952.1| ATP synthase F0, B subunit [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332681719|gb|EGJ54638.1| ATP synthase F0, B subunit [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 168

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   I   I+     P ++   +D     I   +  AR+  E+ + +  + +   +
Sbjct: 12  FWMVIIFGIVFFILAKYAFP-VITGMVDKRKQYIDSSLEAARQANEQLQQVKAESEALLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      +  E  +     +   L +   +I   K  A   +  ++A 
Sbjct: 71  RAHEEQTAILKEASATRDRIIAEARERARTEARKALDETRHQIAAEKESAINDIRRQVAI 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV++  +++ +K+ +D     +  + +  ++S + ++
Sbjct: 131 LSVDVAEKVLRKKLSDDKEQLELVNRLLDEVKSNNNIE 168


>gi|150395674|ref|YP_001326141.1| F0F1 ATP synthase subunit B' [Sinorhizobium medicae WSM419]
 gi|226698822|sp|A6U6M6|ATPX_SINMW RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|150027189|gb|ABR59306.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           medicae WSM419]
          Length = 204

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 70/149 (46%), Gaps = 1/149 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + IP  + S L+   D+I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 57  LWLAITFGLFYLLMSKVIIPR-IGSILETRHDRIAQDLDEASRLKGEADAAIAAYEQELA 115

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  A+     +E   A  +   E +I  +K +A   + A   +
Sbjct: 116 GARAKGHSIADTAREAAKSKAKADRDGVEADLAKKIAAAEARIGDIKSKALADVGAIAEE 175

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
            +  IV+++I   +     ++ F+ +  +
Sbjct: 176 TATAIVKQLIGGTVTKSEIAAAFKASAGN 204


>gi|299537988|ref|ZP_07051274.1| ATP synthase B chain [Lysinibacillus fusiformis ZC1]
 gi|298726570|gb|EFI67159.1| ATP synthase B chain [Lysinibacillus fusiformis ZC1]
          Length = 172

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 9   VFMSLIIFLVI--VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +  +L+IF+ +  ++       L+  +    + +  +I  A + R++S   L + K    
Sbjct: 19  IIATLVIFIGLMLLLRKFAWGPLMGIMQQREELVASEIEAAEKARKESHQFLEEQKSLLK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E + I+  AK + ++  EE        +    +   ++I   K +A   +  ++  
Sbjct: 79  EARTEAQSIVEGAKKQGELQKEEILTVARNEANRLKESALREIESEKEKAIAAVRDEVVS 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SV    +++S+++++  N ++ E+TI+     
Sbjct: 139 LSVLAASKVLSKEISEADNRALIEETIAKAGEA 171


>gi|218290065|ref|ZP_03494232.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius LAA1]
 gi|218239899|gb|EED07087.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius LAA1]
          Length = 167

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 69/154 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF+  +   + +  ++       L   L+     I   I EA +  E++E +L + +   
Sbjct: 12  TFIFSVISFLIVFFIIQRFAFKPLARMLEQRRIHIETQISEAEKSCEEAERLLAEQQRLL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E R ++  A+ RA   A E  Q  E+ +A  L++  Q I   + EA   +  ++A
Sbjct: 72  EEARKEARNLLDQARIRADEQAREIVQKAEEEAARILEESRQAIVRERDEALAAVTKRVA 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           + SVE+  +++   +  +++  +  +  S +   
Sbjct: 132 ELSVELATKLLRDHVTAELHKDLLAEAESKLGEL 165


>gi|269925189|ref|YP_003321812.1| ATP synthase F0, B subunit [Thermobaculum terrenum ATCC BAA-798]
 gi|269788849|gb|ACZ40990.1| ATP synthase F0, B subunit [Thermobaculum terrenum ATCC BAA-798]
          Length = 175

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 65/148 (43%), Gaps = 1/148 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +I + ++        +   LD  A ++R+ I  A R++ ++     + K+    
Sbjct: 17  WQLVAFLILVYVLKRF-AFGPVTRILDERAARVRESIETAERIQREAAEQEQRTKQMLED 75

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              + + I+  A+  A+ +      N  + +   ++  ++ I  MK EA   L  ++AD 
Sbjct: 76  ARRQAQAILQQAQQAAERIQSTAQDNAREQANQIIQRAQEDIDRMKAEAIDELRRQVADL 135

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISS 155
           ++     II ++++   + ++  + ++ 
Sbjct: 136 AIAAASRIIRKELDPATHRALINEVLAE 163


>gi|158312874|ref|YP_001505382.1| F0F1 ATP synthase subunit B [Frankia sp. EAN1pec]
 gi|226741457|sp|A8L3W1|ATPF_FRASN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158108279|gb|ABW10476.1| ATP synthase F0, B subunit [Frankia sp. EAN1pec]
          Length = 193

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 65/155 (41%), Gaps = 2/155 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  + +    +   P  +       A++I   +  A R   +++ +L QY+ + ++  
Sbjct: 32  LLAFGLLVGFFFWKIYPQ-IRKTYAERAERIEGGLNRAERAEREAQALLEQYRSQLAEAR 90

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+ + + + EE    ++Q  A   +  +  +   + +    +  +I + ++
Sbjct: 91  SEAARIREDAQAQGRQIVEELRTQVQQEVAEIRERADAALVAERAQVVASVRREIGEIAL 150

Query: 130 EIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
           E+   I+ +++ ND     + +  I+ +    Q D
Sbjct: 151 ELATRIVGRELENDTRQRQLVDDFIAGLDEAPQPD 185


>gi|304391257|ref|ZP_07373201.1| ATP synthase B' chain [Ahrensia sp. R2A130]
 gi|303296613|gb|EFL90969.1| ATP synthase B' chain [Ahrensia sp. R2A130]
          Length = 174

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 68/151 (45%), Gaps = 5/151 (3%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S  +F  I+  + +P  +   L+  + +I  D+ EA RL+++S+  +  Y++  +
Sbjct: 28  LWLVLSFGLFYYIMSRVVLPR-ISGILETRSGRIAQDLDEANRLKDESDAAIAAYEQDLA 86

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             +    +I   A+   K  A+     +E      + D E +I  +K +A   + +    
Sbjct: 87  TAKTNAHKIAQEARDAGKAEADVKRAEVEADMTARVADAEARIAKIKSDAMSDVGS---- 142

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            + E    ++SQ +   V  +   K +S+++
Sbjct: 143 IATETAETLVSQLLGSKVTKAEVAKAVSNVK 173


>gi|251812180|ref|ZP_04826653.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282876485|ref|ZP_06285351.1| ATP synthase F0, B subunit [Staphylococcus epidermidis SK135]
 gi|251804277|gb|EES56934.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281294737|gb|EFA87265.1| ATP synthase F0, B subunit [Staphylococcus epidermidis SK135]
 gi|329735666|gb|EGG71949.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU028]
          Length = 171

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 71/154 (46%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T +  ++ +I + I++       L   +D     I  DI +A + +  ++ +  + ++ 
Sbjct: 18  TTIVTLVTFVILI-ILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKT 76

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  ++
Sbjct: 77  LKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQV 136

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++ SV I  +++ +++++     + EK +     
Sbjct: 137 SELSVLIASKVLRKEISEQDQKELVEKYLKEAGD 170


>gi|197124854|ref|YP_002136805.1| ATP synthase F0 subunit beta [Anaeromyxobacter sp. K]
 gi|226741291|sp|B4UJU5|ATPF_ANASK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|196174703|gb|ACG75676.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. K]
          Length = 179

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ LV++        ++  L      IR+ I  A++ R ++E +L   KE  
Sbjct: 24  TLWTAITFLVMLVVLGKF-AWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +K + E  E+    +   + L +E      + +   + +  ++I     +AK  L A++ 
Sbjct: 83  AKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELGKAKTELKAQVV 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +++    ++   +++    ++ E+ I+ + +
Sbjct: 143 DLAIDAASRLVKANLDEKAQRALVEEYIAQLPA 175


>gi|226698383|sp|A1URU4|ATPX_BARBK RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
          Length = 188

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 66/146 (45%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S   F   +  + +P  +   ++   D+I  D+  A RL+++++ ++  Y+ K +
Sbjct: 42  FWLVISFGFFYFFIARVIVPR-IGCTIEIRRDRIASDLDRAMRLKQEADTVVEIYERKLA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I     +  K   +   + IE      L D E +I  ++ +A + + +   +
Sbjct: 101 EARLQAYAIAQKTSNEIKEKTKLERKEIETSLDKKLADAEGQIAKIRNKAVQNIGSIAEE 160

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
              EIV+++I  +++ +  S   +  
Sbjct: 161 VVPEIVKKLIGVEVSKESVSLAVKAA 186


>gi|167762920|ref|ZP_02435047.1| hypothetical protein BACSTE_01284 [Bacteroides stercoris ATCC
           43183]
 gi|167699260|gb|EDS15839.1| hypothetical protein BACSTE_01284 [Bacteroides stercoris ATCC
           43183]
          Length = 166

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  AR+   +   +  +     +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEERRAYIDQSLEVARQANAQLAKLKEESDALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  ++ E ++   L D++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRIMREAMHERDKIIVEARKHAEALAQKELDDVKQQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDDV-NSSIFEKTISSIQSCHQ 161
            SV+I  +II   ++ +     + ++ +  + + ++
Sbjct: 131 LSVDIAEKIIRHNLDKEQDQMEMIDRMLDEMLTANR 166


>gi|306842325|ref|ZP_07474984.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
 gi|306845018|ref|ZP_07477599.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306274650|gb|EFM56439.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306287541|gb|EFM59000.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
          Length = 208

 Score = 72.2 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++  K +    S   +
Sbjct: 178 TTATIVEQLLGLKADKASVSEAVK 201


>gi|330996916|ref|ZP_08320781.1| ATP synthase F0, B subunit [Paraprevotella xylaniphila YIT 11841]
 gi|329571990|gb|EGG53661.1| ATP synthase F0, B subunit [Paraprevotella xylaniphila YIT 11841]
          Length = 168

 Score = 72.2 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   I   I+     P ++   +D     I   +  AR+  E+ + +  + +   +
Sbjct: 12  FWMVIIFGIVFFILAKYAFP-VITGMVDKRKQYIDSSLEAARQANEQLQQVKAESEALLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      +  E  +     +   L +   +I   K  A   +  ++A 
Sbjct: 71  RAHEEQTAILKEASATRDRIIAEARERARTEARKALDETRHQIAAEKESAINDIRRQVAI 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV++  +++ +K+ +D     +  + +  ++S + ++
Sbjct: 131 LSVDVAEKVLRKKLSDDKEQLELVNRLLDEVKSNNDIE 168


>gi|13357692|ref|NP_077966.1| F0F1 ATP synthase subunit B [Ureaplasma parvum serovar 3 str. ATCC
           700970]
 gi|170762248|ref|YP_001752218.1| F0F1 ATP synthase subunit B [Ureaplasma parvum serovar 3 str. ATCC
           27815]
 gi|171920294|ref|ZP_02931646.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 1 str. ATCC
           27813]
 gi|183508843|ref|ZP_02958291.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 14 str. ATCC
           33697]
 gi|186701972|ref|ZP_02554407.2| ATP synthase F0, B subunit [Ureaplasma parvum serovar 6 str. ATCC
           27818]
 gi|81789069|sp|Q9PR09|ATPF_UREPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|226737875|sp|B1AIC4|ATPF_UREP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|11279154|pir||F82929 ATP synthase B chain UU135 [imported] - Ureaplasma urealyticum
 gi|6899094|gb|AAF30541.1|AE002114_8 ATP synthase B chain [Ureaplasma parvum serovar 3 str. ATCC 700970]
 gi|168827825|gb|ACA33087.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 3 str. ATCC
           27815]
 gi|171902707|gb|EDT48996.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 1 str. ATCC
           27813]
 gi|182675815|gb|EDT87720.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 14 str. ATCC
           33697]
 gi|186700735|gb|EDU19017.1| ATP synthase F0, B subunit [Ureaplasma parvum serovar 6 str. ATCC
           27818]
          Length = 205

 Score = 72.2 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 65/156 (41%), Gaps = 3/156 (1%)

Query: 5   ETFLVFMSLIIFLVI---VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
               VF++ +I + +   +V   +       LD   + I  +I +A   ++++   L   
Sbjct: 46  PNVWVFIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENA 105

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K +H   + +T EII  AK  +  L E   +   + +   +   +  I   + E    L 
Sbjct: 106 KSEHLAAQAQTLEIIAKAKSESLTLRESLEKEAREAADKIISSAKISIANERRENLERLQ 165

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           ++  + +      ++ ++++ + N  + ++ I  ++
Sbjct: 166 SEAREAAYIAAEALMKKELSREDNDKLVDQFIKELE 201


>gi|225352597|ref|ZP_03743620.1| hypothetical protein BIFPSEUDO_04222 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156791|gb|EEG70185.1| hypothetical protein BIFPSEUDO_04222 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 173

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y+ + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K   E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  KARVEASKIRDDARTEASHIIADARTRAENDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            +  +  +I+  K+ NDDV SS+ ++ I+ + S
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDQMIADLDS 170


>gi|231608|sp|P21904|ATPF_PROMO RecName: Full=ATP synthase subunit b, sodium ion specific; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I; AltName: Full=F-type ATPase
           subunit b; Short=F-ATPase subunit b
 gi|581457|emb|CAA37913.1| unnamed protein product [Propionigenium modestum]
          Length = 168

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I +           +   LDA  +KI +D+ +A   +E +     + +    
Sbjct: 16  FWQIINFLILM-FFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + E  E++L A+ +A    E   +         LK  E +I  MK +A++ L  ++ D
Sbjct: 75  SAKTEANEMLLRAEKKADERKETILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVTD 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V++  ++I++K++  + +++ ++ I  +  
Sbjct: 135 LAVKLAEKMINEKVDAKIGANLLDQFIGEVGE 166


>gi|261420767|ref|YP_003254449.1| F0F1 ATP synthase subunit B [Geobacillus sp. Y412MC61]
 gi|297531562|ref|YP_003672837.1| ATP synthase F0 subunit beta [Geobacillus sp. C56-T3]
 gi|319768437|ref|YP_004133938.1| ATP synthase F0 subunit B [Geobacillus sp. Y412MC52]
 gi|261377224|gb|ACX79967.1| ATP synthase F0, B subunit [Geobacillus sp. Y412MC61]
 gi|297254814|gb|ADI28260.1| ATP synthase F0, B subunit [Geobacillus sp. C56-T3]
 gi|317113303|gb|ADU95795.1| ATP synthase F0, B subunit [Geobacillus sp. Y412MC52]
          Length = 178

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 72/153 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +  + + I L+ ++       L++ +    + I ++I +A + R+++E +L + +E  
Sbjct: 21  TIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIGQAEKRRQEAEKLLEEQRELM 80

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E + +I  A+  A+   E+   +    +    +  +++I   K +A   L  ++A
Sbjct: 81  KQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEAAKKEIEREKEQAMAALREQVA 140

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             SV I  ++I +++ +     + E  I  +Q 
Sbjct: 141 SLSVLIASKVIEKELTEQDQRKLIEAYIKDVQE 173


>gi|225550369|ref|ZP_03771318.1| ATP synthase subunit B [Ureaplasma urealyticum serovar 2 str. ATCC
           27814]
 gi|225379523|gb|EEH01885.1| ATP synthase subunit B [Ureaplasma urealyticum serovar 2 str. ATCC
           27814]
          Length = 205

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 65/157 (41%), Gaps = 3/157 (1%)

Query: 5   ETFLVFMSLIIFLVI---VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
               VF++ +I + +   +V   +       LD   + I  +I +A   ++++   L   
Sbjct: 46  PNVWVFIAQVIAMCVVFSLVLWLVWKPTNKMLDKRREYIAKEITDAENAKQEALQYLENA 105

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K +H   + ET EII  AK  +  L E   +   + +   +   +  I   + E    L 
Sbjct: 106 KSEHLAAQAETAEIIAKAKSESLTLRELLEKEAREAADKIISSAKISIANERRENLERLQ 165

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  + +      ++ ++++ + N  + ++ I  +++
Sbjct: 166 TEAREAAYIAAEALMKKELSREDNDKLVDQFIKELET 202


>gi|78042703|ref|YP_361342.1| ATP synthase F0 subunit B [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123575369|sp|Q3A942|ATPF_CARHZ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77994818|gb|ABB13717.1| ATP synthase F0, B subunit [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 159

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/159 (22%), Positives = 77/159 (48%), Gaps = 3/159 (1%)

Query: 1   MHFD--ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           MHFD  +     ++  + L I+  L +   +L  ++     I + + +A + +E++E I 
Sbjct: 1   MHFDWSDFIWTLINFFVLLFILKIL-LYKPVLKTIEDRKKSIEESLEKAAKAQEEAERIK 59

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            +Y    +K  EE REII  A+  A+   EE     ++ +   L D +  I   K +A R
Sbjct: 60  AEYDGMIAKAREEAREIIAKAQKTAQAEKEEIIATAQREAQSLLADAKATIAQEKEKALR 119

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            L  +I + +V    +I+++ +  + +  + ++ ++ ++
Sbjct: 120 ELRQEIGNLAVLAAGKILNRAVTLEDHQKLVDEFLNEVK 158


>gi|259046355|ref|ZP_05736756.1| ATP synthase B chain [Granulicatella adiacens ATCC 49175]
 gi|259036992|gb|EEW38247.1| ATP synthase B chain [Granulicatella adiacens ATCC 49175]
          Length = 168

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 74/153 (48%), Gaps = 1/153 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           +T +V +S+ + L  +V       + + L++  DKI  D+ EA   ++ +E I     E 
Sbjct: 16  DTLVVLVSMTLLL-FLVKYFAWDKVNAMLESRRDKISKDLDEAAEKKKAAEEIQANANEI 74

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             K E +  +I+  A+  A    +E  +  +++ +    + ++++  MK  A   +  +I
Sbjct: 75  IHKAELKGSDILNNAREAASKTQDEMIKEGKEVVSRMKAEGQREVDSMKQRAIAQVQDEI 134

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            D S+++  +I+ +++  + +  + E  I  ++
Sbjct: 135 VDLSIQLASQILEKEVTKERHQEVIESFIKGLE 167


>gi|210613764|ref|ZP_03289878.1| hypothetical protein CLONEX_02085 [Clostridium nexile DSM 1787]
 gi|210150973|gb|EEA81981.1| hypothetical protein CLONEX_02085 [Clostridium nexile DSM 1787]
          Length = 171

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 74/151 (49%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++ +S+++   I+ YL + + + S L+    ++ DD   A+R ++++     +Y  K  +
Sbjct: 17  VLGLSMLLLFTILSYL-LFNPVRSLLEKRRQRVLDDQETAKREKQEAIAYKEEYDRKLKE 75

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
           V++E +EI+ AA+ +A     +     ++ +A  ++    +I   K  A   +  ++   
Sbjct: 76  VDKEAQEILSAARKKAMQNEAKIVAEAKEEAARIIEHANAQIELEKKRALDDMKQEMITI 135

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +  ++++  ++  V   + ++T+  +  
Sbjct: 136 ASMMAGKVVAASIDTKVQEGLIDETLKEMGD 166


>gi|308234031|ref|ZP_07664768.1| ATP synthase F0, B subunit [Atopobium vaginae DSM 15829]
 gi|328944385|ref|ZP_08241847.1| ATP synthase F0 sector subunit B [Atopobium vaginae DSM 15829]
 gi|327490969|gb|EGF22746.1| ATP synthase F0 sector subunit B [Atopobium vaginae DSM 15829]
          Length = 212

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/160 (16%), Positives = 66/160 (41%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             FL  ++  + +  ++       ++  ++    KI+ D+  A   + K+E    +  + 
Sbjct: 52  AEFLPALAAFLVVWFIMARFAWPSIVKMMEKRELKIKGDLDSAEEAKLKAEQDRKESAKT 111

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               + +  EII  AK  A+   E    + ++ ++  ++     I   + +A   L   +
Sbjct: 112 IGDAQIKAAEIIATAKREAEQEREHILADAQRNASGLIEKARDAITTERHKAMIELSGFV 171

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDK 164
            D SVEI  +II   +++     + E  +  + + H  ++
Sbjct: 172 VDLSVEIAGKIIGNSLSEAQQRDLAEHYLHEVGAKHDEEQ 211


>gi|297585423|ref|YP_003701203.1| ATP synthase F0 subunit B [Bacillus selenitireducens MLS10]
 gi|297143880|gb|ADI00638.1| ATP synthase F0, B subunit [Bacillus selenitireducens MLS10]
          Length = 165

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 66/144 (45%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            +FL+ ++       ++  ++     + D I  A + R+++E  L + +E      +E +
Sbjct: 19  FLFLMWLLKRYAFGPIMDMMEKREKHVADQIKSAEKNRDEAEQYLKEQREAIQTARQEAK 78

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           EI+  AK  +   A +   +    +    +  + +I+  K +A   L  +++  SV +  
Sbjct: 79  EIVENAKKMSDQQAADIVASARTEAERLKETAKAEINSEKEQAVSALREQVSTLSVLVAS 138

Query: 134 EIISQKMNDDVNSSIFEKTISSIQ 157
           ++I +++++     + ++T+  + 
Sbjct: 139 KVIEKELDEKEQEKLIQETLKEVG 162


>gi|254718568|ref|ZP_05180379.1| F0F1 ATP synthase subunit B' [Brucella sp. 83/13]
 gi|265983543|ref|ZP_06096278.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306837305|ref|ZP_07470188.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
 gi|264662135|gb|EEZ32396.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306407618|gb|EFM63814.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
          Length = 208

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E +I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEGRIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++  K +    S   +
Sbjct: 178 TTATIVEQLLGLKADKASVSEAVK 201


>gi|329726099|gb|EGG62571.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU144]
          Length = 171

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 71/154 (46%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T +  ++ +I + I++       L   +D     I  DI +A + +  ++ +  + ++ 
Sbjct: 18  TTIVTLVTFVILI-ILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKT 76

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  ++
Sbjct: 77  LKETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQV 136

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++ SV I  +++ +++++     + EK +     
Sbjct: 137 SELSVLIASKVLRKEISEQDQKELVEKYLKEAGD 170


>gi|116490719|ref|YP_810263.1| F0F1-type ATP synthase, subunit b [Oenococcus oeni PSU-1]
 gi|122277097|sp|Q04G24|ATPF_OENOB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116091444|gb|ABJ56598.1| ATP synthase F0 subcomplex B subunit [Oenococcus oeni PSU-1]
          Length = 176

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V ++ I+ + I+  L     +   +DA A++I DD+  A + + +++ +         +
Sbjct: 16  FVLLTFILLMFILKKL-AWGPITKIMDARANQINDDLDSAAKSKNEAKKLQTVADTNLKE 74

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + +   ++  A+  ++  +++     +  +    +  +     +K +A      +IAD 
Sbjct: 75  SQSQATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDEIADL 134

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           SV I   II +++    + ++ +  IS ++   +
Sbjct: 135 SVSIASRIIGKEITASKHKALIDDFISELEKQQE 168


>gi|15964590|ref|NP_384943.1| F0F1 ATP synthase subunit B' [Sinorhizobium meliloti 1021]
 gi|307309336|ref|ZP_07588999.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti BL225C]
 gi|307320072|ref|ZP_07599493.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti AK83]
 gi|81635006|sp|Q92RM6|ATPX_RHIME RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|15073768|emb|CAC45409.1| Probable ATP synthase subunit B' transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306894287|gb|EFN25052.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti AK83]
 gi|306900205|gb|EFN30823.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti BL225C]
          Length = 204

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 69/149 (46%), Gaps = 1/149 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + IP  +   L+   D+I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 57  LWLAITFGLFYLLMSKVIIPR-IGGILETRHDRIAQDLDEASRLKGEADAAIAAYEQELA 115

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  A+     +E   A  +   E +I  +K +A   + A   +
Sbjct: 116 GARAKGHSIADTAREAAKAKAKADRDGVEAGLAKKIAAAEARIADIKSKALADVGAIAEE 175

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
            +  +V+++I   +     ++ F+ +  +
Sbjct: 176 TATAVVKQLIGGTVTKAEIAAAFKASAGN 204


>gi|158321584|ref|YP_001514091.1| ATP synthase F0, B subunit [Alkaliphilus oremlandii OhILAs]
 gi|226694436|sp|A8MJW3|ATPF_ALKOO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158141783|gb|ABW20095.1| ATP synthase F0, B subunit [Alkaliphilus oremlandii OhILAs]
          Length = 167

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 68/153 (44%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD TF   ++  + + +++   +   +  F+D     I + I EA    ++S  +  QY+
Sbjct: 7   FDATFFFQLANTLIMFLILKHFLFQPVTEFMDKRTKAIEESIAEAELKNKESNELKAQYE 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K +++++E  +II  A   A+   +E        +   ++    +I   K +    L  
Sbjct: 67  SKLTEIKKERTQIIDEAVRNAQKRGDEIVSAAGVEARRTIEKATAEIEREKQKMMNELKG 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           +I+  ++   +++I + ++   +  + ++ I  
Sbjct: 127 EISQLAIAAAQKVIEKDLDQSAHQQMIQQFIDK 159


>gi|86356512|ref|YP_468404.1| F0F1 ATP synthase subunit B' [Rhizobium etli CFN 42]
 gi|123512872|sp|Q2KBV9|ATPX_RHIEC RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|86280614|gb|ABC89677.1| ATP synthase protein, subunit B` [Rhizobium etli CFN 42]
          Length = 207

 Score = 71.9 bits (175), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 64/133 (48%), Gaps = 1/133 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  +  P  + + LD    +I  D+ EA RL+ +++  +  Y+ + +
Sbjct: 59  LWLVITFGVFYLLMQKVIAPR-IGAILDQRHKRISQDLEEAGRLKAEADAAVQTYEGELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               ++  I  AA+  AK+ AEE  + +E   +  +K  E +I  +K +A   +     +
Sbjct: 118 AARAKSHAIGSAARDAAKVKAEEDRRTVEASLSEKIKAAEARIADIKAKAFADVGTIAEE 177

Query: 127 FSVEIVREIISQK 139
            +  +V ++I   
Sbjct: 178 TAAAVVEQLIGST 190


>gi|23464960|ref|NP_695563.1| F0F1 ATP synthase subunit B [Bifidobacterium longum NCC2705]
 gi|81754473|sp|Q8G7A9|ATPF_BIFLO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|23325557|gb|AAN24199.1| protein with similarity to ATP synthase B chain [Bifidobacterium
           longum NCC2705]
          Length = 173

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 64/152 (42%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  V      +P    +  D  A KI+ +I +A + R+ ++    +Y+ + S 
Sbjct: 21  WSLIILVIVAVFFYKFFMP-KFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLST 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  +I   A+  A  +  +     E  +A      ++ I     +A   L  ++   
Sbjct: 80  ARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGAL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+  K+ ++DV SS+ +  I  + +
Sbjct: 140 ATALAGKILGAKLEDNDVQSSMIDSMIDDLGA 171


>gi|218130972|ref|ZP_03459776.1| hypothetical protein BACEGG_02574 [Bacteroides eggerthii DSM 20697]
 gi|317476283|ref|ZP_07935533.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|217986844|gb|EEC53176.1| hypothetical protein BACEGG_02574 [Bacteroides eggerthii DSM 20697]
 gi|316907557|gb|EFV29261.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 166

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 69/156 (44%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  AR+   +   +  + +   +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEGRRTYIDQSLEVARQANIQLAKLKEESEALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  ++ E ++   L D++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRIMREAMHERDKIIIEARKHAEAVAQKELDDVKQQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQ 161
            SV+I  +II + +++      + ++ +  + + + 
Sbjct: 131 LSVDIAEKIIRRNLDEKHEQMEMIDRMLDEMLAANH 166


>gi|257470707|ref|ZP_05634797.1| ATP synthase B chain, sodium ion specific [Fusobacterium ulcerans
           ATCC 49185]
          Length = 168

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 70/153 (45%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y + P  L   L+    KI  D+ +A   +E +  +  + +E  
Sbjct: 16  FWQIINFFILVFVFNKYFKKP--LGKMLETRKAKITSDLNDANVNKEAAMKLQKEAEELL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K + +  EI+  A+H+A    E      +      +K+ E +   MK + ++ L  ++ 
Sbjct: 74  KKAKFQANEILKTAEHKADERREYILSEAKDQRDKIIKNAELEAVKMKSDVRKELQDEVK 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +V +  ++I +K+N  + S++ ++ I  +  
Sbjct: 134 DLAVRLAEKLIEEKINPKLESTLIDEFIEEVGE 166


>gi|49484331|ref|YP_041555.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|282904776|ref|ZP_06312650.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906451|ref|ZP_06314302.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909420|ref|ZP_06317235.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282920285|ref|ZP_06328009.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|283958887|ref|ZP_06376332.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|295428694|ref|ZP_06821320.1| ATP synthase F0 [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297589826|ref|ZP_06948466.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus MN8]
 gi|81650653|sp|Q6GEW8|ATPF_STAAR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|49242460|emb|CAG41176.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|282316145|gb|EFB46526.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|282326690|gb|EFB56988.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330401|gb|EFB59919.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282594809|gb|EFB99786.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C160]
 gi|283789605|gb|EFC28428.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|295127364|gb|EFG57004.1| ATP synthase F0 [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297576954|gb|EFH95668.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus MN8]
 gi|315193272|gb|EFU23670.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 173

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 71/153 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++    ++ +K +     
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAGD 172


>gi|134300985|ref|YP_001114481.1| ATP synthase F0 subunit B [Desulfotomaculum reducens MI-1]
 gi|226741433|sp|A4J9A3|ATPF_DESRM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|134053685|gb|ABO51656.1| ATP synthase F0 subcomplex B subunit [Desulfotomaculum reducens
           MI-1]
          Length = 189

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 32/159 (20%), Positives = 67/159 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + F+ T L  M   + L+I++        ++ L+   + I   I  A   ++++E +   
Sbjct: 29  LGFNGTLLAQMFNFLVLLILLRAVAYKPFMNMLEKRRELIEGSIAAAEEDKKQAEQLRAT 88

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +    +  E+  E++  A   A+  A++  +  +  +A        +I   K  A   L
Sbjct: 89  LQADLQRSREQATEMMARATKNAEEQAQQIIEAAKAEAARVKDSALSEIQREKERAVAEL 148

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             ++A  S+ +  +II QK+NDDV   +  K +      
Sbjct: 149 RDQVATLSILVAGKIIDQKLNDDVQKDLVNKFVKEAGDL 187


>gi|322688425|ref|YP_004208159.1| ATP synthase subunit beta [Bifidobacterium longum subsp. infantis
           157F]
 gi|320459761|dbj|BAJ70381.1| ATP synthase subunit B [Bifidobacterium longum subsp. infantis
           157F]
          Length = 172

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 63/152 (41%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  V      +P    +  D  A KI+ +I +A + R+ ++    +Y+ + S 
Sbjct: 20  WSLIILVIVAVFFYKFFMP-KFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLST 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  +I   A+  A  +  +     E  +A      ++ I     +A   L  ++   
Sbjct: 79  ARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGAL 138

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+  K+ + DV SS+ +  I  + +
Sbjct: 139 ATALAGKILGAKLEDSDVQSSMIDSMIDDLGA 170


>gi|154245920|ref|YP_001416878.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
 gi|226694401|sp|A7IGS8|ATPF2_XANP2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|154160005|gb|ABS67221.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
          Length = 207

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 61/153 (39%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S  +  +++  + +P  +   L+   D+I DD+ EA + + +SE     Y++  +
Sbjct: 56  LWLVLSFGLLYLLMSRVALPR-IGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALA 114

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I    ++R    +E   +++E   A+ L   EQ I   K EA   +     D
Sbjct: 115 EARAKANAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVD 174

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +  IV  +I             +  +    + 
Sbjct: 175 ATHAIVSTLIGSSPAQSDVEKAVDVALVKKDAA 207


>gi|283782654|ref|YP_003373408.1| ATP synthase F0, B subunit [Gardnerella vaginalis 409-05]
 gi|283441546|gb|ADB14012.1| ATP synthase F0, B subunit [Gardnerella vaginalis 409-05]
          Length = 180

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 77/168 (45%), Gaps = 3/168 (1%)

Query: 1   MHFDETFLVFMSLIIFLVI--VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           +   E + V  SL+I +V+    Y  +     + LD  A+KI   + +A  ++ +++ + 
Sbjct: 12  LFLPEPYDVIWSLVILVVLAAFFYKFVMPKFQAILDERAEKIEGGMAKAANVQREADELK 71

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            Q + + S+ + +  +    A+  A  +  E  Q  E+ +A  + + +  I      A  
Sbjct: 72  SQIENELSQAQTDAAKTREEARAEASKIIGEARQRAEKDAAKIISEAQHSIEAQHKHAMS 131

Query: 119 LLYAKIADFSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQMDKN 165
            L  +++  +  +  +I++ K++DD V+S I +  I  +      D++
Sbjct: 132 SLQGEVSVLAAALAGKILASKLDDDTVSSKIIDHVIDEVGDTKNSDQS 179


>gi|293627818|gb|ADE58440.1| ATP synthase beta-chain [Bartonella quintana]
          Length = 148

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 73/146 (50%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +F + +  + +P  +   ++   D+I  D+ +A R++++++ ++  Y+ K +
Sbjct: 2   FWLAISFGLFYLFISRVIVPR-IGDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLA 60

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA    K   E   + IE      LKD E++I  ++ +A + + +   +
Sbjct: 61  QARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQIAKIRDKAMQNVGSIAEE 120

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            ++EIV+++I   ++ +   S  +  
Sbjct: 121 AALEIVKKMIDVDVSRESVRSAVKAA 146


>gi|118443791|ref|YP_879000.1| F0F1 ATP synthase subunit B [Clostridium novyi NT]
 gi|226741361|sp|A0Q2Z8|ATPF_CLONN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|118134247|gb|ABK61291.1| ATP synthase F0, B subunit [Clostridium novyi NT]
          Length = 159

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 81/150 (54%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ LV++ Y  +   +   +D  +  I  DI +AR  ++K+E + +  +E++  
Sbjct: 10  WTIINFLLLLVVLSYF-LFKPVNEIIDKRSKDIEGDIEQARIDKDKAEELRIANEEEYKA 68

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E + I+   K +A+ ++EE   +  + + + ++  +++I   + +A+  +  K  + 
Sbjct: 69  AKKEGKIIVENYKAKAENVSEEIISDAHKEAEIIIERAKKEIQREREKAEYEIKNKTIEL 128

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           S+E+ ++ + + +++ ++  + E+ IS + 
Sbjct: 129 SLELSKKALERSIDEKMHRELIEEFISKVG 158


>gi|317064912|ref|ZP_07929397.1| ATP synthase subunit B [Fusobacterium ulcerans ATCC 49185]
 gi|313690588|gb|EFS27423.1| ATP synthase subunit B [Fusobacterium ulcerans ATCC 49185]
          Length = 163

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 70/153 (45%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y + P  L   L+    KI  D+ +A   +E +  +  + +E  
Sbjct: 11  FWQIINFFILVFVFNKYFKKP--LGKMLETRKAKITSDLNDANVNKEAAMKLQKEAEELL 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K + +  EI+  A+H+A    E      +      +K+ E +   MK + ++ L  ++ 
Sbjct: 69  KKAKFQANEILKTAEHKADERREYILSEAKDQRDKIIKNAELEAVKMKSDVRKELQDEVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +V +  ++I +K+N  + S++ ++ I  +  
Sbjct: 129 DLAVRLAEKLIEEKINPKLESTLIDEFIEEVGE 161


>gi|118586240|ref|ZP_01543700.1| ATP synthase, b subunit [Oenococcus oeni ATCC BAA-1163]
 gi|118433324|gb|EAV40030.1| ATP synthase, b subunit [Oenococcus oeni ATCC BAA-1163]
          Length = 179

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V ++ I+ + I+  L     +   +DA A++I DD+  A + + +++ +         +
Sbjct: 19  FVLLTFILLMFILKKL-AWGPITKIMDARANQINDDLDSAAKSKNEAKKLQTVADTNLKE 77

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + +   ++  A+  ++  +++     +  +    +  +     +K +A      +IAD 
Sbjct: 78  SQSQATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDEIADL 137

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           SV I   II +++    + ++ +  IS ++   +
Sbjct: 138 SVSIASRIIGKEITASKHKALIDDFISELEKQQE 171


>gi|269794327|ref|YP_003313782.1| ATP synthase F0 subcomplex subunit B [Sanguibacter keddieii DSM
           10542]
 gi|269096512|gb|ACZ20948.1| ATP synthase F0 subcomplex B subunit [Sanguibacter keddieii DSM
           10542]
          Length = 194

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 17  LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREII 76
           + ++ Y  +     + LD    KI   + +A   + +++ +L QYK +  +   +   I 
Sbjct: 42  VGLMFYKLVLPKFTAILDERTAKIEGGLSKAEHAQAEADALLAQYKAQLQEARTDAARIR 101

Query: 77  LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREII 136
             A+  A  +  E      + SA   +  +++I   + +A   L   +   + E+  +I+
Sbjct: 102 EEARGEATAIVAEAKAKASEESARIFETAQRQIEAERQQASTSLRNDVGALATELASKIV 161

Query: 137 SQKM-NDDVNSSIFEKTISSIQSCH 160
            + + +    S + ++ +  +++  
Sbjct: 162 GESLEDTARQSRVVDRFLDELEASA 186


>gi|23336544|ref|ZP_00121756.1| COG0711: F0F1-type ATP synthase, subunit b [Bifidobacterium longum
           DJO10A]
 gi|189439990|ref|YP_001955071.1| F0F1 ATP synthase subunit B [Bifidobacterium longum DJO10A]
 gi|227545744|ref|ZP_03975793.1| F0F1 ATP synthase subunit B [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239622553|ref|ZP_04665584.1| ATP synthase B subunit [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|296453445|ref|YP_003660588.1| ATP synthase F0 subunit B [Bifidobacterium longum subsp. longum
           JDM301]
 gi|312133385|ref|YP_004000724.1| atpf [Bifidobacterium longum subsp. longum BBMN68]
 gi|317481931|ref|ZP_07940956.1| ATP synthase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322690444|ref|YP_004220014.1| ATP synthase subunit B [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|226741310|sp|B3DTV4|ATPF_BIFLD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189428425|gb|ACD98573.1| F0F1-type ATP synthase subunit b [Bifidobacterium longum DJO10A]
 gi|227213860|gb|EEI81699.1| F0F1 ATP synthase subunit B [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239514550|gb|EEQ54417.1| ATP synthase B subunit [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|291517462|emb|CBK71078.1| ATP synthase F0 subcomplex B subunit [Bifidobacterium longum subsp.
           longum F8]
 gi|296182876|gb|ADG99757.1| ATP synthase F0, B subunit [Bifidobacterium longum subsp. longum
           JDM301]
 gi|311772611|gb|ADQ02099.1| AtpF [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916498|gb|EFV37895.1| ATP synthase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455300|dbj|BAJ65922.1| ATP synthase subunit B [Bifidobacterium longum subsp. longum JCM
           1217]
          Length = 172

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 64/152 (42%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  V      +P    +  D  A KI+ +I +A + R+ ++    +Y+ + S 
Sbjct: 20  WSLIILVIVAVFFYKFFMP-KFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLST 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  +I   A+  A  +  +     E  +A      ++ I     +A   L  ++   
Sbjct: 79  ARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGAL 138

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+  K+ ++DV SS+ +  I  + +
Sbjct: 139 ATALAGKILGAKLEDNDVQSSMIDSMIDDLGA 170


>gi|283771275|ref|ZP_06344164.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           H19]
 gi|283459480|gb|EFC06573.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           H19]
          Length = 173

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 71/153 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLKKFAWGPLKDIMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++    ++ +K +     
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAGD 172


>gi|23501288|ref|NP_697415.1| F0F1 ATP synthase subunit B' [Brucella suis 1330]
 gi|62289374|ref|YP_221167.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 1 str. 9-941]
 gi|82699299|ref|YP_413873.1| F0F1 ATP synthase subunit B' [Brucella melitensis biovar Abortus
           2308]
 gi|148559980|ref|YP_001258411.1| F0F1 ATP synthase subunit B' [Brucella ovis ATCC 25840]
 gi|161618360|ref|YP_001592247.1| F0F1 ATP synthase subunit B' [Brucella canis ATCC 23365]
 gi|163842668|ref|YP_001627072.1| F0F1 ATP synthase subunit B' [Brucella suis ATCC 23445]
 gi|189023627|ref|YP_001934395.1| F0F1 ATP synthase subunit B' [Brucella abortus S19]
 gi|225626899|ref|ZP_03784938.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237814861|ref|ZP_04593859.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|254688689|ref|ZP_05151943.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 6 str. 870]
 gi|254693172|ref|ZP_05155000.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 3 str. Tulya]
 gi|254696816|ref|ZP_05158644.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701196|ref|ZP_05163024.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 5 str. 513]
 gi|254703741|ref|ZP_05165569.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 3 str. 686]
 gi|254707879|ref|ZP_05169707.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M163/99/10]
 gi|254709537|ref|ZP_05171348.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis B2/94]
 gi|254729723|ref|ZP_05188301.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 4 str. 292]
 gi|256031031|ref|ZP_05444645.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M292/94/1]
 gi|256060523|ref|ZP_05450692.1| F0F1 ATP synthase subunit B' [Brucella neotomae 5K33]
 gi|256159089|ref|ZP_05456915.1| F0F1 ATP synthase subunit B' [Brucella ceti M490/95/1]
 gi|256254434|ref|ZP_05459970.1| F0F1 ATP synthase subunit B' [Brucella ceti B1/94]
 gi|256256936|ref|ZP_05462472.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 9 str. C68]
 gi|256368840|ref|YP_003106346.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260168163|ref|ZP_05754974.1| F0F1 ATP synthase subunit B' [Brucella sp. F5/99]
 gi|260545873|ref|ZP_05821614.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260567004|ref|ZP_05837474.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260754165|ref|ZP_05866513.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757385|ref|ZP_05869733.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761209|ref|ZP_05873552.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883190|ref|ZP_05894804.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213412|ref|ZP_05927693.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|261221602|ref|ZP_05935883.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315370|ref|ZP_05954567.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317063|ref|ZP_05956260.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261324517|ref|ZP_05963714.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751733|ref|ZP_05995442.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261754386|ref|ZP_05998095.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|261757621|ref|ZP_06001330.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265988101|ref|ZP_06100658.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265997566|ref|ZP_06110123.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851767|ref|ZP_06792440.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297247787|ref|ZP_06931505.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
 gi|75505336|sp|Q57EX8|ATPF_BRUAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81753123|sp|Q8G2D9|ATPF1_BRUSU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|123546350|sp|Q2YMC5|ATPF1_BRUA2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694367|sp|B2S9N0|ATPF1_BRUA1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694385|sp|A9M8G0|ATPF1_BRUC2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694387|sp|A5VNW4|ATPF1_BRUO2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694388|sp|B0CK72|ATPF1_BRUSI RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|23347176|gb|AAN29330.1| ATP synthase F0, B subunit, putative [Brucella suis 1330]
 gi|62195506|gb|AAX73806.1| ATP synthase F0, B subunit, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82615400|emb|CAJ10369.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|148371237|gb|ABQ61216.1| putative ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
 gi|161335171|gb|ABX61476.1| ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|163673391|gb|ABY37502.1| ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|189019199|gb|ACD71921.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|225618556|gb|EEH15599.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237789698|gb|EEP63908.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|255998998|gb|ACU47397.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260097280|gb|EEW81155.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260156522|gb|EEW91602.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260667703|gb|EEX54643.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671641|gb|EEX58462.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674273|gb|EEX61094.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872718|gb|EEX79787.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915019|gb|EEX81880.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|260920186|gb|EEX86839.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261296286|gb|EEX99782.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300497|gb|EEY03994.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304396|gb|EEY07893.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737605|gb|EEY25601.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741486|gb|EEY29412.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261744139|gb|EEY32065.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|262552034|gb|EEZ08024.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|264660298|gb|EEZ30559.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|294820356|gb|EFG37355.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297174956|gb|EFH34303.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
          Length = 208

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++    +    S   +
Sbjct: 178 TTATIVEQLLGLTADKASVSEAVK 201


>gi|295394656|ref|ZP_06804875.1| ATP synthase F0 sector subunit B [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972549|gb|EFG48405.1| ATP synthase F0 sector subunit B [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 184

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 69/151 (45%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  II LV+   + +P      LD  A++I+  I +A +++ +++  L +Y+++ + 
Sbjct: 24  WSAVCFIIILVVFWKVILP-KFKKTLDERAERIQGGIEKAEKVQAEADAALAEYQKQLAD 82

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+     +  E  Q   + +   +   + +I   + +A   L  ++   
Sbjct: 83  GRAEAARLRAEAQEEGAQILAETKQRATEEADRIISAAKAQIEAERQQAMNSLRTEVGSL 142

Query: 128 SVEIVREIISQKMNDDVNSS-IFEKTISSIQ 157
           + ++   I+ + + DD  S+ + ++ I+ ++
Sbjct: 143 ATDLASRIVGESLQDDARSASVVDRFIADLE 173


>gi|308234730|ref|ZP_07665467.1| F0F1 ATP synthase subunit B [Gardnerella vaginalis ATCC 14018]
 gi|311113895|ref|YP_003985116.1| ATP synthase F0 sector subunit B [Gardnerella vaginalis ATCC 14019]
 gi|310945389|gb|ADP38093.1| ATP synthase F0 sector subunit B [Gardnerella vaginalis ATCC 14019]
          Length = 180

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 78/168 (46%), Gaps = 3/168 (1%)

Query: 1   MHFDETFLVFMSLIIFLVI--VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           +   E + V  SL+I +V+    Y  +     + LD  A+KI   + +A  ++ +++ + 
Sbjct: 12  LFLPEPYDVIWSLVILVVLAAFFYKFVMPKFQAILDERAEKIEGGMSKAANVQREADELK 71

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            Q +E+ ++ + +  +    A+ +A  + +E  Q  E+ +A  + + +  I      A  
Sbjct: 72  SQMEEELAQAQADAAKTREQARAQASKIVDEARQRAEKDAAKIISEAQYSIEAQHKHAMS 131

Query: 119 LLYAKIADFSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQMDKN 165
            L  +++  +  +  +I++ K++DD V S I +  I  +       +N
Sbjct: 132 SLQGEVSVLAAALAGKILASKLDDDTVGSKIIDHVIDEVGDVKSSGQN 179


>gi|115373534|ref|ZP_01460831.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1]
 gi|115369540|gb|EAU68478.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1]
          Length = 200

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ I+  V++ + +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 39  FWTLVTFILVAVVLRW-KAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKTAIA 97

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++   +   +   +E      + +        ++I   KL+A   +     D
Sbjct: 98  EARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTMAVD 157

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++E+  +++S++M+D  + ++ E+ +  +   
Sbjct: 158 LAMEVAGKLLSERMDDAKHRALAEQFVQGLPVA 190


>gi|76798166|ref|ZP_00780418.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|76586474|gb|EAO62980.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
          Length = 145

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 54/128 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++    ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S 
Sbjct: 14  IIVSGSVLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSN 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + E  +II  AK       ++     +  +    +   Q I   K EA      ++AD 
Sbjct: 74  AKTEANQIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADGKGEVADL 133

Query: 128 SVEIVREI 135
           +V +  +I
Sbjct: 134 TVLLAEKI 141


>gi|159900581|ref|YP_001546828.1| F0F1 ATP synthase subunit B [Herpetosiphon aurantiacus ATCC 23779]
 gi|226741472|sp|A9AVV0|ATPF_HERA2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|159893620|gb|ABX06700.1| ATP synthase F0, B subunit [Herpetosiphon aurantiacus ATCC 23779]
          Length = 164

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 24/145 (16%), Positives = 63/145 (43%)

Query: 16  FLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREI 75
            L  ++   +   +L+ L A +++IR+ +  A +++++   +   Y+ K  +   E + I
Sbjct: 20  LLAFLLNTFLYKPVLNALQARSERIRESLDNAEKVKQQLARVDADYEAKLQEARREGQTI 79

Query: 76  ILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREI 135
           I  A+ RA+    E        +A   ++   K+   + +  R L  ++A    E    +
Sbjct: 80  ISQAQERARAQEAELLVVARNNAAKIEEEARGKVEQERQQVLRGLQGQLASLVTETASNV 139

Query: 136 ISQKMNDDVNSSIFEKTISSIQSCH 160
           + +++    +  +  K+I  +   +
Sbjct: 140 LGRELQTKGHDELINKSIDQLGRLN 164


>gi|328465137|gb|EGF36405.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 1816]
          Length = 165

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + K
Sbjct: 14  FGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQK 72

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L  
Sbjct: 73  SVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALRE 132

Query: 123 KIADFSVEIVREIISQKMNDDVNSSI 148
           ++   SV I  ++I + +++  N ++
Sbjct: 133 QVGSLSVLIASKVIEKNLDEKNNLTL 158


>gi|85858473|ref|YP_460675.1| ATP synthase B chain [Syntrophus aciditrophicus SB]
 gi|123515870|sp|Q2LQZ9|ATPF1_SYNAS RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|85721564|gb|ABC76507.1| ATP synthase B chain [Syntrophus aciditrophicus SB]
          Length = 202

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 64/157 (40%), Gaps = 9/157 (5%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  II + +  +L   S + SF     ++I+  + EAR  +E +E+   +Y EK  K
Sbjct: 51  WRVLDFIILVGLFYWLLA-SKVKSFFSGRREEIKTTLEEARLAKEAAEHKFKEYSEKLDK 109

Query: 68  VEEETRE----IILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
             +E       I    +   + + E+  +   ++       +EQ++     +    L  +
Sbjct: 110 ASKEIEGVYEMIRAQGQAEKEKILEDARKAAAKMKEDTQARIEQELKKASQQ----LRME 165

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               SV +  +I+ + +  + + S+ +  +  +   H
Sbjct: 166 AVQLSVHVAEDILKRNITPEDHQSMVKDYLDKVVRKH 202


>gi|15925097|ref|NP_372631.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927681|ref|NP_375214.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283760|ref|NP_646848.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486900|ref|YP_044121.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57652129|ref|YP_186914.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           COL]
 gi|82751708|ref|YP_417449.1| F0F1 ATP synthase subunit B [Staphylococcus aureus RF122]
 gi|87162300|ref|YP_494708.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196011|ref|YP_500824.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|148268558|ref|YP_001247501.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150394622|ref|YP_001317297.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151222223|ref|YP_001333045.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156980422|ref|YP_001442681.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161510314|ref|YP_001575973.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141626|ref|ZP_03566119.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315775|ref|ZP_04838988.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|253731055|ref|ZP_04865220.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733059|ref|ZP_04867224.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006895|ref|ZP_05145496.2| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257426246|ref|ZP_05602661.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428904|ref|ZP_05605298.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431513|ref|ZP_05607886.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257434222|ref|ZP_05610572.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257437135|ref|ZP_05613175.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793865|ref|ZP_05642844.1| ATP synthase F0, B subunit [Staphylococcus aureus A9781]
 gi|258407033|ref|ZP_05680183.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9763]
 gi|258422055|ref|ZP_05684972.1| ATP synthase F0, B subunit [Staphylococcus aureus A9719]
 gi|258422893|ref|ZP_05685793.1| ATP synthase F0, B subunit [Staphylococcus aureus A9635]
 gi|258433576|ref|ZP_05688649.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9299]
 gi|258440471|ref|ZP_05690641.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A8115]
 gi|258445679|ref|ZP_05693857.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6300]
 gi|258450133|ref|ZP_05698228.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6224]
 gi|258453183|ref|ZP_05701174.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A5948]
 gi|258453412|ref|ZP_05701394.1| ATP synthase F0, B subunit [Staphylococcus aureus A5937]
 gi|262049274|ref|ZP_06022149.1| ATP synthase B chain [Staphylococcus aureus D30]
 gi|269203743|ref|YP_003283012.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894751|ref|ZP_06302977.1| ATP synthase F0, B subunit [Staphylococcus aureus A8117]
 gi|282911672|ref|ZP_06319471.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914956|ref|ZP_06322736.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M899]
 gi|282923095|ref|ZP_06330780.1| ATP synthase F0, B subunit [Staphylococcus aureus A9765]
 gi|282925496|ref|ZP_06333150.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282929031|ref|ZP_06336616.1| ATP synthase F0, B subunit [Staphylococcus aureus A10102]
 gi|284025141|ref|ZP_06379539.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           132]
 gi|293509024|ref|ZP_06667811.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510939|ref|ZP_06669638.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|293547541|ref|ZP_06672216.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294850077|ref|ZP_06790814.1| ATP synthase F0 [Staphylococcus aureus A9754]
 gi|295407037|ref|ZP_06816839.1| ATP synthase F0 [Staphylococcus aureus A8819]
 gi|296275414|ref|ZP_06857921.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297210072|ref|ZP_06926465.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297246036|ref|ZP_06929893.1| ATP synthase F0 [Staphylococcus aureus A8796]
 gi|300910435|ref|ZP_07127887.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304379288|ref|ZP_07362027.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|81648901|sp|Q6G7K3|ATPF_STAAS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81694059|sp|Q5HE93|ATPF_STAAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81704255|sp|Q7A0C4|ATPF_STAAW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81705321|sp|Q7A4E7|ATPF_STAAN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81781174|sp|Q99SF1|ATPF_STAAM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122540612|sp|Q2G2F8|ATPF_STAA8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123484936|sp|Q2FF20|ATPF_STAA3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123548233|sp|Q2YUJ7|ATPF_STAAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695871|sp|A7X4U9|ATPF_STAA1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695872|sp|A6U3J2|ATPF_STAA2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695874|sp|A5IUQ2|ATPF_STAA9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695875|sp|A6QIV1|ATPF_STAAE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695876|sp|A8YY74|ATPF_STAAT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13701901|dbj|BAB43193.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus N315]
 gi|14247880|dbj|BAB58269.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu50]
 gi|21205202|dbj|BAB95896.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus MW2]
 gi|49245343|emb|CAG43818.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57286315|gb|AAW38409.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           COL]
 gi|82657239|emb|CAI81680.1| ATP synthase B chain [Staphylococcus aureus RF122]
 gi|87128274|gb|ABD22788.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203569|gb|ABD31379.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741627|gb|ABQ49925.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947074|gb|ABR53010.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           JH1]
 gi|150375023|dbj|BAF68283.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722557|dbj|BAF78974.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu3]
 gi|160369123|gb|ABX30094.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating
           F-type ATPase epsilon subunit subunit B [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|253725182|gb|EES93911.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728967|gb|EES97696.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257270951|gb|EEV03124.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274246|gb|EEV05763.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257277754|gb|EEV08424.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257280861|gb|EEV11006.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283528|gb|EEV13655.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787837|gb|EEV26177.1| ATP synthase F0, B subunit [Staphylococcus aureus A9781]
 gi|257841366|gb|EEV65810.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9763]
 gi|257841955|gb|EEV66387.1| ATP synthase F0, B subunit [Staphylococcus aureus A9719]
 gi|257846917|gb|EEV70931.1| ATP synthase F0, B subunit [Staphylococcus aureus A9635]
 gi|257849307|gb|EEV73286.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9299]
 gi|257852540|gb|EEV76458.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A8115]
 gi|257855518|gb|EEV78455.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6300]
 gi|257856607|gb|EEV79513.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6224]
 gi|257859129|gb|EEV81986.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A5948]
 gi|257864393|gb|EEV87139.1| ATP synthase F0, B subunit [Staphylococcus aureus A5937]
 gi|259162639|gb|EEW47206.1| ATP synthase B chain [Staphylococcus aureus D30]
 gi|262076033|gb|ACY12006.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941706|emb|CBI50113.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282312897|gb|EFB43298.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282321159|gb|EFB51490.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324437|gb|EFB54750.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282589337|gb|EFB94429.1| ATP synthase F0, B subunit [Staphylococcus aureus A10102]
 gi|282593286|gb|EFB98283.1| ATP synthase F0, B subunit [Staphylococcus aureus A9765]
 gi|282762839|gb|EFC02973.1| ATP synthase F0, B subunit [Staphylococcus aureus A8117]
 gi|283471324|emb|CAQ50535.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           ST398]
 gi|285817771|gb|ADC38258.1| ATP synthase B chain [Staphylococcus aureus 04-02981]
 gi|290919661|gb|EFD96734.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291094728|gb|EFE25000.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466224|gb|EFF08751.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|294823025|gb|EFG39457.1| ATP synthase F0 [Staphylococcus aureus A9754]
 gi|294968062|gb|EFG44089.1| ATP synthase F0 [Staphylococcus aureus A8819]
 gi|296885272|gb|EFH24212.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297177035|gb|EFH36290.1| ATP synthase F0 [Staphylococcus aureus A8796]
 gi|298695381|gb|ADI98603.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus ED133]
 gi|300888277|gb|EFK83468.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302333753|gb|ADL23946.1| ATP synthase subunit beta, AtpB_1 [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302751988|gb|ADL66165.1| ATP synthase subunit beta, AtpB_1 [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304342147|gb|EFM08047.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312437475|gb|ADQ76546.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312830459|emb|CBX35301.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315128778|gb|EFT84778.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315196959|gb|EFU27301.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140721|gb|EFW32573.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143697|gb|EFW35474.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323439344|gb|EGA97068.1| F0F1 ATP synthase subunit B [Staphylococcus aureus O11]
 gi|323442447|gb|EGB00076.1| F0F1 ATP synthase subunit B [Staphylococcus aureus O46]
 gi|329314792|gb|AEB89205.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus T0131]
 gi|329723970|gb|EGG60494.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21189]
 gi|329726377|gb|EGG62845.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21172]
 gi|329729274|gb|EGG65682.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21193]
          Length = 173

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 71/153 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++    ++ +K +     
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAGD 172


>gi|302334939|ref|YP_003800146.1| ATP synthase F0 subcomplex B subunit [Olsenella uli DSM 7084]
 gi|301318779|gb|ADK67266.1| ATP synthase F0 subcomplex B subunit [Olsenella uli DSM 7084]
          Length = 201

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 65/152 (42%), Gaps = 1/152 (0%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
             ++ ++  +++     PS +L  ++    KI+DD+  A   R ++      Y  + ++ 
Sbjct: 49  ALLAFLVIWIVLAKFAWPS-ILGMMEERQQKIQDDLEAAEESRAQAAEEAKNYTAQITEA 107

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
             E   II  A+  A     +     ++ +A  +      +   + +A   L  ++ D S
Sbjct: 108 HREAEAIISKARKDATEERTQILAKAQREAADIISKAHGAVGSERKKAMIELSGQVVDLS 167

Query: 129 VEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           VEI  +II   +++     + EK ++ + + H
Sbjct: 168 VEIAGKIIGNDLSEAEQRKLAEKYLAEVSAPH 199


>gi|313894469|ref|ZP_07828034.1| ATP synthase F0, B subunit [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313441293|gb|EFR59720.1| ATP synthase F0, B subunit [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 165

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 61/148 (41%), Gaps = 1/148 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++  I + ++        LL+ +    ++I  D+  A + R ++E     Y  + +K  +
Sbjct: 14  LNFFILVWLLARF-AYKPLLAMMTERKERIAKDLEAAEKARVEAEGFKADYAAQIAKARQ 72

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E ++I+  A   A+    E      +          Q I   +  A   L  ++   SV 
Sbjct: 73  EAQQIVEKAVQEAEHTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNEVVSLSVA 132

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +++++ MN + N+ + E  I  + S
Sbjct: 133 MAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|295400688|ref|ZP_06810665.1| ATP synthase F0, B subunit [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312112622|ref|YP_003990938.1| ATP synthase F0 subunit beta [Geobacillus sp. Y4.1MC1]
 gi|294977269|gb|EFG52870.1| ATP synthase F0, B subunit [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311217723|gb|ADP76327.1| ATP synthase F0, B subunit [Geobacillus sp. Y4.1MC1]
          Length = 172

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 64/132 (48%)

Query: 27  SILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKIL 86
             L+  +    + I ++I +A + R+++E +L + +E   +  +E +++I  A+  A+  
Sbjct: 39  GPLMGVMKQREEHIANEIDQAEKHRQEAEKLLAEQRELMKQSRQEAQQLIENARKLAEEQ 98

Query: 87  AEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNS 146
            E+   +    +    +  +++I   K +A   L  ++A  SV I  ++I +++N+   +
Sbjct: 99  KEQIIASARAEAERLKETAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELNEQDQA 158

Query: 147 SIFEKTISSIQS 158
            +  + I  +  
Sbjct: 159 KLISEYIQEVGE 170


>gi|110633055|ref|YP_673263.1| F0F1 ATP synthase subunit B' [Mesorhizobium sp. BNC1]
 gi|123058180|sp|Q11KH7|ATPF1_MESSB RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|110284039|gb|ABG62098.1| H+-transporting two-sector ATPase, B/B' subunit [Chelativorans sp.
           BNC1]
          Length = 193

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   L+  +D+I  D+ +A R++E ++  +  Y+++ +
Sbjct: 46  LWLAITFGLFYLFLKRVVLPR-IAGILEVRSDRIAQDLDQAARMKEDADAAVAAYEQELA 104

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  ++   I   A+  AK  A    + +E      LK+ E +I  +K  A   +     +
Sbjct: 105 EARKKAAAIAQEARDTAKAEAAAERRKVESGLDSKLKEAEARIALIKDTALSDVGTIAEE 164

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV+E++  K++    S+  +
Sbjct: 165 TAAAIVQELVGGKVDKASLSAAVK 188


>gi|45603|emb|CAA46896.1| ATPase b subunit [Propionigenium modestum]
 gi|45610|emb|CAA38580.1| ATPase b subunit [Propionigenium modestum]
 gi|45651|emb|CAA41370.1| F0 subunit [Propionigenium modestum]
          Length = 163

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I +           +   LDA  +KI +D+ +A   +E +     + +    
Sbjct: 11  FWQIINFLILM-FFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVK 69

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + E  E++L A+ +A    E   +         LK  E +I  MK +A++ L  ++ D
Sbjct: 70  SAKTEANEMLLRAEKKADERKETILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVTD 129

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V++  ++I++K++  + +++ ++ I  +  
Sbjct: 130 LAVKLAEKMINEKVDAKIGANLLDQFIGEVGE 161


>gi|303239769|ref|ZP_07326293.1| ATP synthase F0, B subunit [Acetivibrio cellulolyticus CD2]
 gi|302592706|gb|EFL62430.1| ATP synthase F0, B subunit [Acetivibrio cellulolyticus CD2]
          Length = 162

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 71/151 (47%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +  ++ L +++   +   +  F++  A+ I++ +  +++  E++ ++ + Y+ K
Sbjct: 8   PDFIWAIINLLVLYLILKKFLFKPITEFMENRANLIKEQLEGSQKSNEEAADLKLAYERK 67

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                 +  +II  AK  A+   +E  +  +  + +  +  E +I   + E  + +  +I
Sbjct: 68  LETAHADASKIINDAKLDAQDKYDEIIKKAKADAEVLREKAEAEIERERNEMIKAMRNEI 127

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
              ++E   +++   MN + N  + ++ ++ 
Sbjct: 128 VSLALEAASKVMEANMNTEANKKLVDEVVTK 158


>gi|223043922|ref|ZP_03613963.1| ATP synthase F0, B subunit [Staphylococcus capitis SK14]
 gi|222442637|gb|EEE48741.1| ATP synthase F0, B subunit [Staphylococcus capitis SK14]
          Length = 171

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T +  ++ +I L ++        L   +D     I  DI +A + +  ++ +  + ++ 
Sbjct: 18  TTIVTLVTFVILLALL-KKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKT 76

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + ++E + I+  AK +A+   EE        +   ++  + +I+  K  A   +  ++
Sbjct: 77  LKETQDEVQRILDDAKVQARKQHEEIIHEANVRANGMIETAQSEINSEKERALADINNQV 136

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++ SV I  +++ +++++     + EK +     
Sbjct: 137 SELSVLIASKVLRKEISEQDQKDLVEKYLKEAGD 170


>gi|171742079|ref|ZP_02917886.1| hypothetical protein BIFDEN_01184 [Bifidobacterium dentium ATCC
           27678]
 gi|283456795|ref|YP_003361359.1| ATP synthase subunit B [Bifidobacterium dentium Bd1]
 gi|306822062|ref|ZP_07455446.1| ATP synthase F0 sector subunit B [Bifidobacterium dentium ATCC
           27679]
 gi|309802600|ref|ZP_07696704.1| ATP synthase F0, B subunit [Bifidobacterium dentium JCVIHMP022]
 gi|171277693|gb|EDT45354.1| hypothetical protein BIFDEN_01184 [Bifidobacterium dentium ATCC
           27678]
 gi|283103429|gb|ADB10535.1| ATP synthase B chain [Bifidobacterium dentium Bd1]
 gi|304554662|gb|EFM42565.1| ATP synthase F0 sector subunit B [Bifidobacterium dentium ATCC
           27679]
 gi|308220664|gb|EFO76972.1| ATP synthase F0, B subunit [Bifidobacterium dentium JCVIHMP022]
          Length = 173

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 66/153 (43%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y+ + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  TARVEASKIRDDARAEASHIIADARSRAESDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            +  +  +I+  K+ NDDV SS+ ++ I+ + S
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDRMIADMDS 170


>gi|290890138|ref|ZP_06553220.1| hypothetical protein AWRIB429_0610 [Oenococcus oeni AWRIB429]
 gi|290480182|gb|EFD88824.1| hypothetical protein AWRIB429_0610 [Oenococcus oeni AWRIB429]
          Length = 176

 Score = 71.1 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V ++ I+ + I+  L     +   +DA A++I DD+  A + + +++ +         +
Sbjct: 16  FVLLTFILLMFILKKL-AWGPITKIMDARANQINDDLDSAAKSKNEAKKLQTVADTNLKE 74

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + +   ++  A+  ++  +++     +  +    +  +     +K +A      +IAD 
Sbjct: 75  SQSQATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDEIADL 134

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           SV I   II +++    + ++ +  IS ++   +
Sbjct: 135 SVSIASRIIGKEITASKHKALIDDFISELEKQQE 168


>gi|70725929|ref|YP_252843.1| F0F1 ATP synthase subunit B [Staphylococcus haemolyticus JCSC1435]
 gi|88909587|sp|Q4L7Y8|ATPF_STAHJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68446653|dbj|BAE04237.1| ATP synthase B chain [Staphylococcus haemolyticus JCSC1435]
          Length = 176

 Score = 71.1 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 66/153 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +     L+ ++       L   +D     I  DI EA   +  ++ +  + K+  
Sbjct: 23  TVIVTVITFAILLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E + I+  A+ +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 83  KQTQDEVQRILEDARVQARKQHEEIIHEANIRANGMIETAQSEINSEKERALADINNQVS 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++     + +K +     
Sbjct: 143 ELSVLIASKVLKKEISEQDQKELVDKYLKEAGD 175


>gi|42518861|ref|NP_964791.1| F0F1 ATP synthase subunit B [Lactobacillus johnsonii NCC 533]
 gi|227889719|ref|ZP_04007524.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus johnsonii
           ATCC 33200]
 gi|268319743|ref|YP_003293399.1| ATP synthase F0, B subunit [Lactobacillus johnsonii FI9785]
 gi|81703851|sp|Q74K19|ATPF_LACJO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|41583147|gb|AAS08757.1| ATP synthase B chain [Lactobacillus johnsonii NCC 533]
 gi|227849583|gb|EEJ59669.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus johnsonii
           ATCC 33200]
 gi|262398118|emb|CAX67132.1| ATP synthase F0, B subunit [Lactobacillus johnsonii FI9785]
 gi|329667592|gb|AEB93540.1| ATP synthase B chain [Lactobacillus johnsonii DPC 6026]
          Length = 166

 Score = 71.1 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 56/138 (40%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK 80
           V       +   ++    K+  D+ +A   R+K+E +  Q +      ++E  +I+  AK
Sbjct: 29  VKHFAWGPVTKMMEERRQKVISDLDQAESDRKKAELLANQREAALKDSKQEATQILSTAK 88

Query: 81  HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM 140
             A+          +Q +A   K   +     K +A      ++AD SV I  ++IS+ +
Sbjct: 89  SNAEKTKNNIISQADQEAAAIRKRASEDAAQAKTDALNEARDQVADISVAIAEKVISKNL 148

Query: 141 NDDVNSSIFEKTISSIQS 158
           +      + ++ I  +  
Sbjct: 149 SAADQKDLVDQFIKGLND 166


>gi|288957579|ref|YP_003447920.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
 gi|288909887|dbj|BAI71376.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
          Length = 216

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 58/149 (38%), Gaps = 1/149 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++  +   ++    +P  +   L+A  ++I  D+ +A +L+E++E IL Q ++  +
Sbjct: 66  FWLALTFGVLYHLMSKKALPR-VAEVLEARQERISRDLAKAAQLKEEAEAILAQVEKSLA 124

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + +I       +   +     +    A  L+  E  I   K +A   + A+   
Sbjct: 125 GARAEAQGVIAQVSAEIEANNQARQGQLNADIAERLRSAEASIATAKDQALANIRAESTG 184

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
              +I   +    ++     +     +  
Sbjct: 185 IVRDIAGRLAGVDVDPAQADAAVAAVLEE 213


>gi|256372562|ref|YP_003110386.1| ATP synthase F0, B subunit [Acidimicrobium ferrooxidans DSM 10331]
 gi|256009146|gb|ACU54713.1| ATP synthase F0, B subunit [Acidimicrobium ferrooxidans DSM 10331]
          Length = 173

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +S +I LV++  +  P  +   +   +D+IR D+  A   R ++E +  + + +   
Sbjct: 22  WSVISFVILLVVLAKVAYPP-VARMMAQRSDRIRADLEAADAARREAEALRAERERELQG 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             E+ R I+  A+  A+ L +E  +     +      +E ++   +++  R L +++AD 
Sbjct: 81  AREDARRILDDARRTAEALRQEASERARAEAEAIRAQVEAQLAAERVQLLRSLRSEVADL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +VE+  +I+++++       + E  +   +  
Sbjct: 141 AVELAGKIVARELEQSSFDPLIEAFLREAEPA 172


>gi|220919572|ref|YP_002494876.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957426|gb|ACL67810.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 179

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ L ++        ++  L      IR+ I  A++ R ++E +L   KE  
Sbjct: 24  TLWTAITFLVMLAVLAKF-AWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +K + E  E+    +   ++L +E      + +   + +  ++I    ++AK  L A++ 
Sbjct: 83  AKAQREAAELARRNQQEVEVLRQELTAKARKEADDLVAEARRQIAEELVKAKAELKAQVV 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +++    ++   +++    ++ E+ I+ + +
Sbjct: 143 DLAIDAASRLVKANLDEKAQRALVEEYIAQLPA 175


>gi|224283627|ref|ZP_03646949.1| F0F1 ATP synthase subunit B [Bifidobacterium bifidum NCIMB 41171]
 gi|310288112|ref|YP_003939371.1| ATP synthase B chain [Bifidobacterium bifidum S17]
 gi|313140778|ref|ZP_07802971.1| F0F1 ATP synthase subunit B [Bifidobacterium bifidum NCIMB 41171]
 gi|309252049|gb|ADO53797.1| ATP synthase B chain [Bifidobacterium bifidum S17]
 gi|313133288|gb|EFR50905.1| F0F1 ATP synthase subunit B [Bifidobacterium bifidum NCIMB 41171]
          Length = 176

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  +      +P    +  D  A KI  +I +A + ++ ++    +Y+ + S 
Sbjct: 22  WSLIILVIVALFFHKFFMP-KFNAIFDERAAKIEGNIAKAEQSKKDADAAKSKYEAQLST 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+  A  +  +     E  +A    + ++ I   + +A   L  ++   
Sbjct: 81  ARVEASKIRDDARAEASHIIADARSRAESDAAQITANAQRSIESQQQQALVSLKGEVGTL 140

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+  K+ +DDV SS+ +K I  + +
Sbjct: 141 ATALAGKILGAKLESDDVQSSMIDKMIDDLDT 172


>gi|311033326|ref|ZP_07711416.1| F0F1 ATP synthase subunit B [Bacillus sp. m3-13]
          Length = 172

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/145 (15%), Positives = 63/145 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L+  +       L+  +    D I ++I  A +   +++ ++ + K    +   E +
Sbjct: 26  FLILLYFLRKFAWDKLVGMMKQREDHIANEITAAEQSNVEAKALVEEQKSLLKEARTEAQ 85

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            ++ +AK  A+    +  +  ++ SA   +   ++I   K +A   L  ++A  SV I  
Sbjct: 86  ALVESAKKVAEDQKADIVRAAQEESARLKEAARKEIIQEKEQAVVALREQVASLSVLIAS 145

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I +++N+     + +  +  +  
Sbjct: 146 KVIEKELNEKDQQKLIDDYVKQVGE 170


>gi|319650871|ref|ZP_08005008.1| ATP synthase subunit B [Bacillus sp. 2_A_57_CT2]
 gi|317397469|gb|EFV78170.1| ATP synthase subunit B [Bacillus sp. 2_A_57_CT2]
          Length = 173

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/143 (16%), Positives = 58/143 (40%)

Query: 13  LIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
           + I L+ ++       L+  +    + I  +I  A   R +++ +L + +    +   E 
Sbjct: 26  MFIILLALLKKFAWGPLMGIMQQREEHIASEIQAAEESRTEAKKLLEEQRNLLKEARTEA 85

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
           + +I  AK +  +  EE        S    +  + +I   K +A   +  ++A  SV I 
Sbjct: 86  QGLIENAKKQGDVQREEIIAAARTESERIKESAKLEIEQQKEQAVAAIREQVASLSVLIA 145

Query: 133 REIISQKMNDDVNSSIFEKTISS 155
            ++I ++++      +  + I  
Sbjct: 146 SKVIEKELSAADQEKLINEYIQE 168


>gi|313891429|ref|ZP_07825045.1| putative ATP synthase F0, B subunit [Dialister microaerophilus UPII
           345-E]
 gi|329121457|ref|ZP_08250081.1| F-type two-sector ATPase, F(1) beta subunit [Dialister
           micraerophilus DSM 19965]
 gi|313120204|gb|EFR43380.1| putative ATP synthase F0, B subunit [Dialister microaerophilus UPII
           345-E]
 gi|327469372|gb|EGF14842.1| F-type two-sector ATPase, F(1) beta subunit [Dialister
           micraerophilus DSM 19965]
          Length = 164

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 73/152 (48%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  ++ II + I+ +      +L  LDA   +I++D+  A   +  +  +   Y+E+  
Sbjct: 9   LIQILNFIILVAILGHF-AYKPMLKVLDARKQRIQNDLDSAAASKADAAKLKDSYEEQLR 67

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + + +EI+  A   AK+ AEE  +          ++  ++I   + +A   L A++A 
Sbjct: 68  NAQAKAQEIVTQAVKEAKVKAEEQIEAAHIAIEQEKENATKQIERERKDALDDLKAQVAV 127

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            S +I  +IIS+ M  + N  I E +I+ + +
Sbjct: 128 LSCDIAAKIISKNMTPEENGRIIEDSITKLGA 159


>gi|87311754|ref|ZP_01093869.1| probable protein ATP synthase B chain [Blastopirellula marina DSM
           3645]
 gi|87285538|gb|EAQ77457.1| probable protein ATP synthase B chain [Blastopirellula marina DSM
           3645]
          Length = 245

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 67/150 (44%), Gaps = 2/150 (1%)

Query: 13  LIIFLVI--VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
            +IFL +  ++ +     +++ LD+    +   + EA+++   +E  L +Y +K +  ++
Sbjct: 96  FLIFLGLAALLTIFAWKPIVAALDSREAAMDGKLAEAQKMFAAAEARLAEYNQKLADAQQ 155

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E ++        A+    +   + +       K  +Q+I   K  A   L  +  + +++
Sbjct: 156 EIQKSREQIMKEAEEKRLQILADAQAAGNAERKRAQQEIEAAKTAAISDLTKQSVNLAID 215

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +  +I  Q++  + +  +   T++ + S +
Sbjct: 216 LASKITRQQLTPEDHQHLINDTLAQLPSQN 245


>gi|146318830|ref|YP_001198542.1| F0F1-type ATP synthase subunit B [Streptococcus suis 05ZYH33]
 gi|146321039|ref|YP_001200750.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223932792|ref|ZP_03624789.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|253751916|ref|YP_003025057.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|253753739|ref|YP_003026880.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|253755383|ref|YP_003028523.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|330832981|ref|YP_004401806.1| F0F1-type ATP synthase subunit b [Streptococcus suis ST3]
 gi|226696181|sp|A4W1W1|ATPF_STRS2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696183|sp|A4VVK3|ATPF_STRSY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145689636|gb|ABP90142.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 05ZYH33]
 gi|145691845|gb|ABP92350.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223898501|gb|EEF64865.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|251816205|emb|CAZ51832.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|251817847|emb|CAZ55600.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|251819985|emb|CAR46135.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|292558491|gb|ADE31492.1| ATP synthase F0, subunit B [Streptococcus suis GZ1]
 gi|319758277|gb|ADV70219.1| F0F1-type ATP synthase, subunit b [Streptococcus suis JS14]
 gi|329307204|gb|AEB81620.1| F0F1-type ATP synthase, subunit b [Streptococcus suis ST3]
          Length = 168

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 74/153 (48%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++  +    L+I++ +     +    +  A+KI +DI  A      + N++ Q +++ 
Sbjct: 15  NFILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANLVQQREDEL 74

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +   E+++II  A  RAK+  +   +  +       +  + +I   K EA+  L  ++A
Sbjct: 75  VQGRIESQKIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQENLRVQVA 134

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + +V++  +II + ++   +S++ ++ +  +  
Sbjct: 135 ELAVDLASKIILEDLDQQAHSNLIDRYLDKLGD 167


>gi|212715315|ref|ZP_03323443.1| hypothetical protein BIFCAT_00208 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661772|gb|EEB22347.1| hypothetical protein BIFCAT_00208 [Bifidobacterium catenulatum DSM
           16992]
          Length = 173

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y+ + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K   +  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  KARVDASKIRDDARTEASHIIADARTRAESDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            +  +  +I+  K+ NDDV SS+ ++ I+ + S
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDQMIADMDS 170


>gi|29346126|ref|NP_809629.1| ATP synthase subunit B [Bacteroides thetaiotaomicron VPI-5482]
 gi|253568450|ref|ZP_04845861.1| ATP synthase B subunit [Bacteroides sp. 1_1_6]
 gi|298385491|ref|ZP_06995049.1| ATP synthase F0, B subunit [Bacteroides sp. 1_1_14]
 gi|81740940|sp|Q8A9U9|ATPF_BACTN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29338020|gb|AAO75823.1| ATP synthase B subunit [Bacteroides thetaiotaomicron VPI-5482]
 gi|251842523|gb|EES70603.1| ATP synthase B subunit [Bacteroides sp. 1_1_6]
 gi|298261632|gb|EFI04498.1| ATP synthase F0, B subunit [Bacteroides sp. 1_1_14]
          Length = 167

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F++  +  VI+     P I++  ++     I   +  AR    +  ++  + +   +
Sbjct: 12  FWMFVAFGVVFVILAKYGFP-IIIKMVEGRKTYIDQSLEVAREANAQLAHLKEEGEALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILKEAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV+I  +++ + + + +    + ++ +  + + ++
Sbjct: 131 LSVDIAEKVLRKNLQDKESQMGMIDRMLDEVLTPNK 166


>gi|302023930|ref|ZP_07249141.1| F0F1 ATP synthase subunit B [Streptococcus suis 05HAS68]
          Length = 168

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 73/153 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F++  +    L+I++ +     +    +  A+KI +DI  A      + N++ Q +++ 
Sbjct: 15  NFILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANLVQQREDEL 74

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +   E+ +II  A  RAK+  +   +  +       +  + +I   K EA+  L  ++A
Sbjct: 75  VQGRIESPQIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQENLRVQVA 134

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + +V++  +II + ++   +S++ ++ +  +  
Sbjct: 135 ELAVDLASKIILEDLDQQAHSNLIDRYLDKLGD 167


>gi|293627820|gb|ADE58441.1| ATP synthase beta-chain [Bartonella quintana]
          Length = 148

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 72/146 (49%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   +F + +  + +P  +   ++   D+I  D+ +A R++++++ ++  Y+ K +
Sbjct: 2   FWLAIFFGLFYLFISRVIVPR-IGDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLA 60

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA    K   E   + IE      LKD E++I  ++ +A + + +   +
Sbjct: 61  QARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQIAKIRDKAMQNVGSIAEE 120

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            ++EIV+++I   ++ +   S  +  
Sbjct: 121 AALEIVKKMIDVDVSRESVRSAVKAA 146


>gi|126653445|ref|ZP_01725541.1| AtpF [Bacillus sp. B14905]
 gi|126589801|gb|EAZ83934.1| AtpF [Bacillus sp. B14905]
          Length = 173

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 65/152 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  + + + L+ ++       L+  +    + +  +I  A + R+ S   L + K    +
Sbjct: 21  IATLVIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKDSHQFLEEQKSLLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E + I+  AK + ++  +E        +    +   ++I   K +A   +  ++   
Sbjct: 81  ARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVRDEVVSL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           SV    +++S+++++  N ++ E+TI+     
Sbjct: 141 SVLAASKVLSKEISEADNRALIEETIAKAGEA 172


>gi|325684410|gb|EGD26578.1| ATP synthase F0 sector subunit B [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 168

 Score = 70.7 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 63/154 (40%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    +   I L + V       +   ++    K+ DD+ +A   R+K+E +  + +  
Sbjct: 16  NTLWYLIVFSILL-LAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAEILANEREAA 74

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                +E  +I+  AK  A+ + ++     +  ++   +  +      K +A      ++
Sbjct: 75  LKNSRQEATQILSVAKSNAQKIGKQIVSEAKAEASAIRERAKADAAQAKTDALNEARNEV 134

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD SV I  ++I++ ++      + ++ I  +  
Sbjct: 135 ADLSVTIAEKVIAKNLSAADQKDLVDQFIKGLND 168


>gi|311064985|ref|YP_003971711.1| ATP synthasesubunit B [Bifidobacterium bifidum PRL2010]
 gi|310867305|gb|ADP36674.1| AtpF ATP synthase B chain [Bifidobacterium bifidum PRL2010]
          Length = 175

 Score = 70.7 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  +      +P    +  D  A KI  +I +A + ++ ++    +Y+ + S 
Sbjct: 21  WSLIILVIVALFFHKFFMP-KFNAIFDERAAKIEGNIAKAEQSKKDADAAKSKYEAQLST 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+  A  +  +     E  +A    + ++ I   + +A   L  ++   
Sbjct: 80  ARVEASKIRDDARAEASHIIADARSRAESDAAQITANAQRSIESQQQQALVSLKGEVGTL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+  K+ +DDV SS+ +K I  + +
Sbjct: 140 ATALAGKILGAKLESDDVQSSMIDKMIDDLDT 171


>gi|260584612|ref|ZP_05852358.1| ATP synthase F0, B subunit [Granulicatella elegans ATCC 700633]
 gi|260157635|gb|EEW92705.1| ATP synthase F0, B subunit [Granulicatella elegans ATCC 700633]
          Length = 166

 Score = 70.7 bits (172), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/137 (21%), Positives = 64/137 (46%)

Query: 22  YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH 81
                  +   L+A   KI  D+ EA + R+ +E I    KE     E + +EI+ + + 
Sbjct: 30  KFFAWDKIEEMLEARRQKISKDLEEAEKKRKAAEEIQANAKEIIHNAEVKGQEILNSTRE 89

Query: 82  RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN 141
            A  + +E  +    + +    D ++++  MK  A   +  +I D SV++  +I+++++ 
Sbjct: 90  AASKMQDEMIKEGRDVVSRMKLDGQREVDSMKQRALAQMQDQIVDLSVQLASQILNKELT 149

Query: 142 DDVNSSIFEKTISSIQS 158
           +  +  + E  I  ++S
Sbjct: 150 EQTHQDVIESFIEGLES 166


>gi|104773791|ref|YP_618771.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513797|ref|YP_812703.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122275433|sp|Q04BA7|ATPF_LACDB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122397274|sp|Q1GAW9|ATPF_LACDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|103422872|emb|CAI97534.1| H+ transporting ATPase / ATP synthase, B subunit [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116093112|gb|ABJ58265.1| ATP synthase F0 subcomplex B subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|325125455|gb|ADY84785.1| H+-transporting ATP synthase chain B [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
          Length = 168

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 61/154 (39%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    +   I L + V       +   ++    K+ DD+ +A   R+K+E +  + +  
Sbjct: 16  NTLWYLIVFSILL-LAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAETLANEREAA 74

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                +E  +I+  AK  A+   ++        ++   +  +      + +A      ++
Sbjct: 75  LKNSRQEATQILSDAKSNAQKTGKQIVSEAMAEASAIREKAKADAAQAETDALNEAREEV 134

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD SV I  ++I++ ++      + ++ I  +  
Sbjct: 135 ADLSVTIAEKVIAKNLSAADQKDLVDQFIKGLND 168


>gi|251771548|gb|EES52125.1| ATP synthase F0, B subunit [Leptospirillum ferrodiazotrophum]
          Length = 168

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 36/152 (23%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +S  + L IV     PS++   LD    K+  D+  AR+ RE++E +L +  E   
Sbjct: 14  FWSLVSFALMLFIVGKYLYPSLI-RILDERRTKVSSDMEAARKSREEAEKLLAEQHELLE 72

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K   +   +I  A+  A+ L EE  + I Q     L     +I   + + K  L  +   
Sbjct: 73  KARAQAENMIRQAEEMARTLREEREKEIAQSVKAELDKAAAQIAADREKMKSELRTETVT 132

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             V  +  I+ + + D        K + +I  
Sbjct: 133 LVVRSLETILEETLTDTQKVVYINKAMKAIDE 164


>gi|189465905|ref|ZP_03014690.1| hypothetical protein BACINT_02268 [Bacteroides intestinalis DSM
           17393]
 gi|224539740|ref|ZP_03680279.1| hypothetical protein BACCELL_04649 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189434169|gb|EDV03154.1| hypothetical protein BACINT_02268 [Bacteroides intestinalis DSM
           17393]
 gi|224518640|gb|EEF87745.1| hypothetical protein BACCELL_04649 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 168

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  A+    + + +  + +   +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEGRRTYIDQSLEVAKEANAQLQRLKAESEALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  +  E  +   L D++++I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMHERDKIIVEARKQAEVAAQKELDDVKKQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQ 161
            SV+I  ++I + ++++     + ++ +  + +  +
Sbjct: 131 LSVDIAEKVIRKNLDEEHEQMEMIDRMLDEVLAASR 166


>gi|17987827|ref|NP_540461.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. 16M]
 gi|17983555|gb|AAL52725.1| ATP synthase b' chain [Brucella melitensis bv. 1 str. 16M]
          Length = 180

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 67/144 (46%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 31  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 89

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 90  QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 149

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
               IV +++    +    S   +
Sbjct: 150 TMATIVEQLLGLTADKASVSEAVK 173


>gi|225851924|ref|YP_002732157.1| F0F1 ATP synthase subunit B' [Brucella melitensis ATCC 23457]
 gi|256044106|ref|ZP_05447017.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112904|ref|ZP_05453820.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 3 str. Ether]
 gi|256264564|ref|ZP_05467096.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|260563465|ref|ZP_05833951.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|265990518|ref|ZP_06103075.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994346|ref|ZP_06106903.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|226741364|sp|Q8YFH7|ATPF_BRUME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|2984782|gb|AAC08030.1| ATP synthase subunit B' [Brucella melitensis]
 gi|225640289|gb|ACO00203.1| ATP synthase B' chain [Brucella melitensis ATCC 23457]
 gi|260153481|gb|EEW88573.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|262765459|gb|EEZ11248.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001302|gb|EEZ13877.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094929|gb|EEZ18637.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|326408423|gb|ADZ65488.1| F0F1 ATP synthase subunit B' [Brucella melitensis M28]
 gi|326538137|gb|ADZ86352.1| ATP synthase B' chain [Brucella melitensis M5-90]
          Length = 208

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 67/144 (46%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
               IV +++    +    S   +
Sbjct: 178 TMATIVEQLLGLTADKASVSEAVK 201


>gi|160881858|ref|YP_001560826.1| ATP synthase F0, B subunit [Clostridium phytofermentans ISDg]
 gi|160430524|gb|ABX44087.1| ATP synthase F0, B subunit [Clostridium phytofermentans ISDg]
          Length = 194

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 17/151 (11%), Positives = 69/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++ +++ +  +I+ YL + +     L    D+I++++  + + ++++  +   Y+ K  +
Sbjct: 40  IMGLAIFVLFLILSYL-LFNPARELLQKRQDRIKEEMDSSAKDKKEATQLKTNYEAKIKE 98

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  EI+   + +A     +     +  ++  +    ++I   K + K  +  ++   
Sbjct: 99  ASKEVDEILSEGRKKALKRENDIVDEAKVEASRIVDRANKEIELNKSKMKDEVKQEMIAV 158

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +  +II+  +++     + ++ ++ +  
Sbjct: 159 ASVMAGKIIAGNIDETKQKQLIDEALNEMGD 189


>gi|46579192|ref|YP_010000.1| ATP synthase F0 subunit B [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|81699142|sp|Q72E00|ATPF_DESVH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46448605|gb|AAS95259.1| ATP synthase F0, B subunit, putative [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 176

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++ +IF  I ++      ++ F       I  ++ +    + +++  L + + + + +E 
Sbjct: 29  VNFVIFAGI-IWKAAGKKIVGFFTGRRQGIEQELNDLETRKTEAKKQLAEVERRIANLES 87

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E + I+   + + + +        E+ ++L  +  ++        A   + A++AD  + 
Sbjct: 88  ERQAILADYRAQGENIKAAIIDKAEKSASLITEQAKRTADNEIKAAIDAMRAQMADEIIV 147

Query: 131 IVREIISQKMNDDVNSSIFEKTISSI 156
              +++++K+  + +  + +K ++ +
Sbjct: 148 AAEKLLAEKLTANEHEKLIDKYLTKV 173


>gi|281423285|ref|ZP_06254198.1| ATP synthase F0, B subunit [Prevotella oris F0302]
 gi|299140475|ref|ZP_07033613.1| ATP synthase F0, B subunit [Prevotella oris C735]
 gi|281402621|gb|EFB33452.1| ATP synthase F0, B subunit [Prevotella oris F0302]
 gi|298577441|gb|EFI49309.1| ATP synthase F0, B subunit [Prevotella oris C735]
          Length = 172

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 70/158 (44%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++  + +     P +++  +D     I + + +A    E+  NI  + +    
Sbjct: 16  FWMLLAFLVVFICLARFGFP-VIIKMVDERKQYIDESLNKAHEASERLANIKQEGETLLQ 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E+      + S   + + +++I   K  A R + +++A+
Sbjct: 75  EAREQQAKIMKEAATTRDAIIEQAQDKAREESTRIISEAKKQIEVEKQSAIRDIRSQVAE 134

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            S+++  +I+ +K+ ND     + ++ +  +      D
Sbjct: 135 LSIQVAEKILREKLSNDKAQMDMIDRLLDEVSEKENKD 172


>gi|94501606|ref|ZP_01308123.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65]
 gi|94426289|gb|EAT11280.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65]
          Length = 156

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +    F V   +  +   L++ +   A KI D +  A R     +    +
Sbjct: 1   MNINLTLIGQIIAFAFFVAFCWKFVWPPLMNAMQERAKKIADGLDAANRADRDLKLAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  + +E+  +II  A  RA  + +E      Q         + +I      AK  L
Sbjct: 61  AGSQLREAKEQAAQIIEQANKRANQIIDEAKDAAHQEGERLKAAAQAEIDQEVNRAKETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +++++ +V    +I+   ++ + ++++ +K    +
Sbjct: 121 RSQVSELAVAGASKILETSIDVEKHNALLDKLAEEL 156


>gi|317060279|ref|ZP_07924764.1| ATP synthase subunit B, sodium ion specific [Fusobacterium sp. D12]
 gi|313685955|gb|EFS22790.1| ATP synthase subunit B, sodium ion specific [Fusobacterium sp. D12]
          Length = 163

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 70/153 (45%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y +IP  +   L     KI  ++  A   +E+++    Q +   
Sbjct: 11  FWQIINFFILVFVFNKYCKIP--IQRILTERKKKITSELRSASLSKEEAKISARQAETAL 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E  EI+  A++RA+ +  E   +        L++  +++  +K  A++ L+ ++ 
Sbjct: 69  KEARDEAYEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKSRARQELHQEVT 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +VE+  +++ + +++   + + +  I  +  
Sbjct: 129 SLAVELAEKLMRKNIDEQTATDLIDDFIERVGD 161


>gi|315608097|ref|ZP_07883090.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
 gi|315250566|gb|EFU30562.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
          Length = 172

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 73/158 (46%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++   ++     P+I+ + ++     I + + +A    E+ ENI  + +    
Sbjct: 16  FWMLLAFLVVFGVLAKFGFPAII-NMVEERKKYIDESLRKAHEASERLENIKQEGESMLK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E   +   + SA  L D +++I   K  A R +  ++A+
Sbjct: 75  EAREKQAQIMKEAAGTRDAIVENAQEKAREESARLLSDAKRQIESEKQNAIRDIRMQVAE 134

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV+I  +I+ +K+ +DD    + ++ +  +      D
Sbjct: 135 LSVQIAEKILREKLSSDDKQMDMVDRLLDEVSVKKNKD 172


>gi|147679151|ref|YP_001213366.1| F0F1-type ATP synthase, subunit b [Pelotomaculum thermopropionicum
           SI]
 gi|226694344|sp|A5CYE6|ATPF_PELTS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146275248|dbj|BAF60997.1| F0F1-type ATP synthase, subunit b [Pelotomaculum thermopropionicum
           SI]
          Length = 162

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/159 (20%), Positives = 69/159 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           + F+ T L  +   I L+I + L     L+  L   ++ I  +I  A + R+++E +   
Sbjct: 2   LEFNATLLAQIVDFIILLIFLRLVAYKPLMKLLSERSEHIERNIAAAEKERQQAEQLRAS 61

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ +  +  E+ +EII  A    +  A +  +N +  +    +    +I   K +A   L
Sbjct: 62  YEAEMRRAREQAQEIIQKATKAGEEQALQIIENAKNETVRMKETALAEIEREKQKAMAEL 121

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             ++   S+ +  +II++ M+ ++   I    I      
Sbjct: 122 RDQVVTLSILVAGKIINRSMSSEIQHEIVRDFIKEAGEL 160


>gi|167747408|ref|ZP_02419535.1| hypothetical protein ANACAC_02128 [Anaerostipes caccae DSM 14662]
 gi|167652770|gb|EDR96899.1| hypothetical protein ANACAC_02128 [Anaerostipes caccae DSM 14662]
          Length = 171

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 70/149 (46%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +++ I    + Y+ +   +   L+   +KI DD+  A   +E++  +  +Y+EK   +E
Sbjct: 19  AVAVFIMFAFLSYV-LFEPVRKLLNDRKNKIADDLDTAAADKEEAARLKAEYEEKIRDIE 77

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E  EI+  A+ +A    +E      Q +    +  E +I   K + +  +  ++   +V
Sbjct: 78  KEADEILSQARKKALKREDEIISEARQEALKITERAENEIALEKKKVRDQVKQEMIQVAV 137

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +II+ K++     ++ E+T+  +  
Sbjct: 138 AMAGKIITDKIDPAKQDALVEETLKEMGD 166


>gi|291456003|ref|ZP_06595393.1| ATP synthase F0, B subunit [Bifidobacterium breve DSM 20213]
 gi|291382412|gb|EFE89930.1| ATP synthase F0, B subunit [Bifidobacterium breve DSM 20213]
          Length = 172

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 64/152 (42%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  V      +P    +  D  A KI  +I +A + ++ ++    +Y+ + S 
Sbjct: 20  WSLIILVIVAVFFYKFFMP-KFNAIFDERAAKIEGNIAKAEQAKKDADEAKAKYEAQLST 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++   
Sbjct: 79  ARVDAAKIRDDARAEASHIISDARSRAESDAAQITASAQRSIESQQQQAIVSLKGEVGAL 138

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+  K+ ++DV SS+ +  I  + +
Sbjct: 139 ATALAGKILGAKLEDNDVQSSMIDSMIDDLDA 170


>gi|315641270|ref|ZP_07896347.1| ATP synthase F0 sector subunit B [Enterococcus italicus DSM 15952]
 gi|315483037|gb|EFU73556.1| ATP synthase F0 sector subunit B [Enterococcus italicus DSM 15952]
          Length = 173

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 58/135 (42%)

Query: 24  RIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRA 83
                +   L    +KI +DI  A + R K+  +  + +++      E   II  AK   
Sbjct: 36  FAWGSISEMLKKREEKIANDIDSAEQSRIKAAALEKERQDQLMNSRSEAASIIQNAKDIG 95

Query: 84  KILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDD 143
           ++  +    + ++ ++      +  I   K  A   +  ++A  S++I  +I+ ++++ +
Sbjct: 96  EVTRQAIVTDAKEEASRLKAKAKSDISIEKDAAFLEVKNEVASLSLQIAEKILGKELSPE 155

Query: 144 VNSSIFEKTISSIQS 158
            + S+  + I  + S
Sbjct: 156 AHESLINEYIEGLGS 170


>gi|312898817|ref|ZP_07758205.1| ATP synthase F0, B subunit [Megasphaera micronuciformis F0359]
 gi|310619979|gb|EFQ03551.1| ATP synthase F0, B subunit [Megasphaera micronuciformis F0359]
          Length = 164

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 68/149 (45%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
           F++  + + I+        +L  L+   +KI  D+ +A + R  +E +   Y+++    +
Sbjct: 12  FLNFFVLVAILAKF-AYKPMLKVLEERRNKISSDLNDAEQSRLAAEKLKADYEQQLQTAQ 70

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           E+ + II  A  +A+   +     I    A   +    +I   +  A R +  ++   S+
Sbjct: 71  EKAQAIIDKAVKQAEAEGQAQLDAIRTQIAREKELAHAEIVSEREAALREMRQEVVSLSM 130

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +++ + M+ D+NS + ++ +  + +
Sbjct: 131 AVAEKLLEKNMDTDMNSKLIKECMDRMDA 159


>gi|117926950|ref|YP_867567.1| ATP synthase F0 subunit beta [Magnetococcus sp. MC-1]
 gi|226741506|sp|A0LDW8|ATPF_MAGSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117610706|gb|ABK46161.1| ATP synthase F0 subcomplex B subunit [Magnetococcus sp. MC-1]
          Length = 189

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +S +  L+++    +P+ +   L+A A +I +++  A   R+++  +L+  + +  
Sbjct: 33  FWTVISFVALLLLLKKFVVPA-ISDVLEARASRIEEELKAAENERKEAAALLVDQRAEVK 91

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              E+  +++ +A+  A  L E+    +E   A       Q I   + +A   +   + +
Sbjct: 92  AEREKIAQLLESARKEADALREQEKAELEAELAKLKSQATQDIEQARRQAMSEVRGVVVE 151

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++ +  ++I++ ++    + + ++ I  +++
Sbjct: 152 VALAVTEKLITKSIDKAEANKLADEAIRHLEA 183


>gi|121281905|gb|ABM53536.1| putative ATP synthase B chain [uncultured bacterium CBNPD1 BAC
           clone 543]
          Length = 245

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 49/127 (38%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F+  M +   +   +   +   +L  LD    KI  +I  A   R  +     ++++K 
Sbjct: 119 PFITTMVVFGTVAAALGFFVWPKILKGLDDRNAKILGEIAAAEAARTAAAAKQKEFEQKL 178

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  EE+  +I  AK  A  + EE     E   A   +  + +I   +  A   L +  A
Sbjct: 179 QEAMEESSRMIREAKAEAVRMGEELRVRSEAELAERARRAQDEIESARRTAVAELESHAA 238

Query: 126 DFSVEIV 132
             +V I 
Sbjct: 239 TLAVSIA 245


>gi|229175983|ref|ZP_04303479.1| ATP synthase B chain [Bacillus cereus MM3]
 gi|228607476|gb|EEK64802.1| ATP synthase B chain [Bacillus cereus MM3]
          Length = 168

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|320102106|ref|YP_004177697.1| ATP synthase F0 subunit B [Isosphaera pallida ATCC 43644]
 gi|319749388|gb|ADV61148.1| ATP synthase F0, B subunit [Isosphaera pallida ATCC 43644]
          Length = 208

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 76/164 (46%), Gaps = 2/164 (1%)

Query: 8   LVFMSLIIFLVIV--VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           LV  SLI+FL+++  ++    + ++  LDA    +     EA   R ++  +  +Y+ K 
Sbjct: 43  LVAYSLIVFLILLAILWKYAWTPIVQALDAREASLNQIRQEAEAARSETLRLQTEYETKL 102

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   EE + +I  A+  A+    E  +   + +A      EQ I   K EA + L+ +  
Sbjct: 103 AAAAEEVKALIEEARRDAQATKAEILRAANEEAAAIKARAEQAIKLAKDEALKELWDRAT 162

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTET 169
           + SV +   ++ ++++ D    + E+ I  ++        ++ET
Sbjct: 163 ELSVVVAGRLLPRELSHDDQRRLTEQAIHELEMLKTSSGVSSET 206


>gi|288925058|ref|ZP_06418994.1| ATP synthase F0, B subunit [Prevotella buccae D17]
 gi|288338248|gb|EFC76598.1| ATP synthase F0, B subunit [Prevotella buccae D17]
          Length = 169

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 73/158 (46%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++   ++     P+I+ + ++     I + + +A    E+ ENI  + +    
Sbjct: 13  FWMLLAFLVVFGVLAKFGFPAII-NMVEERKKYIDESLRKAHEASERLENIKQEGESMLK 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E   +   + SA  L D +++I   K  A R +  ++A+
Sbjct: 72  EAREKQAQIMKEAAGTRDAIVENAQEKAREESARLLSDAKRQIESEKQNAIRDIRMQVAE 131

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV+I  +I+ +K+ +DD    + ++ +  +      D
Sbjct: 132 LSVQIAEKILREKLSSDDKQMDMVDRLLDEVSVKKNKD 169


>gi|291540374|emb|CBL13485.1| ATP synthase F0 subcomplex B subunit [Roseburia intestinalis XB6B4]
          Length = 171

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLR-IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +V M+L +F + +   + +       L+   ++I  DI  A   ++ +  +  +Y  K  
Sbjct: 15  VVLMALAVFFLFLFMSKMLFEPARKLLNDRKNRIAADIKTAETDKQDAAALKAEYDAKLK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V++E  +I+  A+  A+  A     + ++ +A  +K   ++    K  A   +  ++  
Sbjct: 75  EVDKEAEQILSEARKTAQKNAARIESDAKEEAARIIKRANEEAELSKKRAMDEVKQEMVT 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +  +  ++++  ++  V  ++ E+T+  +   
Sbjct: 135 VASMMAAKVVAANIDATVQDTLVEETLKEMGDS 167


>gi|228474878|ref|ZP_04059607.1| ATP synthase F0, B subunit [Staphylococcus hominis SK119]
 gi|314935944|ref|ZP_07843294.1| ATP synthase F0, B subunit [Staphylococcus hominis subsp. hominis
           C80]
 gi|228271110|gb|EEK12490.1| ATP synthase F0, B subunit [Staphylococcus hominis SK119]
 gi|313655950|gb|EFS19692.1| ATP synthase F0, B subunit [Staphylococcus hominis subsp. hominis
           C80]
          Length = 176

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/142 (15%), Positives = 63/142 (44%)

Query: 17  LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREII 76
           L+ ++       L   +D     I  DI EA   +  ++ +  + K+   + ++E   I+
Sbjct: 34  LLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTLKETQDEVHHIL 93

Query: 77  LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREII 136
             A+ +A+   EE  ++  + +   ++  + +I   K  A   +  ++++ SV I  +++
Sbjct: 94  EDARIQARKQHEEIIKDAHERANGMIETAQSEIKSEKERALADINNQVSELSVLIASKVL 153

Query: 137 SQKMNDDVNSSIFEKTISSIQS 158
            +++++     + +K +     
Sbjct: 154 QKEISEQDQKGLVDKYLKEAGD 175


>gi|282917456|ref|ZP_06325209.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           D139]
 gi|282318658|gb|EFB49015.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           D139]
          Length = 173

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 71/153 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLEKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++    ++ +K +     
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAGD 172


>gi|237714630|ref|ZP_04545111.1| ATP synthase B subunit [Bacteroides sp. D1]
 gi|262406495|ref|ZP_06083044.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_22]
 gi|294646113|ref|ZP_06723776.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CC 2a]
 gi|294808292|ref|ZP_06767050.1| ATP synthase F0, B subunit [Bacteroides xylanisolvens SD CC 1b]
 gi|229445399|gb|EEO51190.1| ATP synthase B subunit [Bacteroides sp. D1]
 gi|262355198|gb|EEZ04289.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_22]
 gi|292638557|gb|EFF56912.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CC 2a]
 gi|294444511|gb|EFG13220.1| ATP synthase F0, B subunit [Bacteroides xylanisolvens SD CC 1b]
          Length = 167

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSKLKQEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQMEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV+I  +++ + + + D    + ++ +  + + ++
Sbjct: 131 LSVDIAEKVLRKSLEDKDAQMGMIDRMLDEVLTPNK 166


>gi|119026449|ref|YP_910294.1| F0F1 ATP synthase subunit B [Bifidobacterium adolescentis ATCC
           15703]
 gi|226741309|sp|A1A3C9|ATPF_BIFAA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|118766033|dbj|BAF40212.1| protein with similarity to ATP synthase B chain [Bifidobacterium
           adolescentis ATCC 15703]
          Length = 173

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y  + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  NARVEASKIRDDARAEASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            +  +  +I+  K+ +DDV S++ ++ I+ + S
Sbjct: 138 LATALAGKILGSKLESDDVQSTMIDQMIAELDS 170


>gi|298481156|ref|ZP_06999350.1| ATP synthase F0, B subunit [Bacteroides sp. D22]
 gi|298272730|gb|EFI14297.1| ATP synthase F0, B subunit [Bacteroides sp. D22]
          Length = 167

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSKLKQEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQMEKDEAIRDIRRQVAM 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV+I  +++ + + + D    + ++ +  + + ++
Sbjct: 131 LSVDIAEKVLRKSLEDKDAQMGMIDRMLDEVLTPNK 166


>gi|169335789|ref|ZP_02862982.1| hypothetical protein ANASTE_02214 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258527|gb|EDS72493.1| hypothetical protein ANASTE_02214 [Anaerofustis stercorihominis DSM
           17244]
          Length = 172

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 65/147 (44%)

Query: 12  SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEE 71
           ++ +   I+V       ++  +D   D I ++  +A   + K++++  +Y+EK   + EE
Sbjct: 22  AIFLLFFILVKKFFYEKVIEIVDKRQDMITEEFDKAEGEKAKADSLREEYEEKVKSINEE 81

Query: 72  TREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI 131
              I   A   AK + E       + +       ++ I   +  A + +   I D S +I
Sbjct: 82  ALTITNNATKEAKEIKENIISEANEEARRIKAKSKKDIENARETAMKEMKDSIIDISFDI 141

Query: 132 VREIISQKMNDDVNSSIFEKTISSIQS 158
             +++  K++ + + ++ +K I S+  
Sbjct: 142 TSKVLDTKLDKNADEALVKKAIESLDE 168


>gi|163942997|ref|YP_001647881.1| F0F1 ATP synthase subunit B [Bacillus weihenstephanensis KBAB4]
 gi|229014479|ref|ZP_04171597.1| ATP synthase B chain [Bacillus mycoides DSM 2048]
 gi|229064960|ref|ZP_04200258.1| ATP synthase B chain [Bacillus cereus AH603]
 gi|229136128|ref|ZP_04264881.1| ATP synthase B chain [Bacillus cereus BDRD-ST196]
 gi|229170017|ref|ZP_04297709.1| ATP synthase B chain [Bacillus cereus AH621]
 gi|226741306|sp|A9VSA7|ATPF_BACWK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|163865194|gb|ABY46253.1| ATP synthase F0, B subunit [Bacillus weihenstephanensis KBAB4]
 gi|228613442|gb|EEK70575.1| ATP synthase B chain [Bacillus cereus AH621]
 gi|228647287|gb|EEL03369.1| ATP synthase B chain [Bacillus cereus BDRD-ST196]
 gi|228716261|gb|EEL67973.1| ATP synthase B chain [Bacillus cereus AH603]
 gi|228746829|gb|EEL96714.1| ATP synthase B chain [Bacillus mycoides DSM 2048]
          Length = 168

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 62/146 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKTSAVQEIQREKEQAIAALQEQVASLSVHIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|83815076|ref|YP_445047.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855]
 gi|83756470|gb|ABC44583.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855]
          Length = 204

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +IFL I+        +   L+   ++I   I  A    E+++ I  + +E   
Sbjct: 53  FWKTVAFLIFLYILYRFG-WGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEEARR 111

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + E++ ++I+  A+  A+ L EE      +      +  + +I   K  A + L  ++AD
Sbjct: 112 EAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDEVAD 171

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            ++E  ++II   ++ D +  + +  +    +
Sbjct: 172 LAIEAAQKIIENDLDADRHRQLVDDALDDFPT 203


>gi|239828589|ref|YP_002951213.1| F0F1 ATP synthase subunit B [Geobacillus sp. WCH70]
 gi|239808882|gb|ACS25947.1| ATP synthase F0, B subunit [Geobacillus sp. WCH70]
          Length = 179

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 63/137 (45%)

Query: 22  YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH 81
                  L+  +    + I ++I +A + R+++E +L + +E   +  +E +E+I  A+ 
Sbjct: 41  RKYAFGPLMGVMKQREEHIANEIEQAEKHRKEAEKLLEEQRELMKQSRQEAQELIENARK 100

Query: 82  RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN 141
            A+   E+   +    +    +  +++I   K +A   L  ++A  SV I  ++I +++ 
Sbjct: 101 MAEEQKEQIIASARAEAERLKETAKKEIEREKEQAMAALREQVASLSVLIASKVIEKELT 160

Query: 142 DDVNSSIFEKTISSIQS 158
           +   + +  + I  +  
Sbjct: 161 EQDQAKLISEYIQEVGE 177


>gi|240143391|ref|ZP_04741992.1| ATP synthase F0, B subunit [Roseburia intestinalis L1-82]
 gi|257204660|gb|EEV02945.1| ATP synthase F0, B subunit [Roseburia intestinalis L1-82]
          Length = 171

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLR-IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           +V M+L +F + +   + +       L+   ++I  DI  A   ++ +  +  +Y  K  
Sbjct: 15  VVLMALAVFFLFLFMSKMLFEPARKLLNDRKNRIAADIKTAETDKQDAAALKAEYDAKLK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +V++E  +I+  A+  A+  A     + ++ +A  +K   ++    K  A   +  ++  
Sbjct: 75  EVDKEAEQILSEARKTAQKNAARIESDAKEEAARIIKRANEEAELSKKRAMDEVKQEMIT 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +  +  ++++  ++  V  ++ E+T+  +   
Sbjct: 135 VASMMAAKVVAANIDATVQDTLVEETLKEMGDS 167


>gi|224543576|ref|ZP_03684115.1| hypothetical protein CATMIT_02785 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523503|gb|EEF92608.1| hypothetical protein CATMIT_02785 [Catenibacterium mitsuokai DSM
           15897]
          Length = 166

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 72/152 (47%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T +V +     ++++    + + +L F    AD I  +I +A+   EK+   L++ +++
Sbjct: 13  TTMIVQLCSTAIMLLLFKKYLWNYVLEFFQKRADFIEGNINDAKAKNEKASEYLLESEKQ 72

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +  ++ +EII  AK  A     +      + +   ++    +I   KL A+  +  +I
Sbjct: 73  AKEAAKQYKEIIDQAKEDAVKAKSKIMDEANKQAQEKIEQARHEIESEKLAAQDEMKKEI 132

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            D +VE+  +++ Q MN + N ++ +  +  +
Sbjct: 133 VDVAVEVATKVMDQNMNTEANKALVDDFVKQV 164


>gi|257462632|ref|ZP_05627042.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp. D12]
          Length = 168

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 70/153 (45%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIV-VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  I + +   Y +IP  +   L     KI  ++  A   +E+++    Q +   
Sbjct: 16  FWQIINFFILVFVFNKYCKIP--IQRILTERKKKITSELRSASLSKEEAKISARQAETAL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E  EI+  A++RA+ +  E   +        L++  +++  +K  A++ L+ ++ 
Sbjct: 74  KEARDEAYEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKSRARQELHQEVT 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +VE+  +++ + +++   + + +  I  +  
Sbjct: 134 SLAVELAEKLMRKNIDEQTATDLIDDFIERVGD 166


>gi|261879473|ref|ZP_06005900.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
 gi|270333898|gb|EFA44684.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
          Length = 173

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 73/159 (45%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++   ++     P+ + + ++     I D + +A    E+ ENI  + +    
Sbjct: 16  FWMLLAFLVVFGVLAKFGFPA-ITNMVEDRKKYIDDSLRKAHEASERLENIRQEGESMLQ 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +++  A     ++ E+  +  +      L D + +I   K  A R + +++A+
Sbjct: 75  EAREKQAQLLKEATETRDVIVEKAQEKAKAEGTRLLSDAKAQIEAEKQNAIRDIRSQVAE 134

Query: 127 FSVEIVREIISQKMND-DVNSSIFEKTISSIQSCHQMDK 164
            SV+I   I+ Q+++  D    + +K +  +   ++ ++
Sbjct: 135 LSVKIAERIVKQQLSSNDKQMELIDKLLDEVSEDNKREQ 173


>gi|268315887|ref|YP_003289606.1| ATP synthase F0, B subunit [Rhodothermus marinus DSM 4252]
 gi|262333421|gb|ACY47218.1| ATP synthase F0, B subunit [Rhodothermus marinus DSM 4252]
          Length = 171

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 55/138 (39%)

Query: 22  YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH 81
           Y      +L  L    + I   +  A R   ++  I  + +    + E+E + I+  A+ 
Sbjct: 32  YKFAWKPILQALKEREESIDTSLRRAERALAEARQIQAENERIRREAEQEAQRILREARE 91

Query: 82  RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN 141
            A+ L +E  Q               +I   K  A   L A +AD +++   +I+ + ++
Sbjct: 92  EAERLRQEELQKTRVQIQQMQAQARAEIEREKQGALDELRAVVADLAIQAAEKILRESLD 151

Query: 142 DDVNSSIFEKTISSIQSC 159
            D    + E+ + S+ + 
Sbjct: 152 ADRQRRLVERFLESLPAS 169


>gi|239637400|ref|ZP_04678382.1| ATP synthase F0, B subunit [Staphylococcus warneri L37603]
 gi|239597000|gb|EEQ79515.1| ATP synthase F0, B subunit [Staphylococcus warneri L37603]
 gi|330684786|gb|EGG96479.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU121]
          Length = 173

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 68/153 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+  
Sbjct: 20  TVIVQIVTFIILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKLNAQKLEEENKQTL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E + I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQDEVQRILEDAKVQARKQHEEIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++     + EK +     
Sbjct: 140 ELSVLIASKVLRKEISEQDQKELVEKYLKEAGD 172


>gi|24215481|ref|NP_712962.1| F0F1 ATP synthase subunit B [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45657122|ref|YP_001208.1| F0F1 ATP synthase subunit B [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|81699498|sp|Q72SY3|ATPF_LEPIC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81748219|sp|Q8F2J0|ATPF_LEPIN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24196612|gb|AAN49980.1| ATP synthase F0 subunit B [Leptospira interrogans serovar Lai str.
           56601]
 gi|45600360|gb|AAS69845.1| ATP synthase B chain [Leptospira interrogans serovar Copenhageni
           str. Fiocruz L1-130]
          Length = 173

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 61/136 (44%)

Query: 25  IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAK 84
              ++L  LD  A+ +++DI +A  LR ++E +L  Y+ + +  ++E   I+  AK  A 
Sbjct: 37  AWDVILKALDERAETVQNDIKKASELRLEAEALLKDYEARLNSAKDEANAIVAEAKSDAL 96

Query: 85  ILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDV 144
            L  +  +              ++I   K +A   L A+I + ++ +  +++ +++  + 
Sbjct: 97  KLKNKLLEETNGEVKAQKDQAVKEIELAKAKALGQLQAQIVEMTITVAAKVLEKQLKSED 156

Query: 145 NSSIFEKTISSIQSCH 160
             +  E  +  +    
Sbjct: 157 YKAFIETELDKLGKLS 172


>gi|86160753|ref|YP_467538.1| ATP synthase F0 subunit B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497396|sp|Q2IHP6|ATPF_ANADE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|85777264|gb|ABC84101.1| ATP synthase F0 subcomplex B subunit [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 179

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ L ++        ++  L      IR+ I  A++ R ++E +L   KE  
Sbjct: 24  TLWTAITFLVMLAVLAKF-AWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           SK + E  E+    +   + L +E      + +   + +  ++I    ++AK  L A++ 
Sbjct: 83  SKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELVKAKAELKAQVV 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +++    ++   +++    ++ E+ I+ + +
Sbjct: 143 DLAIDAASRLVKANLDEKSQRALVEEYIAQLPA 175


>gi|283782159|ref|YP_003372914.1| ATP synthase F0, B subunit [Pirellula staleyi DSM 6068]
 gi|283440612|gb|ADB19054.1| ATP synthase F0, B subunit [Pirellula staleyi DSM 6068]
          Length = 303

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
           F+   + L I+        ++S LD     I D I  AR   E++   L +++ + S   
Sbjct: 154 FLVFCVLLAILTKF-AWGPIVSGLDKREQGIADMIENARIANEQAAAKLREHEARLSAAA 212

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           EETR ++  A+  A+   E+     +  +A         I   K  A + +  K  + ++
Sbjct: 213 EETRALLTQARVDAEAAREKIVGEAQAAAARERDRAVADIATAKSVALKEIAEKSVETAL 272

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +   I+ +++  + + ++  + ++   + +
Sbjct: 273 ALAGNIVRREIKPEDHETLITEALNKFPTLN 303


>gi|154249026|ref|YP_001409851.1| ATP synthase F0, B subunit [Fervidobacterium nodosum Rt17-B1]
 gi|226741453|sp|A7HJW1|ATPF_FERNB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|154152962|gb|ABS60194.1| ATP synthase F0, B subunit [Fervidobacterium nodosum Rt17-B1]
          Length = 161

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 69/156 (44%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T +V +   +FL+ ++   +    L  ++   +KI  +I EA +LR+++E I    +
Sbjct: 6   INLTAVVQLLNFLFLLWILNKLLYKPFLGMMEKRKEKIEGEIVEAEKLRKQAEEIKKNAE 65

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+         +II +A   ++ + EE  Q  ++ +   L++   +I   K EA   +  
Sbjct: 66  EELKNARIRAEQIIASANSESEKIVEEAKQKAQKEAEKILQNAYLEIEKQKQEALAQVQT 125

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              + ++ +  +++   +++        K I   + 
Sbjct: 126 IATELAINLAMKVLKGTLDEKAKREYLAKVIKEYEK 161


>gi|310825289|ref|YP_003957647.1| ATP synthase B chain [Stigmatella aurantiaca DW4/3-1]
 gi|309398361|gb|ADO75820.1| ATP synthase B chain [Stigmatella aurantiaca DW4/3-1]
          Length = 182

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ I+  V++ + +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 21  FWTLVTFILVAVVLRW-KAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKTAIA 79

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++   +   +   +E      + +        ++I   KL+A   +     D
Sbjct: 80  EARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTMAVD 139

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++E+  +++S++M+D  + ++ E+ +  +   
Sbjct: 140 LAMEVAGKLLSERMDDAKHRALAEQFVQGLPVA 172


>gi|269798592|ref|YP_003312492.1| ATP synthase F0 subunit beta [Veillonella parvula DSM 2008]
 gi|269095221|gb|ACZ25212.1| ATP synthase F0, B subunit [Veillonella parvula DSM 2008]
          Length = 165

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 59/148 (39%), Gaps = 1/148 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++  I + ++        LL+ +    ++I  D+  A + R ++E     Y  + S    
Sbjct: 14  LNFFILVWLLARF-AYKPLLAMMTERKERIAKDLEAAEQARAETEKFKADYAAQISNARV 72

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E ++I+  A   A+    E      +          Q I   +  A   L  ++   SV 
Sbjct: 73  EAQQIVEKAIQEAENTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNEVVSLSVA 132

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +++++ MN + N+ + E  I  + S
Sbjct: 133 MAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|313112903|ref|ZP_07798549.1| ATP synthase F0, B subunit [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310624808|gb|EFQ08117.1| ATP synthase F0, B subunit [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 168

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 67/155 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TFL  +  ++  + +    + + + + +     K    I +A +LR ++E +  +Y++  
Sbjct: 14  TFLAQICNLMIQLFIFKKFLLNPVKNVIAERKAKADSQIADATKLRTEAEAMKAEYEQNL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EI+  A+  A    EE        +A   +  E  I   + +A   +  +I 
Sbjct: 74  QNARTEANEIVANAQKTATARGEEIVGEARAQAAALKQKAEADIAQERKKAVNEVKDEIG 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             ++EI  +++ +++++  +  + ++ I ++    
Sbjct: 134 GIAMEIASKVVEREISEKDHKDLIDEFIKNVGEAS 168


>gi|296111394|ref|YP_003621776.1| H(+)-transporting two-sector ATPase, B subunit [Leuconostoc kimchii
           IMSNU 11154]
 gi|295832926|gb|ADG40807.1| H(+)-transporting two-sector ATPase, B subunit [Leuconostoc kimchii
           IMSNU 11154]
          Length = 169

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 71/154 (46%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            +  + +S +  + I+  +     +   LD  A KI +DI  A   R+++E++ +Q + +
Sbjct: 16  NSVFIIISFLALMYILKKV-AYGPVTKTLDDRAAKISNDIDGAEVARQEAEDLAVQRQSE 74

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +   ++  +++  AK  A+  ++         + L  +  +     +K +A       +
Sbjct: 75  LADTRQKATQVVADAKASAQKQSDTLISTASDRATLISQRAQTDAEKLKEDAILNAKNDV 134

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A  SV I  +++ ++++ +   ++ +  IS +++
Sbjct: 135 AALSVAIASKLMQKELSLNDQQALIDAYISDLET 168


>gi|168185928|ref|ZP_02620563.1| ATP synthase F0, B subunit [Clostridium botulinum C str. Eklund]
 gi|169295924|gb|EDS78057.1| ATP synthase F0, B subunit [Clostridium botulinum C str. Eklund]
          Length = 159

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 79/150 (52%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +    ++ +  +   +   +D  +  I +DI +A+  ++K++ + +  +E++  
Sbjct: 10  WTIINFLALFAVLSHF-LFKPVNQIIDKRSSDIENDINQAKIDKDKAQELRIANEEEYKT 68

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E + I+   K +A+ ++EE   +  + + L ++  +++I   + +A+  +  +  + 
Sbjct: 69  AKKEGKTIVENYKAKAENVSEEIISDAHKEAELIIERAKKEIQREREKAEDEVKNRTIEL 128

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           S+E+ ++ + + +++ ++  + ++ IS + 
Sbjct: 129 SLELSKKALERSIDEKMHRELIDEFISKVG 158


>gi|154488036|ref|ZP_02029153.1| hypothetical protein BIFADO_01605 [Bifidobacterium adolescentis
           L2-32]
 gi|154083509|gb|EDN82554.1| hypothetical protein BIFADO_01605 [Bifidobacterium adolescentis
           L2-32]
          Length = 173

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y  + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  SARVEASKIRDDARAEASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            +  +  +I+  K+ +DDV S++ ++ I+ + S
Sbjct: 138 LATALAGKILGSKLESDDVQSTMIDQMIAELDS 170


>gi|220927390|ref|YP_002502692.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951997|gb|ACL62389.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 187

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 60/146 (41%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++  +   ++  + IP  +   L     ++  D+ EA R++  ++     Y     
Sbjct: 39  LWVAITFGLLYYLMSRVAIPR-ITGLLHERQMRLAGDLDEAARMKTDADAARESYARSLK 97

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + +++ + I  A +      AE   +++E   A  L + E +I    + A   +    AD
Sbjct: 98  EAQDKAKGIAQATRDSLAAEAETRRKSLEADLAAKLAESEAQIRSRTVSAMSNVREVAAD 157

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            +  IV  +I Q  +     + +++T
Sbjct: 158 AATAIVERLIGQTPDRAAVEAAYDRT 183


>gi|120603234|ref|YP_967634.1| H+-transporting two-sector ATPase, B/B' subunit [Desulfovibrio
           vulgaris DP4]
 gi|226741434|sp|A1VFJ1|ATPF_DESVV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120563463|gb|ABM29207.1| ATP synthase F0 subcomplex B subunit [Desulfovibrio vulgaris DP4]
 gi|311233030|gb|ADP85884.1| H+transporting two-sector ATPase B/B' subunit [Desulfovibrio
           vulgaris RCH1]
          Length = 188

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/146 (11%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++ +IF  I ++      ++ F       I  ++ +    + +++  L + + + + +E 
Sbjct: 41  VNFVIFAGI-IWKAAGKKIVGFFTGRRQGIEQELNDLETRKTEAKKQLAEVERRIANLES 99

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E + I+   + + + +        E+ ++L  +  ++        A   + A++AD  + 
Sbjct: 100 ERQAILADYRAQGENIKAAIIDKAEKSASLITEQAKRTADNEIKAAIDAMRAQMADEIIV 159

Query: 131 IVREIISQKMNDDVNSSIFEKTISSI 156
              +++++K+  + +  + +K ++ +
Sbjct: 160 AAEKLLAEKLTANEHEKLIDKYLTKV 185


>gi|319408194|emb|CBI81847.1| ATP synthase, B' chain [Bartonella schoenbuchensis R1]
          Length = 193

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 73/144 (50%), Gaps = 5/144 (3%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S   F + +  + +P  + + ++   D+I  D+ +A R++++++ ++  Y++K +
Sbjct: 42  FWLAISFGFFYLFIARVIVPR-IGNVIETRRDRIASDLDQAMRMKQEADTVIEVYEKKLA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   + R ++  A+ + K  A+   + +E+     L     +I  ++ +A + +      
Sbjct: 101 EARLQARIVVQEARDKIKEKADLERKEVEKKLEKKLATAGDQIAEIRDKAMQNVGL---- 156

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            + E+ REI+ + ++ DV+  +  
Sbjct: 157 IAEEVTREIVKKLLDIDVSEEVVN 180


>gi|242371598|ref|ZP_04817172.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis M23864:W1]
 gi|242350665|gb|EES42266.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis M23864:W1]
          Length = 171

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 71/153 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T LV ++  + L+ ++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TMLVTIATFVVLLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKVNAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANVRANGMIETAQSEINSQKERALADINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + SV I  +++ +++++    ++ EK +     
Sbjct: 138 ELSVLIASKVLRKEISEQDQKALVEKYLKEAGD 170


>gi|229164257|ref|ZP_04292190.1| ATP synthase B chain [Bacillus cereus R309803]
 gi|228619197|gb|EEK76090.1| ATP synthase B chain [Bacillus cereus R309803]
          Length = 168

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|160942709|ref|ZP_02089951.1| hypothetical protein FAEPRAM212_00185 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445983|gb|EDP22986.1| hypothetical protein FAEPRAM212_00185 [Faecalibacterium prausnitzii
           M21/2]
          Length = 168

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 70/155 (45%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TFL  +  ++  +++    +   +   +     K   +I +A++LR ++E +  +Y++  
Sbjct: 14  TFLAQICNLMIQLVIFKKFLLKPIKQVIADRKAKADSEIADAQKLRTEAEAMKAEYEQNL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +I+ AA+  A   +EE        +A   +  E  I   + +A   +  +I 
Sbjct: 74  QNARTEANQIVTAAQKTATARSEEIVGEARAQAAALKQKAEADIAQERKKAVNEVKDEIG 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             ++EI  +++ +++++  +  + ++ I ++    
Sbjct: 134 GIAMEIASKVVEREISEKDHKDLIDEFIKNVGEAS 168


>gi|303230072|ref|ZP_07316844.1| ATP synthase F0, B subunit [Veillonella atypica ACS-134-V-Col7a]
 gi|302515282|gb|EFL57252.1| ATP synthase F0, B subunit [Veillonella atypica ACS-134-V-Col7a]
          Length = 165

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 64/148 (43%), Gaps = 1/148 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++  I + I+        L+S +    ++I  D+ +A+  R ++E     Y  + +   +
Sbjct: 14  LNFFILVWILARF-AYKPLVSMMQERKERIAKDLADAQAARNEAEQFKADYAAQIANARQ 72

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E ++I+  A  +A+    E      +      +   Q I   +  A   L  ++   SV 
Sbjct: 73  EAQQIVEKAVQQAEATTREQLAAAREQIEREKERARQDIVNERDRAMNNLRNEVISLSVA 132

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +++++ M+ + N+ + E  I+ + S
Sbjct: 133 MATKVVAKDMDSETNTKLIEDAIAKLDS 160


>gi|221633215|ref|YP_002522440.1| ATP synthase F0 subunit B [Thermomicrobium roseum DSM 5159]
 gi|221155512|gb|ACM04639.1| ATP synthase F0, B subunit [Thermomicrobium roseum DSM 5159]
          Length = 165

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++ ++FL +     +   +   +D   ++IR+ +  A R++ +      + +E  ++  
Sbjct: 15  LIAFLLFLAVFWRFAL-GPITRMIDQRQERIREGLEAAERMKRELAETQARNEEILAEAR 73

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E + I+ +A+  A+ L     +  +Q +   ++  ++ I   +      L  ++AD ++
Sbjct: 74  REAQRIVASARESAEQLIARAREEAQQQAQQLIQQAQEAIEAERQRVWAELRREVADLAI 133

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
                II Q+++ D + ++ E+ ++ +    +
Sbjct: 134 LAATRIIRQELDRDRHLALIEQALAELDGARR 165


>gi|167463131|ref|ZP_02328220.1| hypothetical protein Plarl_11311 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 164

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 67/157 (42%), Gaps = 1/157 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
            H++       +  I   ++        L   ++  A+ +++ +  A   R ++E ++ +
Sbjct: 3   WHWESFVFAIFAFAILYWLLNKY-AFGPLFGIMEKRAELVQEQLKSAETNRTQAEQLVAE 61

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            KE   +  ++   I+  AK  +   AEE     ++ ++   ++  + I   K +A   L
Sbjct: 62  QKEAIQEARKDAYNIVEQAKQASTRQAEEIVHKAKEDASRIKEEAVRDIESEKNKAIAAL 121

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
             ++ D SV I  +++ ++++      +  + +  ++
Sbjct: 122 REQVGDMSVLIASKVLEKEVDAGEQQKLVNQYLKEVE 158


>gi|226694487|sp|Q1DF98|ATPF_MYXXD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 184

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 67/150 (44%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I  V++ + +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 21  FWTLVTFVIAAVVLKW-KAWGPILSLVEEREKQIASSIESAKRERAEAEKLLADQKTAIA 79

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++       +   EE      + +        ++I   K +A   + +   D
Sbjct: 80  EARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKLSARREIDEQKAKAIAEVRSMAVD 139

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++E+  ++IS++M+D    ++ E+ +  +
Sbjct: 140 LAMEVAGKLISERMDDSKQRALAEQFVQGL 169


>gi|47569804|ref|ZP_00240475.1| ATP synthase F0, B subunit [Bacillus cereus G9241]
 gi|206970328|ref|ZP_03231281.1| ATP synthase F0, B subunit [Bacillus cereus AH1134]
 gi|228924045|ref|ZP_04087321.1| ATP synthase B chain [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228955556|ref|ZP_04117559.1| ATP synthase B chain [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228988534|ref|ZP_04148621.1| ATP synthase B chain [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|229026748|ref|ZP_04183081.1| ATP synthase B chain [Bacillus cereus AH1272]
 gi|229033941|ref|ZP_04188895.1| ATP synthase B chain [Bacillus cereus AH1271]
 gi|229072776|ref|ZP_04205975.1| ATP synthase B chain [Bacillus cereus F65185]
 gi|229082523|ref|ZP_04214986.1| ATP synthase B chain [Bacillus cereus Rock4-2]
 gi|229158871|ref|ZP_04286928.1| ATP synthase B chain [Bacillus cereus ATCC 4342]
 gi|229181557|ref|ZP_04308883.1| ATP synthase B chain [Bacillus cereus 172560W]
 gi|229193561|ref|ZP_04320505.1| ATP synthase B chain [Bacillus cereus ATCC 10876]
 gi|47553546|gb|EAL11926.1| ATP synthase F0, B subunit [Bacillus cereus G9241]
 gi|206734905|gb|EDZ52074.1| ATP synthase F0, B subunit [Bacillus cereus AH1134]
 gi|228589866|gb|EEK47741.1| ATP synthase B chain [Bacillus cereus ATCC 10876]
 gi|228601925|gb|EEK59420.1| ATP synthase B chain [Bacillus cereus 172560W]
 gi|228624482|gb|EEK81252.1| ATP synthase B chain [Bacillus cereus ATCC 4342]
 gi|228700955|gb|EEL53478.1| ATP synthase B chain [Bacillus cereus Rock4-2]
 gi|228710267|gb|EEL62242.1| ATP synthase B chain [Bacillus cereus F65185]
 gi|228728367|gb|EEL79389.1| ATP synthase B chain [Bacillus cereus AH1271]
 gi|228734543|gb|EEL85204.1| ATP synthase B chain [Bacillus cereus AH1272]
 gi|228771151|gb|EEM19630.1| ATP synthase B chain [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228804118|gb|EEM50734.1| ATP synthase B chain [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228835535|gb|EEM80900.1| ATP synthase B chain [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 168

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|257785100|ref|YP_003180317.1| ATP synthase F0, B subunit [Atopobium parvulum DSM 20469]
 gi|257473607|gb|ACV51726.1| ATP synthase F0, B subunit [Atopobium parvulum DSM 20469]
          Length = 203

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 65/154 (42%), Gaps = 9/154 (5%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
             ++ +I   +V    +   +L  LD   +KI+ D+  A + RE++              
Sbjct: 51  ALIAFLIIFAVVAKF-VWPSVLRMLDKRQEKIQGDLDAAAKSREEANKDREIAAAGIDAA 109

Query: 69  EEETREIILAAKHRAK----ILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
           +++  EI+ AAK   +     + E+      +I       +E +    +  A   L   +
Sbjct: 110 KQQANEIVSAAKREGEEERARIIEQAKAEAVEIITKGKGVVESE----RRHAMAELSDSV 165

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D +V+I  +II  +++ +   ++ EK ++ + +
Sbjct: 166 VDLAVDIAGKIIGNELSVEQQRALAEKYLAEVGT 199


>gi|159184432|ref|NP_353741.2| F0F1 ATP synthase subunit B' [Agrobacterium tumefaciens str. C58]
 gi|226698387|sp|Q7D0U9|ATPX_AGRT5 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|159139745|gb|AAK86526.2| ATP synthase B' chain [Agrobacterium tumefaciens str. C58]
          Length = 213

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 64/136 (47%), Gaps = 1/136 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + +P  +   L+    +I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 63  LWLAITFGLFYLLMQKVIVPR-VGGILENRHGRIAQDLDEAARLKAEADTAVETYEKELA 121

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I  +A+  AK  A+     IE   A  L   E++I  ++  A   + A   +
Sbjct: 122 AARAKASSIGASARDAAKAKADADRAAIEAGLAEKLAAAEKRIAGIRDHAFADVGAIAEE 181

Query: 127 FSVEIVREIISQKMND 142
            +  IV +++  K+ D
Sbjct: 182 TATAIVDQLVGAKVKD 197


>gi|42784479|ref|NP_981726.1| F0F1 ATP synthase subunit B [Bacillus cereus ATCC 10987]
 gi|206976874|ref|ZP_03237776.1| ATP synthase F0, B subunit [Bacillus cereus H3081.97]
 gi|217962798|ref|YP_002341376.1| F0F1 ATP synthase subunit B [Bacillus cereus AH187]
 gi|222098780|ref|YP_002532838.1| f0f1 ATP synthase subunit b [Bacillus cereus Q1]
 gi|229142051|ref|ZP_04270576.1| ATP synthase B chain [Bacillus cereus BDRD-ST26]
 gi|229199433|ref|ZP_04326096.1| ATP synthase B chain [Bacillus cereus m1293]
 gi|81699585|sp|Q72XE4|ATPF_BACC1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741303|sp|B7HY69|ATPF_BACC7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|42740411|gb|AAS44334.1| ATP synthase F0, B subunit [Bacillus cereus ATCC 10987]
 gi|206744840|gb|EDZ56245.1| ATP synthase F0, B subunit [Bacillus cereus H3081.97]
 gi|217063785|gb|ACJ78035.1| ATP synthase F0, B subunit [Bacillus cereus AH187]
 gi|221242839|gb|ACM15549.1| ATP synthase F0, B subunit [Bacillus cereus Q1]
 gi|228584009|gb|EEK42164.1| ATP synthase B chain [Bacillus cereus m1293]
 gi|228641340|gb|EEK97646.1| ATP synthase B chain [Bacillus cereus BDRD-ST26]
          Length = 168

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDAIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|302392951|ref|YP_003828771.1| ATP synthase F0 subunit B [Acetohalobium arabaticum DSM 5501]
 gi|302205028|gb|ADL13706.1| ATP synthase F0, B subunit [Acetohalobium arabaticum DSM 5501]
          Length = 167

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 76/156 (48%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   +   I L +++   +   + +F++  ++ I D I EA +   K+E +  +YK
Sbjct: 4   LDVTFFFQVINFIALFLILRHFLFEPITNFMNQRSEDISDQIEEAEKKEAKAEELKSKYK 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +++ +EII   + R +    +     ++ ++  ++  E +I   K +A+  L  
Sbjct: 64  QELKEAKQKAQEIIEEGRRRGQRKKNDIINEAKEEASRQIQKAEDEIERAKQKAREKLKD 123

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  D SV++ ++++ Q ++ ++        + ++  
Sbjct: 124 EALDLSVDMTKKVVDQMIDKELQEQTINNYLENLDE 159


>gi|317471139|ref|ZP_07930510.1| ATP synthase F0 [Anaerostipes sp. 3_2_56FAA]
 gi|316901354|gb|EFV23297.1| ATP synthase F0 [Anaerostipes sp. 3_2_56FAA]
          Length = 171

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 70/149 (46%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +++ I    + Y+ +   +   L+   +KI DD+  A   ++++  +  +Y+EK   +E
Sbjct: 19  AVAVFIMFAFLSYV-LFEPVRKLLNDRKNKIADDLDTAAADKKEAARLKAEYEEKIRDIE 77

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E  EI+  A+ +A    +E      Q +    +  E +I   K + +  +  ++   +V
Sbjct: 78  KEADEILSQARKKALKREDEIISEARQEALKITERAENEIALEKKKVRDQVKQEMIQVAV 137

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +II+ K++     ++ E+T+  +  
Sbjct: 138 AMAGKIITDKIDPAKQDALVEETLKEMGD 166


>gi|303231202|ref|ZP_07317940.1| ATP synthase F0, B subunit [Veillonella atypica ACS-049-V-Sch6]
 gi|302514109|gb|EFL56113.1| ATP synthase F0, B subunit [Veillonella atypica ACS-049-V-Sch6]
          Length = 165

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 64/148 (43%), Gaps = 1/148 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++  I + I+        L+S +    ++I  D+ +A+  R ++E     Y  + +   +
Sbjct: 14  LNFFILVWILARF-AYKPLVSMMQERKERIAKDLADAQVARNEAEQFKADYAAQIANARQ 72

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E ++I+  A  +A+    E      +      +   Q I   +  A   L  ++   SV 
Sbjct: 73  EAQQIVEKAVQQAEATTREQLAAAREQIEREKERARQDIVNERDRAMNNLRNEVISLSVA 132

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +++++ M+ + N+ + E  I+ + S
Sbjct: 133 MATKVVAKDMDSETNTKLIEDAIAKLDS 160


>gi|260906203|ref|ZP_05914525.1| ATP synthase F0, B subunit [Brevibacterium linens BL2]
          Length = 183

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 68/152 (44%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  ++V    +P+     LD  A++I+  I +A +++ +++  L +Y+++ + 
Sbjct: 23  WSAICLLIVFLVVWKYVLPA-FNKTLDERAERIQGGIEKAEKVQAEADEALAEYQKQLAD 81

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+     +           S   +   + +I   +  A   L +++   
Sbjct: 82  GRAEAARLRAEAQEEGAQIIANMKTQAHAESERIVAQAQTQIEAERQSAMVQLRSEVGTL 141

Query: 128 SVEIVREIISQKMNDDVNSS-IFEKTISSIQS 158
           + ++   I+ + + DD  S+ + ++ I+ ++S
Sbjct: 142 ATDLASRIVGESLTDDQRSANVVDRFITDLES 173


>gi|254471829|ref|ZP_05085230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062]
 gi|211959031|gb|EEA94230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062]
          Length = 184

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 62/138 (44%), Gaps = 1/138 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S  +F  ++  + +P  +   L+   D+I  D+ EA RL+++++  +  Y+   +
Sbjct: 37  LWLVLSFGVFYWVMSKVVLPR-IGGILEDRRDRIAGDMAEASRLKQETDEAIASYESALA 95

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              ++   +   A+ + K   E      E+  A  L + EQ I  +K E+   +    A+
Sbjct: 96  DARKKATTMAHDARSKVKAETEGARAAAEEQLAAKLSESEQSISKIKAESLSHVGEIAAE 155

Query: 127 FSVEIVREIISQKMNDDV 144
            + E+V+ +I  +     
Sbjct: 156 TTGELVKALIGGRAPAKA 173


>gi|291560275|emb|CBL39075.1| ATP synthase, F0 subunit b [butyrate-producing bacterium SSC/2]
          Length = 160

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 69/148 (46%), Gaps = 1/148 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +++++F  +++   +   +   ++     I  D+ +A + + ++E I  +Y++  ++
Sbjct: 11  WPIVNIVVFY-LLLRKFLFGPVSEVMEKRKKMISSDLDDAAQTKAEAEEIKQEYEKNLAQ 69

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E  +I+  A+ RAK   +      ++  AL  ++  + I   K +    L  +IA  
Sbjct: 70  AKDEAGQIVSDARTRAKNEYQNKMDQTKEEIALMRENARKDIEAEKQKTIAGLQTEIAGI 129

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISS 155
           ++    +++ ++ ND  N  + +  +  
Sbjct: 130 ALMAASKVVEKEANDKGNEKLLDDFLKE 157


>gi|226741481|sp|A9KK96|ATPF_CLOPH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 187

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/151 (11%), Positives = 69/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++ +++ +  +I+ YL + +     L    D+I++++  + + ++++  +   Y+ K  +
Sbjct: 33  IMGLAIFVLFLILSYL-LFNPARELLQKRQDRIKEEMDSSAKDKKEATQLKTNYEAKIKE 91

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  EI+   + +A     +     +  ++  +    ++I   K + K  +  ++   
Sbjct: 92  ASKEVDEILSEGRKKALKRENDIVDEAKVEASRIVDRANKEIELNKSKMKDEVKQEMIAV 151

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +  +  +II+  +++     + ++ ++ +  
Sbjct: 152 ASVMAGKIIAGNIDETKQKQLIDEALNEMGD 182


>gi|170744959|ref|YP_001773614.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium sp.
           4-46]
 gi|226698381|sp|B0ULY3|ATPX_METS4 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|168199233|gb|ACA21180.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium sp.
           4-46]
          Length = 187

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 60/146 (41%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +   ++  + +P  +   L     ++  D+ EA R++  +++    Y+    
Sbjct: 39  LWLAIAFGLLYYLMSRVAVPR-IAGLLHDRQARLAADLDEASRMKTGADSARGAYERSLK 97

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + +++ + I  A +      AE   + +E   A  L + E +I      A   +    AD
Sbjct: 98  EAQDKAKGIAQATRDSLAAEAETRRKALEADLAAKLAESEAQIRARTATAMGSVREVAAD 157

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            +  IV  +I Q  +     + +++T
Sbjct: 158 AATAIVERLIGQSPDRAAVEAAYDRT 183


>gi|313123403|ref|YP_004033662.1| ATP synthase subunit b [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312279966|gb|ADQ60685.1| ATP synthase subunit b [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
          Length = 168

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 62/154 (40%), Gaps = 1/154 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    +   I L + V       +   ++    K+ DD+ +A   R+K+E +  + +  
Sbjct: 16  NTLWYLIVFSILL-LAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAEILANEREAA 74

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                +E  +I+  AK  A+   ++     +  ++   +  +      K +A      ++
Sbjct: 75  LKNSRQEATQILSVAKSNAQKTGKQIVSEAKAEASAIRERAKADAAQAKSDALNEARNEV 134

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD SV I  ++I++ ++      + ++ I  +  
Sbjct: 135 ADLSVTIAEKVIAKNLSAADQKDLVDQFIKGLND 168


>gi|30023341|ref|NP_834972.1| F0F1 ATP synthase subunit B [Bacillus cereus ATCC 14579]
 gi|218235641|ref|YP_002370085.1| F0F1 ATP synthase subunit B [Bacillus cereus B4264]
 gi|229050980|ref|ZP_04194529.1| ATP synthase B chain [Bacillus cereus AH676]
 gi|229112723|ref|ZP_04242256.1| ATP synthase B chain [Bacillus cereus Rock1-15]
 gi|229130559|ref|ZP_04259515.1| ATP synthase B chain [Bacillus cereus BDRD-Cer4]
 gi|229147850|ref|ZP_04276191.1| ATP synthase B chain [Bacillus cereus BDRD-ST24]
 gi|229153473|ref|ZP_04281651.1| ATP synthase B chain [Bacillus cereus m1550]
 gi|81433043|sp|Q814V8|ATPF_BACCR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741302|sp|B7HFK6|ATPF_BACC4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29898902|gb|AAP12173.1| ATP synthase B chain [Bacillus cereus ATCC 14579]
 gi|218163598|gb|ACK63590.1| ATP synthase F0, B subunit [Bacillus cereus B4264]
 gi|228630077|gb|EEK86728.1| ATP synthase B chain [Bacillus cereus m1550]
 gi|228635500|gb|EEK91989.1| ATP synthase B chain [Bacillus cereus BDRD-ST24]
 gi|228652898|gb|EEL08780.1| ATP synthase B chain [Bacillus cereus BDRD-Cer4]
 gi|228670704|gb|EEL26015.1| ATP synthase B chain [Bacillus cereus Rock1-15]
 gi|228722357|gb|EEL73753.1| ATP synthase B chain [Bacillus cereus AH676]
          Length = 168

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|150006930|ref|YP_001301673.1| ATP synthase subunit B [Parabacteroides distasonis ATCC 8503]
 gi|255016048|ref|ZP_05288174.1| ATP synthase B subunit [Bacteroides sp. 2_1_7]
 gi|256842071|ref|ZP_05547576.1| ATP synthase F0, B subunit [Parabacteroides sp. D13]
 gi|262384327|ref|ZP_06077462.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_33B]
 gi|298377355|ref|ZP_06987308.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_19]
 gi|301308755|ref|ZP_07214707.1| ATP synthase F0, B subunit [Bacteroides sp. 20_3]
 gi|226694340|sp|A6L8N7|ATPF_PARD8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149935354|gb|ABR42051.1| ATP synthase B subunit [Parabacteroides distasonis ATCC 8503]
 gi|256736387|gb|EEU49716.1| ATP synthase F0, B subunit [Parabacteroides sp. D13]
 gi|262294030|gb|EEY81963.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_33B]
 gi|298265769|gb|EFI07429.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_19]
 gi|300833279|gb|EFK63897.1| ATP synthase F0, B subunit [Bacteroides sp. 20_3]
          Length = 166

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 73/151 (48%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  I  VI+     P +++  ++     I + +  AR+  E+  +I  + ++  +
Sbjct: 12  FWMIVSFGIVFVILSKYGFP-VIVKAIEQRKAYIDNSLETARQANERLAHIQAEGEKMLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + +E+   ++  A    + + EE  +     + L +++  ++I   K +A R + ++IAD
Sbjct: 71  EAKEKQNAVLKEAFAEKERIIEEARKKAVSEAHLQIEEATRRIREEKEKAIREVRSEIAD 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            S+ I  +++ +K+  D     + ++ +  +
Sbjct: 131 LSIAIAEKVMKEKIGRDKEQQQMIDRLLDEV 161


>gi|228911148|ref|ZP_04074954.1| ATP synthase B chain [Bacillus thuringiensis IBL 200]
 gi|228848511|gb|EEM93359.1| ATP synthase B chain [Bacillus thuringiensis IBL 200]
          Length = 168

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLILLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|89095626|ref|ZP_01168520.1| F0F1-type ATP synthaseB chain [Bacillus sp. NRRL B-14911]
 gi|89089372|gb|EAR68479.1| F0F1-type ATP synthaseB chain [Bacillus sp. NRRL B-14911]
          Length = 177

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/145 (15%), Positives = 61/145 (42%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           +++ I L+ ++       L+  +    + I ++I  A + R ++  +L + +    +   
Sbjct: 28  LAMFIILLALLKKFAWGPLMGIMKQREEHIANEIGAAEQSRVEANKLLEEQRSLLKEART 87

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           + + +I  AK +  +  EE        +    +  + +I   K +A   +  ++A  SV 
Sbjct: 88  DAQNLIEGAKKQGDVQREEIIAAARAEAERVKESAKLEIDQQKEKAVAAIREQVASLSVL 147

Query: 131 IVREIISQKMNDDVNSSIFEKTISS 155
           I  ++I ++++      +  + I  
Sbjct: 148 IASKVIEKELSAADQEKLINEYIQE 172


>gi|15828741|ref|NP_326101.1| ATP synthase B chain [Mycoplasma pulmonis UAB CTIP]
 gi|81533023|sp|Q98QU1|ATPF_MYCPU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|14089683|emb|CAC13443.1| ATP SYNTHASE B CHAIN [Mycoplasma pulmonis]
          Length = 180

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 31/147 (21%), Positives = 66/147 (44%), Gaps = 4/147 (2%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    +  I FL    Y  I   +          I+D+I  A +L+++S   L +  +K
Sbjct: 31  ATLAALVISIFFLTYFFYKPIRKNIK----KRKQYIQDNIDAANKLKQQSLENLEESNKK 86

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            ++  E+  EII ++K  A+++      + ++ S   LK  + +I   + E  R    +I
Sbjct: 87  LNEAREQASEIINSSKRDAELIVINYKMSAQKKSEEILKKAQLEIKRKEEEFLRTSREEI 146

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEK 151
            D +  I ++I+ ++++ +    I + 
Sbjct: 147 IDAATIIAKKILIKEIDSNYEKKIIDD 173


>gi|237739743|ref|ZP_04570224.1| ATP synthase subunit B [Fusobacterium sp. 2_1_31]
 gi|262066573|ref|ZP_06026185.1| ATP synthase F0, B subunit [Fusobacterium periodonticum ATCC 33693]
 gi|294783127|ref|ZP_06748451.1| ATP synthase F0, B subunit [Fusobacterium sp. 1_1_41FAA]
 gi|229423351|gb|EEO38398.1| ATP synthase subunit B [Fusobacterium sp. 2_1_31]
 gi|291379708|gb|EFE87226.1| ATP synthase F0, B subunit [Fusobacterium periodonticum ATCC 33693]
 gi|294480005|gb|EFG27782.1| ATP synthase F0, B subunit [Fusobacterium sp. 1_1_41FAA]
          Length = 163

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 75/153 (49%), Gaps = 3/153 (1%)

Query: 7   FLVFMSL-IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  ++  ++  Y + P  +   ++    KI  ++ EA + RE++E +  + + + 
Sbjct: 11  FWQIINFFVLLFIVKKYFKEP--ISKIINERKQKIEAELVEATKNREEAEKLHKEAEAQV 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
               +E  EI+  A+ +A+  A    +   +     L+  E ++  +K + K  L  ++ 
Sbjct: 69  LNSRKEASEIVKNAQRKAEEEAHLLIKEARENRENILRATELEVTKIKNDTKDELGREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + + E+  +II +K++D+  +S+ +K I+ +  
Sbjct: 129 NLAAELAEKIIKEKVDDNQETSLIDKFIAEVGE 161


>gi|296134377|ref|YP_003641624.1| ATP synthase F0, B subunit [Thermincola sp. JR]
 gi|296032955|gb|ADG83723.1| ATP synthase F0, B subunit [Thermincola potens JR]
          Length = 168

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +I L I+  L +   +L  LD     I D I  A   + ++E +  +Y+ + ++
Sbjct: 16  WQIVNFLILLFILNKL-LYKPMLQMLDDRKKSIEDAINSAETAKAEAEALRKEYETRLAE 74

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E ++II  A    + + +E   N ++ +   ++  +++I   K  A   L  ++A  
Sbjct: 75  AKKEAQDIIAKATKLGEEMKKEIVANAQEEANKAIRKAQEEIAREKDAAVAALRDEVATL 134

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V    +++ + ++ + +  + +  +  +   
Sbjct: 135 AVMAAGKVLGKAISVEDHEKLVKDFVQEVGGL 166


>gi|238855951|ref|ZP_04646237.1| ATP synthase F0, B subunit [Lactobacillus jensenii 269-3]
 gi|260664668|ref|ZP_05865520.1| ATP synthase F0, B subunit [Lactobacillus jensenii SJ-7A-US]
 gi|282934358|ref|ZP_06339625.1| ATP synthase F0, B subunit [Lactobacillus jensenii 208-1]
 gi|313471881|ref|ZP_07812373.1| ATP synthase F0, B subunit [Lactobacillus jensenii 1153]
 gi|238831424|gb|EEQ23775.1| ATP synthase F0, B subunit [Lactobacillus jensenii 269-3]
 gi|239529203|gb|EEQ68204.1| ATP synthase F0, B subunit [Lactobacillus jensenii 1153]
 gi|260561733|gb|EEX27705.1| ATP synthase F0, B subunit [Lactobacillus jensenii SJ-7A-US]
 gi|281301568|gb|EFA93845.1| ATP synthase F0, B subunit [Lactobacillus jensenii 208-1]
          Length = 169

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 68/156 (43%), Gaps = 1/156 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           ++  +T    +   I L + V       +   ++    ++ +DI +A   R+K+E +  +
Sbjct: 13  LYLGDTIYYLVLFAILL-LAVKHFAWGPVTDMMEKRRQQVIEDIDKAADERKKAEILAGE 71

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+     +E  +I+  AK  A+   ++      + +    +  +      K +A    
Sbjct: 72  REEQLKSSRQEATQILSTAKTNAEAAGKDILNQANEEAKNIREKAKADAIQAKSDALNEA 131

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++AD SV+I  ++I++ ++      + ++ I  +
Sbjct: 132 QAQVADISVQIAEKVIAKNLSAADQKDLVDQFIKGL 167


>gi|160938929|ref|ZP_02086280.1| hypothetical protein CLOBOL_03823 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437892|gb|EDP15652.1| hypothetical protein CLOBOL_03823 [Clostridium bolteae ATCC
           BAA-613]
          Length = 163

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 66/147 (44%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ L + +   +   + S LD     I  D+ EA+    ++  +  QY+      +EE  
Sbjct: 16  LLVLYLFMKHFLIGPVRSILDERKQMIEHDLDEAKNRETEARQMKEQYQASIGNADEEAS 75

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            II  A++RA    E+        +A  +++ ++ I   + +A   L A +A  ++    
Sbjct: 76  RIIEEARNRAAAEYEKVLAQARADAAKKMEEADRTIALEREKAMNDLKAGVAGLAMTAAA 135

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++IS++   D + +++ + ++     +
Sbjct: 136 KLISEQSAPDGDRNLYNRFLAESGEGN 162


>gi|253580462|ref|ZP_04857727.1| F0F1-type ATP synthase, subunit B [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848192|gb|EES76157.1| F0F1-type ATP synthase, subunit B [Ruminococcus sp. 5_1_39BFAA]
          Length = 169

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 76/165 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           +  +   +  +  +I L +++   +   +L+ ++   + I      A+   E++  +  +
Sbjct: 5   IEININLVFTIINLIVLYLLMKKFLFGPILNVMEQRKNMIDQQFASAKDTEEQAYELKGK 64

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y++     ++E+  I+  AK  AK+ AE   ++    +   L   +  I   +  A + +
Sbjct: 65  YEDALKSAKDESMRIVNQAKDEAKVQAERIVKDANTQAGAMLDKAKADIRTEQENAMKAM 124

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKN 165
            +++A+ +++   +I+ +K +   + S++++ I      +  +K+
Sbjct: 125 ESRVAEIALDAASKIMGEKNSSQQDLSLYDQFIKEAGDSNDGNKH 169


>gi|34763446|ref|ZP_00144393.1| ATP synthase B chain, sodium ion specific [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|237742364|ref|ZP_04572845.1| ATP synthase subunit B [Fusobacterium sp. 4_1_13]
 gi|256845692|ref|ZP_05551150.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_36A2]
 gi|294785061|ref|ZP_06750349.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_27]
 gi|27886887|gb|EAA24012.1| ATP synthase B chain, sodium ion specific [Fusobacterium nucleatum
           subsp. vincentii ATCC 49256]
 gi|229430012|gb|EEO40224.1| ATP synthase subunit B [Fusobacterium sp. 4_1_13]
 gi|256719251|gb|EEU32806.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_36A2]
 gi|294486775|gb|EFG34137.1| ATP synthase F0, B subunit [Fusobacterium sp. 3_1_27]
          Length = 163

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 76/153 (49%), Gaps = 3/153 (1%)

Query: 7   FLVFMSLIIFLVIVV-YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F   ++  + L IV  Y + P  +   ++    KI  ++ EA + +++SE +L   + + 
Sbjct: 11  FWQIINFFLLLFIVKKYFKEP--ISKIINERKQKIEAELVEATKNKKESEQLLKNAEAQI 68

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +   +E  EI+ AA+ +A+  A    +   +     LK  E ++  +K +AK  L  ++ 
Sbjct: 69  NISRKEAIEIVKAAQRKAEEEAHNLIKEARENRENILKTTELEVTKIKNDAKEELGREVK 128

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + + E+  +II +K++D    S+ +K I+ +  
Sbjct: 129 NLAAELAEKIIKEKVDDAQEISLIDKFIAEVGE 161


>gi|229076524|ref|ZP_04209484.1| ATP synthase B chain [Bacillus cereus Rock4-18]
 gi|229099742|ref|ZP_04230667.1| ATP synthase B chain [Bacillus cereus Rock3-29]
 gi|229105902|ref|ZP_04236526.1| ATP synthase B chain [Bacillus cereus Rock3-28]
 gi|229118805|ref|ZP_04248154.1| ATP synthase B chain [Bacillus cereus Rock1-3]
 gi|228664606|gb|EEL20099.1| ATP synthase B chain [Bacillus cereus Rock1-3]
 gi|228677476|gb|EEL31729.1| ATP synthase B chain [Bacillus cereus Rock3-28]
 gi|228683631|gb|EEL37584.1| ATP synthase B chain [Bacillus cereus Rock3-29]
 gi|228706557|gb|EEL58770.1| ATP synthase B chain [Bacillus cereus Rock4-18]
          Length = 168

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/146 (15%), Positives = 62/146 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + +  +I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTSEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           ++I +++ ++    +    I  +   
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEA 167


>gi|323345606|ref|ZP_08085829.1| ATP synthase F0 sector subunit B [Prevotella oralis ATCC 33269]
 gi|323093720|gb|EFZ36298.1| ATP synthase F0 sector subunit B [Prevotella oralis ATCC 33269]
          Length = 172

 Score = 68.8 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 70/158 (44%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F++ ++   ++     P+I+   ++     I D + +A    E+ +NI  +      
Sbjct: 16  FWMFLAFLVVFGVLATFGFPAII-KMVEGRKQYIDDSLRKAHEASERLDNIKQEGDAILQ 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  ++I  A      + E+      + SA  + D + +I   K  A R +  ++A+
Sbjct: 75  EAREKQAQVINEAAVTRDAIVEKAQAKAHEESARIISDAKAQIENDKQNAVRDIRTQVAE 134

Query: 127 FSVEIVREIISQKMND-DVNSSIFEKTISSIQSCHQMD 163
            S++I   I+ +K++  D+   + ++ +  +      D
Sbjct: 135 LSIQIAENILREKLSSNDMQMEMIDRLLDEVSKGKNKD 172


>gi|295104095|emb|CBL01639.1| ATP synthase F0 subcomplex B subunit [Faecalibacterium prausnitzii
           SL3/3]
          Length = 168

 Score = 68.8 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 69/155 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TFL  +  ++  +++    +   +   +     K   +I +A++LR ++E +  +Y++  
Sbjct: 14  TFLAQICNLMIQLVIFKKFLLKPIKQVIADRKAKADSEIADAQKLRTEAEAMKAEYEQNL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +I+  A+  A   +EE        +A   +  E  I   + +A   +  +I 
Sbjct: 74  QNARTEANQIVATAQKTATARSEEIVGEARAQAAALKQKAEADIAQERKKAVNEVKDEIG 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             ++EI  +++ +++++  +  + ++ I ++    
Sbjct: 134 GIAMEIASKVVEREISEKDHKDLIDEFIKNVGEAS 168


>gi|160890318|ref|ZP_02071321.1| hypothetical protein BACUNI_02759 [Bacteroides unif