BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B
[Candidatus Liberibacter asiaticus str. psy62]
         (173 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040762|gb|ACT57558.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 173

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 173/173 (100%), Positives = 173/173 (100%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ
Sbjct: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL
Sbjct: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ 173
           YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ
Sbjct: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLGSQ 173


>gi|153007848|ref|YP_001369063.1| F0F1 ATP synthase subunit B [Ochrobactrum anthropi ATCC 49188]
 gi|226694417|sp|A6WW80|ATPF2_OCHA4 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|151559736|gb|ABS13234.1| ATP synthase F0, B subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 159

 Score = 98.3 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 92/158 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              D +V    +I++ K++  V  ++F+  +S ++S  
Sbjct: 121 SAVDLAVAAAGKIVADKVDTKVAGNLFKDALSQVKSNL 158


>gi|296120445|ref|YP_003628223.1| ATP synthase F0 subunit beta [Planctomyces limnophilus DSM 3776]
 gi|296012785|gb|ADG66024.1| ATP synthase F0, B subunit [Planctomyces limnophilus DSM 3776]
          Length = 238

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 70/154 (45%), Gaps = 1/154 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D      ++ + F+ ++        L + LD    +IR+DI EA   R K++ +L +++ 
Sbjct: 82  DLMVWSLITFVAFVFLLSKF-AWKPLAAGLDQREARIRNDIQEAESARLKAQQLLAEHEA 140

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + +K EE  RE+I  AK  A+ +  +     E       K    +I   +  A + L+  
Sbjct: 141 RLAKTEETVRELIAEAKRDAEKVRVDLTAAAEADVQTMKKRAVSEIEQARDVALQQLFDT 200

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           ++   ++    I+ + +N D +  + ++ ++ + 
Sbjct: 201 LSTHVMDATSRIVGRSLNSDDHQRLVQEALAELN 234


>gi|194335033|ref|YP_002016893.1| F0F1 ATP synthase subunit B [Prosthecochloris aestuarii DSM 271]
 gi|226694419|sp|B4S6E4|ATPF2_PROA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|194312851|gb|ACF47246.1| ATP synthase F0, B subunit [Prosthecochloris aestuarii DSM 271]
          Length = 175

 Score = 97.2 bits (240), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        +L  L+     I+  I  A   ++++E  L + KE  +
Sbjct: 22  FWTAVTFVIVLLIL-KKFAWGPILGALEEREKAIQSSIDRAHTAKDEAEAALRKNKELLT 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E  +I+   K   + L  +  +     +   +   +++I   K  A   L  ++AD
Sbjct: 81  KADAEAEKILREGKEYGEKLRADIVEKAHSEATKMISSAKEEIEQEKRRALDELRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +V+   +I+   ++ D   +I    I  +
Sbjct: 141 LAVQGAEKILMANLDADKQKAIVSSMIQDL 170


>gi|83815076|ref|YP_445047.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855]
 gi|83756470|gb|ABC44583.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855]
          Length = 204

 Score = 97.2 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +IFL I+        +   L+   ++I   I  A    E+++ I  + +E   
Sbjct: 53  FWKTVAFLIFLYILYRFG-WGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEEARR 111

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + E++ ++I+  A+  A+ L EE      +      +  + +I   K  A + L  ++AD
Sbjct: 112 EAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDEVAD 171

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++E  ++II   ++ D +  + +  +    + 
Sbjct: 172 LAIEAAQKIIENDLDADRHRQLVDDALDDFPTN 204


>gi|78187938|ref|YP_375981.1| ATP synthase F0, subunit B [Chlorobium luteolum DSM 273]
 gi|123582422|sp|Q3B143|ATPF2_PELLD RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|78167840|gb|ABB24938.1| ATP synthase F0 subcomplex B subunit [Chlorobium luteolum DSM 273]
          Length = 175

 Score = 97.2 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ ++ L+I+        ++S L+     I+  I  A   +E+SE IL Q +E  +
Sbjct: 22  FWTTITFVLVLIIL-KKIAWGPIISALEEREKGIQSSIDRAHGAKEESEAILRQNRELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E   +I   +  A+ +  E  +   Q S   +   +++I   K  A   L  ++AD
Sbjct: 81  KADAEADRVIREGREYAEKIRAEITEKAHQESQKMISAAKEEIEQEKRRALAELRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V    +II   ++ DV   + +  I  + +  
Sbjct: 141 LAVRGAEKIIRGVLDADVQKKVVDSMIQDLSTNR 174


>gi|148559545|ref|YP_001258412.1| F0F1 ATP synthase subunit B [Brucella ovis ATCC 25840]
 gi|226694384|sp|A5VNW5|ATPF2_BRUO2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|148370802|gb|ABQ60781.1| ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
          Length = 159

 Score = 97.2 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKCKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|189501405|ref|YP_001960875.1| F0F1 ATP synthase subunit B [Chlorobium phaeobacteroides BS1]
 gi|226741336|sp|B3EQ96|ATPF_CHLPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189496846|gb|ACE05394.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides BS1]
          Length = 175

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L I+        +LS L+     I++ I  A+  +E++E +L + ++  +
Sbjct: 22  FWTTVTFLIVLFIL-KKFTWGPMLSALEEREKGIKNSIDRAQSAKEEAEAVLNKNRQLLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +  +II   K     L  E  +     ++  +   + +I   K  A   L  ++AD
Sbjct: 81  QAGADADKIIREGKEYGDKLKAEITEKAHLEASRMISSAKDEIDQEKRRALTELRTEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +V+   +II   ++ +   +I +  I  +
Sbjct: 141 LAVKGAEKIIMANLDAEKQKNIVDSMIQEL 170


>gi|254510893|ref|ZP_05122960.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
 gi|221534604|gb|EEE37592.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
          Length = 186

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 81/157 (51%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  I+F+ I+ Y ++P ++   LD  A+ I+ ++ EAR L E++ ++L  Y+ 
Sbjct: 29  NTDFVVLLGFIVFIAILFYFKVPGMIGGALDKRAEGIQSELDEARALHEEARSLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ AAK  A + AE+   ++E+  A  L   + +I   +  A + +  +
Sbjct: 89  KQREVQTQADAIVAAAKEDAALAAEQAKADLEKSIARRLAAAQDQIASAEASAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V     +++++M     + + + +I+ +    
Sbjct: 149 AITVAVSAANAVLAKQMTATQANKLIDASIADVGEKL 185


>gi|110598590|ref|ZP_01386858.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031]
 gi|110339824|gb|EAT58331.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031]
          Length = 175

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        +L+ L+     I+  I  A   ++++E  L +  E  +
Sbjct: 22  FWTAVTFVIVLLIL-KKVAWGPILTALEEREKGIQSSIDRAYHAKDEAEAALRKNSELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +II   K  A  L  +  +  +  +   +   + +I   K  A   L  ++AD
Sbjct: 81  KADAESDKIIREGKDFADKLRTDITEKAQAEAQKMISMAKDEIEQEKRRALNELRTEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V+   +II   ++ D+   I +  I    +  
Sbjct: 141 LAVKGAEKIIRGSLDADLQKKIVDSMIQDFSTKR 174


>gi|239831261|ref|ZP_04679590.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301]
 gi|239823528|gb|EEQ95096.1| ATP synthase F0, B subunit [Ochrobactrum intermedium LMG 3301]
          Length = 159

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 93/158 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LIIFL I+ YL++P ++   LD  AD+I++++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWALIGLIIFLAILAYLKVPGMVGRSLDERADRIKNELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L E+  +  E+  A   K  EQKI   +++A   + A
Sbjct: 61  RKRKEAEKEASDIVASAEREAKALLEDAKRATEEYVARRNKLAEQKIATAEVDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              D +V    +I+++K++  V  ++F+  +S +++  
Sbjct: 121 SAVDLAVAAAGKIVAEKVDAKVAGNLFKDALSQVKTNL 158


>gi|226694486|sp|Q0A4M4|ATPF_ALHEH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 156

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F  TF   M      V      +   + + +     +I D +    R +++ +    +
Sbjct: 1   MNFGATFWGPMISFALFVWFTMKYVWPPIQTAMADRQKQIADGLAAGERGQKELDQAKSE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   +  E+  ++I  A  R   L E+  +   Q +   L     +I     +A+  L
Sbjct: 61  VDKMLREAREQASQVIAQANKRQSELVEQAREEARQEAERVLAQARSEIDTEISQARDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++ + +V     I+ ++++   +  + +  +  +
Sbjct: 121 RKEVVNLAVAGSSRILKREIDAKAHKDLIDDLVKQL 156


>gi|62289375|ref|YP_221168.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 1 str. 9-941]
 gi|82699300|ref|YP_413874.1| F0F1 ATP synthase subunit B [Brucella melitensis biovar Abortus
           2308]
 gi|189023628|ref|YP_001934396.1| F0F1 ATP synthase subunit B [Brucella abortus S19]
 gi|237814862|ref|ZP_04593860.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A]
 gi|254688690|ref|ZP_05151944.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|254693173|ref|ZP_05155001.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|254696817|ref|ZP_05158645.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|254729724|ref|ZP_05188302.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|256256937|ref|ZP_05462473.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260545872|ref|ZP_05821613.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260754166|ref|ZP_05866514.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757386|ref|ZP_05869734.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761210|ref|ZP_05873553.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883191|ref|ZP_05894805.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213413|ref|ZP_05927694.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|297247788|ref|ZP_06931506.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196]
 gi|123546349|sp|Q2YMC4|ATPF2_BRUA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|226694382|sp|B2S9N1|ATPF2_BRUA1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|62195507|gb|AAX73807.1| AtpF, ATP synthase F0, B subunit [Brucella abortus bv. 1 str.
           9-941]
 gi|82615401|emb|CAJ10370.1| H+-transporting two-sector ATPase, B/B' subunit:ATP synthase F0,
           subunit B [Brucella melitensis biovar Abortus 2308]
 gi|189019200|gb|ACD71922.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|237789699|gb|EEP63909.1| ATP synthase F0, B subunit [Brucella abortus str. 2308 A]
 gi|260097279|gb|EEW81154.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260667704|gb|EEX54644.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671642|gb|EEX58463.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674274|gb|EEX61095.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872719|gb|EEX79788.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915020|gb|EEX81881.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|297174957|gb|EFH34304.1| ATP synthase F0, B subunit [Brucella abortus bv. 5 str. B3196]
          Length = 159

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++   + ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKADGNLFNDALAQVKS 156


>gi|23501289|ref|NP_697416.1| F0F1 ATP synthase subunit B [Brucella suis 1330]
 gi|161618361|ref|YP_001592248.1| F0F1 ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|254703742|ref|ZP_05165570.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|260567003|ref|ZP_05837473.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|261754387|ref|ZP_05998096.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|81753122|sp|Q8G2D8|ATPF2_BRUSU RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|226694383|sp|A9M8G1|ATPF2_BRUC2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|23347177|gb|AAN29331.1| ATP synthase F0, B subunit [Brucella suis 1330]
 gi|161335172|gb|ABX61477.1| ATP synthase F0, B subunit [Brucella canis ATCC 23365]
 gi|260156521|gb|EEW91601.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|261744140|gb|EEY32066.1| F0F1 ATP synthase subunit B [Brucella suis bv. 3 str. 686]
          Length = 159

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 51/156 (32%), Positives = 92/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+VIVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVVIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|145220542|ref|YP_001131251.1| ATP synthase F0, B subunit [Prosthecochloris vibrioformis DSM 265]
 gi|226694438|sp|A4SGZ0|ATPF_PROVI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145206706|gb|ABP37749.1| ATP synthase F0 subcomplex B subunit [Chlorobium phaeovibrioides
           DSM 265]
          Length = 175

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 67/152 (44%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ ++ L+I+        +L  L+     I+  I  A   +E++E IL Q KE  +
Sbjct: 22  FWTAITFVLVLLIL-KKIAWGPILGALEEREKGIQSSIDRAYGAKEEAEAILRQNKETLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K E E+  II   +  A  +  E  +     S   +   + +I   K  A  +L  ++AD
Sbjct: 81  KAEAESDRIIREGREFADKIRAEITEKAHTESQKMIGAAKDEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +V    +II   ++ +V   + +  I+ + +
Sbjct: 141 LAVRGAEKIIRASLDGEVQRKVVDSMIADLST 172


>gi|163744747|ref|ZP_02152107.1| ATP synthase F0, B subunit [Oceanibulbus indolifex HEL-45]
 gi|161381565|gb|EDQ05974.1| ATP synthase F0, B subunit [Oceanibulbus indolifex HEL-45]
          Length = 190

 Score = 95.3 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 90/157 (57%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P++L+  LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 33  NTDFIVLLAFLLFIGILIYFKVPTLLIGMLDKRADGIKTELEEARALREEAQTLLASYER 92

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           KH +V+++   I+ +AK  A++ AE+   ++ +     +   + +I   +  A + +  +
Sbjct: 93  KHKEVQDQADRIVSSAKEDARLAAEQARADMAKSLDRRMAAAKDQISSAEAAAVKEVRDQ 152

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V   R++I+++M     + + +  I+ +++  
Sbjct: 153 AVTIAVAAARDVIAKQMTAAQGNKLIDDGIAQVEAKL 189


>gi|304391258|ref|ZP_07373202.1| ATP synthase B chain [Ahrensia sp. R2A130]
 gi|303296614|gb|EFL90970.1| ATP synthase B chain [Ahrensia sp. R2A130]
          Length = 161

 Score = 95.3 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 50/158 (31%), Positives = 90/158 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD +F   ++LI+F  ++VYL++P ++   LD  ADKI+ D+ EAR+LRE+++ +L +
Sbjct: 1   MSFDASFWALVALILFFALLVYLKVPGVVSKALDGRADKIKSDLEEARKLREEAQQLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E  EI+ AAK  A  L EE                EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEASEIVAAAKREADALREEAELKTADYVTRRTAQAEQKIAQAESQAMAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +   D +++  R+IIS K+    ++ +F+++++ +++
Sbjct: 121 KSTAVDLAMDAARDIISSKVTGKASTDMFKQSLAEVKA 158


>gi|161511127|ref|NP_540460.2| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|163842669|ref|YP_001627073.1| F0F1 ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|225626900|ref|ZP_03784939.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo]
 gi|225851925|ref|YP_002732158.1| F0F1 ATP synthase subunit B [Brucella melitensis ATCC 23457]
 gi|254701197|ref|ZP_05163025.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|254707878|ref|ZP_05169706.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|254709538|ref|ZP_05171349.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|254713045|ref|ZP_05174856.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|254716602|ref|ZP_05178413.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|254718569|ref|ZP_05180380.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|256031032|ref|ZP_05444646.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|256044107|ref|ZP_05447018.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060524|ref|ZP_05450693.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|256112905|ref|ZP_05453821.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|256159090|ref|ZP_05456916.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|256254435|ref|ZP_05459971.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|256264563|ref|ZP_05467095.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368841|ref|YP_003106347.1| ATP synthase subunit B [Brucella microti CCM 4915]
 gi|260168164|ref|ZP_05754975.1| F0F1 ATP synthase subunit B [Brucella sp. F5/99]
 gi|260563466|ref|ZP_05833952.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|261218401|ref|ZP_05932682.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261221603|ref|ZP_05935884.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315369|ref|ZP_05954566.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317064|ref|ZP_05956261.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261320750|ref|ZP_05959947.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|261324518|ref|ZP_05963715.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751734|ref|ZP_05995443.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261757622|ref|ZP_06001331.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265983544|ref|ZP_06096279.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|265988102|ref|ZP_06100659.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265990519|ref|ZP_06103076.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994347|ref|ZP_06106904.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|265997567|ref|ZP_06110124.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851768|ref|ZP_06792441.1| ATP synthase F0 [Brucella sp. NVSL 07-0026]
 gi|306837306|ref|ZP_07470189.1| ATP synthase F0, B subunit [Brucella sp. NF 2653]
 gi|226694369|sp|B0CK73|ATPF2_BRUSI RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|163673392|gb|ABY37503.1| ATP synthase F0, B subunit [Brucella suis ATCC 23445]
 gi|225618557|gb|EEH15600.1| ATP synthase F0, B subunit [Brucella ceti str. Cudo]
 gi|225640290|gb|ACO00204.1| ATP synthase F0, B subunit [Brucella melitensis ATCC 23457]
 gi|255998999|gb|ACU47398.1| ATP synthase subunit B [Brucella microti CCM 4915]
 gi|260153482|gb|EEW88574.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 1 str.
           16M]
 gi|260920187|gb|EEX86840.1| F0F1 ATP synthase subunit B [Brucella ceti B1/94]
 gi|260923490|gb|EEX90058.1| F0F1 ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293440|gb|EEX96936.1| F0F1 ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|261296287|gb|EEX99783.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300498|gb|EEY03995.1| F0F1 ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304395|gb|EEY07892.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737606|gb|EEY25602.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741487|gb|EEY29413.1| F0F1 ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|262552035|gb|EEZ08025.1| F0F1 ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|262765460|gb|EEZ11249.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001303|gb|EEZ13878.1| F0F1 ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094928|gb|EEZ18636.1| H+-transporting two-sector ATPase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660299|gb|EEZ30560.1| F0F1 ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|264662136|gb|EEZ32397.1| F0F1 ATP synthase subunit B [Brucella sp. 83/13]
 gi|294820357|gb|EFG37356.1| ATP synthase F0 [Brucella sp. NVSL 07-0026]
 gi|306407619|gb|EFM63815.1| ATP synthase F0, B subunit [Brucella sp. NF 2653]
 gi|326408424|gb|ADZ65489.1| F0F1 ATP synthase subunit B [Brucella melitensis M28]
 gi|326538138|gb|ADZ86353.1| ATP synthase F0, B subunit [Brucella melitensis M5-90]
          Length = 159

 Score = 94.9 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMIGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|300024395|ref|YP_003757006.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526216|gb|ADJ24685.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 163

 Score = 94.9 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 84/154 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F V ++ + F+ +V+Y R+P+++   LD  AD IR ++ EAR+LRE ++ +L  Y+ 
Sbjct: 6   NPLFWVLLAFLTFIALVLYYRVPALIGKMLDDRADAIRKELDEARKLREDAQALLADYQR 65

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  + E E R II  AK  A+ LA +  +++ +      K  E+KI   + +A   + A 
Sbjct: 66  KAREAENEARSIIDQAKREAEALAVDARKSLAESLERRSKIAEEKIARAETQALSEVRAT 125

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
             D ++    E++  + +  V  S+  ++IS ++
Sbjct: 126 AVDTAISAAHELLKTRASGSVGDSLITQSISDLR 159


>gi|306842324|ref|ZP_07474983.1| ATP synthase F0, B subunit [Brucella sp. BO2]
 gi|306287540|gb|EFM58999.1| ATP synthase F0, B subunit [Brucella sp. BO2]
          Length = 159

 Score = 94.9 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 50/156 (32%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMVGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              D +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVDLAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|119358471|ref|YP_913115.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides DSM 266]
 gi|226741357|sp|A1BJW4|ATPF_CHLPD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119355820|gb|ABL66691.1| ATP synthase F0 subcomplex B subunit [Chlorobium phaeobacteroides
           DSM 266]
          Length = 175

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 71/154 (46%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +S +I L+I+        ++S L+     I+  I  A + ++++E IL + +E  +
Sbjct: 22  FWTTVSFVIVLLIL-RKLAWGPIISALEEREKGIQSSIDRAHKAKDEAEEILRKNRELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +II   K   + L     +  +  +A  +   +++I   K  A  +L  ++A+
Sbjct: 81  KADAESDKIIREGKEYGEKLRAGIAEKAQAEAAKMISMAKEEIEQEKRRALDVLRNEVAE 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V    +II   ++ D+   I +  I  + +  
Sbjct: 141 LAVMGAEKIIKTSLDADMQKKIVDSMIQDLSTKR 174


>gi|189347958|ref|YP_001944487.1| F0F1 ATP synthase subunit B [Chlorobium limicola DSM 245]
 gi|226741334|sp|B3EIJ6|ATPF_CHLL2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189342105|gb|ACD91508.1| ATP synthase F0, B subunit [Chlorobium limicola DSM 245]
          Length = 175

 Score = 94.1 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        ++S L+     I+  I  A   ++++E IL + ++  +
Sbjct: 22  FWTAVTFVIVLLIL-KQLAWGPIISALEEREKGIQSSIDRAYSAKDEAEAILRKNRDMLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+  II   K   + L +E  +  +  +   +   + +I   K  A  +L  ++AD
Sbjct: 81  KADLESERIIREGKEYGEKLRQEMAEKAQFEAKKMIASAKDEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++    +II   ++ D    I +  I  + S  
Sbjct: 141 LAIMGAEKIIKSSLDADTQKKIVDSMIRDLASKR 174


>gi|306845019|ref|ZP_07477600.1| ATP synthase F0, B subunit [Brucella sp. BO1]
 gi|306274651|gb|EFM56440.1| ATP synthase F0, B subunit [Brucella sp. BO1]
          Length = 159

 Score = 93.7 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 49/156 (31%), Positives = 91/156 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F++L+IF+ IVVY+++P ++   LD  AD+I+ ++ EAR LRE+++ +L +Y 
Sbjct: 1   MDATFWAFIALVIFVAIVVYMKVPGMVGRTLDERADRIKKELEEARTLREEAQQLLAEYH 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E  +I+ +A+  AK L EE  +  E+  A   K  EQKI   + +A   + A
Sbjct: 61  RKRKEAEKEAGDIVASAEREAKALLEEAKRATEEYVARRNKLAEQKIATAETDAINAVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              + +V     I+++K++     ++F   ++ ++S
Sbjct: 121 SAVELAVAAAGSILAEKVDAKAAGNLFNDALAQVKS 156


>gi|194337849|ref|YP_002019643.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1]
 gi|226694332|sp|B4SH38|ATPF_PELPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|194310326|gb|ACF45026.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1]
          Length = 175

 Score = 93.7 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 69/154 (44%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        ++  L+     I+  I  A   +E+SE IL + +E  +
Sbjct: 22  FWTAITFVIVLLIL-KKIAWGPIIGALEEREKGIQSSIDRAHSAKEESEAILRKNRELLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +II   K  A  L  +  +  +  +   +   + +I   K  A  +L  ++AD
Sbjct: 81  KADAESDKIIREGKDYADKLRADITEKAQSEAKKMIATAKDEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V+   +II   ++ D+   I +  I  + +  
Sbjct: 141 LAVKGAEKIIKTTLDADMQKKIVDSMIQDLSTKR 174


>gi|153007322|ref|YP_001381647.1| ATP synthase F0 subunit B [Anaeromyxobacter sp. Fw109-5]
 gi|226741090|sp|A7HIW7|ATPF_ANADF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|152030895|gb|ABS28663.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 175

 Score = 93.7 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ L ++        ++  L      IR+ I  A+R R ++E +L + K   
Sbjct: 20  TLWTGITFLVLLFVLGKF-AWGPIVKMLAERERTIREAIDSAKRERTEAERLLAEQKALL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            K   E  E+    +   + + +E      + +   +    ++I   K +A   L A +A
Sbjct: 79  GKAAREAAELARRNQQEVEAMRQELTARARKEADDLVATARKQIEEEKTKAMSELRAVVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           D +++    ++   ++D     + E  I+ + +  
Sbjct: 139 DLAIDAASRLVKANLDDASQRKLVEDYIAQLPANR 173


>gi|226741485|sp|A1WZT5|ATPF_HALHL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 156

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F  TF   M      V      +   +   L     +I D +    R +E+ +    +
Sbjct: 1   MNFGATFWGPMISFALFVWFTMKFVWPPIQQALADRQKQIADGLAAGERGKEELDKAQAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +       E+  +II  A  R   + EE        +   L    ++I      A+  L
Sbjct: 61  VEAMLRDAREQASQIINQANKRQAEMIEEARAEARSEADRILASAREEIDQEIQRAREDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V+   +I+ ++++   +  + ++  + I
Sbjct: 121 RKQVSTIAVQASSQILKREVDAKAHKDLIDELATQI 156


>gi|330991389|ref|ZP_08315340.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
 gi|329761408|gb|EGG77901.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
          Length = 164

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 75/160 (46%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D  F   ++ ++F V+     +   L+S LD  A++IR ++ EA RLR ++E +L  
Sbjct: 1   MFHDPRFWSAVAFVLFFVLFGR-SLWKPLVSALDGRAERIRAELDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                     E RE++  +   A  +A +  ++ E  +A   +  + +I   +  A R +
Sbjct: 60  ATRDREAALAEARELVEHSLREAANIAAQARKDAEDAAARREQMAKDRIASAERSALREV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
                D +++  RE ++ K+  D +  I +++I  + +  
Sbjct: 120 RETAVDIAIQATRETLAAKLQADDDGKIVDRSIGDLSAAL 159


>gi|149915445|ref|ZP_01903972.1| ATP synthase F0, B subunit [Roseobacter sp. AzwK-3b]
 gi|149810734|gb|EDM70575.1| ATP synthase F0, B subunit [Roseobacter sp. AzwK-3b]
          Length = 184

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 41/157 (26%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ I++Y ++PS+L   LD  A+ I+ ++ EAR LR++++ +L  Y+ 
Sbjct: 27  NTDFVVTLGFLVFIGILLYFKVPSLLGGLLDKRAEGIKSELDEARALRDEAQTLLAGYER 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E++  II AAK  A   AE+  Q+++      LK  E +I   +  A R +  +
Sbjct: 87  KQKEVQEQSERIIAAAKQEAAEAAEQAKQDLKASIKRRLKAAEDQIASAEANAIRDVRNE 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V    ++I++ M     + + +  I  + +  
Sbjct: 147 AIRIAVAAATDVIAKNMTAADGNKLIDDAIGQVDAKL 183


>gi|260906203|ref|ZP_05914525.1| ATP synthase F0, B subunit [Brevibacterium linens BL2]
          Length = 183

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/152 (14%), Positives = 68/152 (44%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+I  ++V    +P      LD  A++I+  I +A +++ +++  L +Y+++ + 
Sbjct: 23  WSAICLLIVFLVVWKYVLP-AFNKTLDERAERIQGGIEKAEKVQAEADEALAEYQKQLAD 81

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+     +           S   +   + +I   +  A   L +++   
Sbjct: 82  GRAEAARLRAEAQEEGAQIIANMKTQAHAESERIVAQAQTQIEAERQSAMVQLRSEVGTL 141

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           + ++   I+ + + +D  ++++ ++ I+ ++S
Sbjct: 142 ATDLASRIVGESLTDDQRSANVVDRFITDLES 173


>gi|150395675|ref|YP_001326142.1| F0F1 ATP synthase subunit B [Sinorhizobium medicae WSM419]
 gi|226695843|sp|A6U6M7|ATPF_SINMW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150027190|gb|ABR59307.1| ATP synthase F0, B subunit [Sinorhizobium medicae WSM419]
          Length = 161

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/160 (30%), Positives = 89/160 (55%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+F V++ YL++P ++   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAASIVAAAQREAEMLTAEAKQKTEEFVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            A   D ++    ++I+ K +     ++F+K +  ++S  
Sbjct: 121 RAAAVDLAISAAEKVIASKADASAQETLFQKALGEVKSRL 160


>gi|134300985|ref|YP_001114481.1| ATP synthase F0 subunit B [Desulfotomaculum reducens MI-1]
 gi|226741433|sp|A4J9A3|ATPF_DESRM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|134053685|gb|ABO51656.1| ATP synthase F0 subcomplex B subunit [Desulfotomaculum reducens
           MI-1]
          Length = 189

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 66/155 (42%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F+ T L  M   + L+I++        ++ L+   + I   I  A   ++++E +    +
Sbjct: 31  FNGTLLAQMFNFLVLLILLRAVAYKPFMNMLEKRRELIEGSIAAAEEDKKQAEQLRATLQ 90

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
               +  E+  E++  A   A+  A++  +  +  +A        +I   K  A   L  
Sbjct: 91  ADLQRSREQATEMMARATKNAEEQAQQIIEAAKAEAARVKDSALSEIQREKERAVAELRD 150

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           ++A  S+ +  +II QK+NDDV   +  K +    
Sbjct: 151 QVATLSILVAGKIIDQKLNDDVQKDLVNKFVKEAG 185


>gi|294506921|ref|YP_003570979.1| ATP synthase B chain [Salinibacter ruber M8]
 gi|294343249|emb|CBH24027.1| ATP synthase B chain [Salinibacter ruber M8]
          Length = 194

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +IFL I+        +   L+   ++I   I  A    E+++ I  + +E   
Sbjct: 43  FWKTVAFLIFLYILYRFG-WGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEEARR 101

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + E++ ++I+  A+  A+ L EE      +      +  + +I   K  A + L  ++AD
Sbjct: 102 EAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDEVAD 161

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++E  ++II   ++ D +  + +  +    + 
Sbjct: 162 LAIEAAQKIIENDLDADRHRQLVDDALDDFPTN 194


>gi|254491191|ref|ZP_05104372.1| ATP synthase F0, B subunit [Methylophaga thiooxidans DMS010]
 gi|224463704|gb|EEF79972.1| ATP synthase F0, B subunit [Methylophaga thiooxydans DMS010]
          Length = 156

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M      V      +   ++  L+    KI D +  A R R + E    +
Sbjct: 1   MNINATLIGQMIAFAVFVAFCMKYVWPPIMQALEERKKKIADGLAAAERGRHEQELAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++   + +++  +II  A+ R   + +E   N        L   + +I      A+  L
Sbjct: 61  AQQVIHEAKDQANDIISQAQKRGNEIVDESKDNARVEGERILNSAKAEIDQEANRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++   ++    +I+ +++++  ++ + ++ +S I
Sbjct: 121 KTQVGGIALAGAGKILGREIDEKAHTDLLDELVSRI 156


>gi|78188050|ref|YP_378388.1| F0F1 ATP synthase subunit B [Chlorobium chlorochromatii CaD3]
 gi|123579103|sp|Q3ANW4|ATPF_CHLCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78170249|gb|ABB27345.1| ATP synthase F0 subcomplex B subunit [Chlorobium chlorochromatii
           CaD3]
          Length = 175

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 70/154 (45%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L+I+        ++  L+     I+  I  A + ++++E IL + +E  S
Sbjct: 22  FWTAITFVIVLLIL-KKIAWGPIIGALEEREKGIQSSIDRAEKAKDEAEAILRKNRELLS 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E+ +I+   K  A+ L  +  +     +A  +   +++I   K  A  +L  ++AD
Sbjct: 81  KADAESEKIVREGKEYAEKLRTDITEKAHTEAAKMIASAKEEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V     II + +N D+   +    I  + S  
Sbjct: 141 LAVLGAERIIRESLNADMQKKVVASMIQDMSSKR 174


>gi|94501606|ref|ZP_01308123.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65]
 gi|94426289|gb|EAT11280.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65]
          Length = 156

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +    F V   +  +   L++ +   A KI D +  A R     +    +
Sbjct: 1   MNINLTLIGQIIAFAFFVAFCWKFVWPPLMNAMQERAKKIADGLDAANRADRDLKLAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  + +E+  +II  A  RA  + +E      Q         + +I      AK  L
Sbjct: 61  AGSQLREAKEQAAQIIEQANKRANQIIDEAKDAAHQEGERLKAAAQAEIDQEVNRAKETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +++++ +V    +I+   ++ + ++++ +K    +
Sbjct: 121 RSQVSELAVAGASKILETSIDVEKHNALLDKLAEEL 156


>gi|15964591|ref|NP_384944.1| F0F1 ATP synthase subunit B [Sinorhizobium meliloti 1021]
 gi|307309337|ref|ZP_07589000.1| ATP synthase F0, B subunit [Sinorhizobium meliloti BL225C]
 gi|307320073|ref|ZP_07599494.1| ATP synthase F0, B subunit [Sinorhizobium meliloti AK83]
 gi|81635005|sp|Q92RM5|ATPF_RHIME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15073769|emb|CAC45410.1| Probable ATP synthase B chain transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|306894288|gb|EFN25053.1| ATP synthase F0, B subunit [Sinorhizobium meliloti AK83]
 gi|306900206|gb|EFN30824.1| ATP synthase F0, B subunit [Sinorhizobium meliloti BL225C]
          Length = 161

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/160 (30%), Positives = 89/160 (55%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+F V++ YL++P ++   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFFVLIAYLKVPGMVGKALDARADKISNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E+  A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAASIVAAAQREAEMLTAEAKQKTEEYVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            A   D ++    ++++ K +     ++F+K I  +++  
Sbjct: 121 RAAAVDLAISAAEKVLASKADAGAQETLFKKAIGEVKARL 160


>gi|116333892|ref|YP_795419.1| F0F1 ATP synthase subunit B [Lactobacillus brevis ATCC 367]
 gi|122269421|sp|Q03QY4|ATPF_LACBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116099239|gb|ABJ64388.1| F0F1-type ATP synthase, subunit b [Lactobacillus brevis ATCC 367]
          Length = 171

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 63/148 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L+ ++ +     +   +   ADKI +DI  A + R  +  ++ + +   +    E +
Sbjct: 23  FLLLMWIIKVLAWKPVTKMMQDRADKISNDIDSAEKSRNDAAELVQKRQAALASSRSEAQ 82

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            I+  AK   +   E+     +       ++ ++ I   + +A       +AD S+EI  
Sbjct: 83  TIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQERQDALSNARNYVADLSIEIAS 142

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           +II +++  D   ++ +  I  +   H+
Sbjct: 143 KIIQRELKADDQKALIDSYIEGLGKQHE 170


>gi|332308603|ref|YP_004436454.1| ATP synthase F0, B subunit [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175932|gb|AEE25186.1| ATP synthase F0, B subunit [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 156

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    +   IF V      +   ++  ++    KI D +  + R  +  E    +
Sbjct: 1   MNINATLFGELIAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + + +   II  AK R   + +E  Q   Q     +     +I   +  AK  L
Sbjct: 61  ATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ ++++    S I EK ++ +
Sbjct: 121 RKQVAVLAVAGAEKILERQIDAAAQSDIVEKLVAEL 156


>gi|297618433|ref|YP_003703592.1| ATP synthase F0 subunit beta [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146270|gb|ADI03027.1| ATP synthase F0, B subunit [Syntrophothermus lipocalidus DSM 12680]
          Length = 197

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 18/153 (11%), Positives = 57/153 (37%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++  +   I+      + +++ L+   + I   +  A  LR + E +  + +   ++
Sbjct: 45  WTAVNFFVLFAILYKFG-YTPIVNMLEQRTNTIESSLKHAEDLRAEVEQMRKEAQTNLAE 103

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E +EI+  A   A+    +     +Q +         +I   K +A   L    A  
Sbjct: 104 ARREAQEIVARATKVAEEAKNDIIAKAQQDARAEKDKALAEIKAEKEQALTELRDTAATL 163

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++    +++ + + ++ +  + ++ +       
Sbjct: 164 AIMAAEKVLGRALTEEDHKGMVKEFVKEAGDLL 196


>gi|330720624|gb|EGG98882.1| ATP synthase B chain [gamma proteobacterium IMCC2047]
          Length = 156

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M   +  V      +   + S L     KI D +  A R     E    +
Sbjct: 1   MNINATMIGQMLTFVVFVWFCMKFVWPPITSALAERKKKIADGLSAADRAEHDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+ ++ +++  EII  A  RA  L +E  +   +  A  +   + +I      A+  L
Sbjct: 61  AVERLAEAKQQGAEIIEQANKRAAQLVDEAKEQAREEGARLVAAAQAEIEQDTNRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +++   +N D ++++ +K  S +
Sbjct: 121 RTQVAAVAIAGAEKVLGSTVNADEHNAMLDKLASEL 156


>gi|109900597|ref|YP_663852.1| F0F1 ATP synthase subunit B [Pseudoalteromonas atlantica T6c]
 gi|123360113|sp|Q15MU0|ATPF2_PSEA6 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|109702878|gb|ABG42798.1| ATP synthase F0 subcomplex B subunit [Pseudoalteromonas atlantica
           T6c]
          Length = 156

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    +   IF V      +   ++  ++    KI D +  + R  +  E    +
Sbjct: 1   MNINATLFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + + +   II  AK R   + +E  Q   Q     +     +I   +  AK  L
Sbjct: 61  ATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V     I+ ++++    S I EK ++ +
Sbjct: 121 RKQVAALAVAGAERILERQIDAAAQSDIVEKLVAEL 156


>gi|307941609|ref|ZP_07656964.1| ATP synthase B chain [Roseibium sp. TrichSKD4]
 gi|307775217|gb|EFO34423.1| ATP synthase B chain [Roseibium sp. TrichSKD4]
          Length = 159

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 88/158 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + L++F  +++YL++P  + S LD  AD I+D++ +ARRLRE+++ +L  Y+
Sbjct: 1   MDASFWALVGLVLFFALIIYLKVPGKITSGLDKRADDIKDELEKARRLREEAQALLSDYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + EEE   I+  A   A+ L  E  + +E++ +   K  E KI   + +A   + +
Sbjct: 61  RKRHEAEEEATAIVAEANAEAERLTAETNRALEEVISRRSKAAEDKIAQAETQAIAEVRS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           K AD +V+    +++ K+ D V   I   +IS +++  
Sbjct: 121 KAADIAVQAAEGMLTAKVKDKVADDILSDSISQVKANL 158


>gi|162457649|ref|YP_001620016.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce
           56']
 gi|161168231|emb|CAN99536.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce
           56']
          Length = 333

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  +  +IVV       +   L      I  ++  A RL++++E  L +Y++K +++E
Sbjct: 169 VLNFGLLALIVVRFG-RKPIAEALKKRKQTITQELDNASRLKQEAELRLEEYEDKLTRLE 227

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           E   E+      +A++         EQ      +D E +       A+ +L  +    +V
Sbjct: 228 ETLAELKAEHAAQAEVEKAHVLAEAEQRRVRMRRDAEFRAEQELKAARAMLLQEAVQNAV 287

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSC 159
               E++ Q++       + E  + +I + 
Sbjct: 288 VAAEELLRQRIGQQDLDRVNEDYLKAIPAA 317


>gi|146284506|ref|YP_001174659.1| ATP synthase B chain [Pseudomonas stutzeri A1501]
 gi|226694444|sp|A4VS66|ATPF_PSEU5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145572711|gb|ABP81817.1| ATP synthase B chain [Pseudomonas stutzeri A1501]
          Length = 156

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T           V      +   + + + A   KI + +  A R ++  +    +
Sbjct: 1   MNINLTLFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + +E+  +II  A   A  + EE  Q         +     +I      A+  L
Sbjct: 61  VSHTLRETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +++A  +V    +I+  +++  V++ + EK  S +
Sbjct: 121 RSQVAALAVAGAEKILESQVDAKVHNELVEKLASQL 156


>gi|162146972|ref|YP_001601433.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544036|ref|YP_002276265.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|226741476|sp|A9HDM4|ATPF_GLUDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|161785549|emb|CAP55120.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531713|gb|ACI51650.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 164

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 75/160 (46%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F   ++ ++F V+     + + L + LD+ AD+IR D+ EA RLR ++E +L  
Sbjct: 1   MLHEPRFWSAVAFVLFFVLFGKK-LWTPLAAALDSRADRIRADLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +      E R ++  +   A  +A+E  +  E ++    +    +I   +  A R +
Sbjct: 60  ATRERETAMVEARALVEHSLIEAARIADEARREAEAVATRREQMARDRIAASERSAVREV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
                D +++  R++++  +    + +I ++ I+ + S  
Sbjct: 120 RQVAIDVAIQATRDVLATALPAGADHAIVDRAIADLPSAL 159


>gi|21672860|ref|NP_660925.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
 gi|81860150|sp|Q8KGE9|ATPF_CHLTE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21645909|gb|AAM71267.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
          Length = 175

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 70/154 (45%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I LVI+        +LS L+  A  I+  I  A   ++++E IL + ++  +
Sbjct: 22  FWTALTFLIVLVIL-RKTAWGPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRDLLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E  +II  AK  A  L  +  +     S   +   +++I   K  A  +L  ++AD
Sbjct: 81  KADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASAKEEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V+   +II   ++ D   ++    I  + +  
Sbjct: 141 MAVKGAEKIIRTTLDADKQKAVVNDMIKEMAASR 174


>gi|307547038|ref|YP_003899517.1| F0F1 ATP synthase subunit B [Halomonas elongata DSM 2581]
 gi|307219062|emb|CBV44332.1| F0F1 ATP synthase subunit B [Halomonas elongata DSM 2581]
          Length = 156

 Score = 90.2 bits (222), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +       F V      +   ++  L     KI D +  A R     E    Q
Sbjct: 1   MNLNLTLIGQAIAFAFFVWFCMRFVWPPVMQALQERQKKIADGLDAASRASRDLELAEQQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E   + +E+  EI+  A  R+  + +E  +   Q     + + + +I      AK  L
Sbjct: 61  AEETLRESKEQAAEILEQAHKRSNQMIDEAREQARQEGERMITNAKSEIEQEVNRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  ++     I+   +++  ++ + +K    +
Sbjct: 121 REQVSRLAIVGAERILESSIDEKQHAKLVDKLADEL 156


>gi|71082827|ref|YP_265546.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71061940|gb|AAZ20943.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 165

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 78/163 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S +IF+  +VYL+IP  +   L+     I+++I E+ +LR++++ +L  
Sbjct: 1   MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + +I+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 61  AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
                  +V+ V++II+  ++      +FEK +   +   +  
Sbjct: 121 KDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIALKKI 163


>gi|193213684|ref|YP_001999637.1| F0F1 ATP synthase subunit B [Chlorobaculum parvum NCIB 8327]
 gi|226741335|sp|B3QLV1|ATPF_CHLP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193087161|gb|ACF12437.1| ATP synthase F0, B subunit [Chlorobaculum parvum NCIB 8327]
          Length = 175

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 71/154 (46%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I LVI+        ++S L+     I+  I  A   +E++E+IL + KE  +
Sbjct: 22  FWTAVTFVIVLVIL-KKIAWGPIVSMLEEREKGIQSAIDRAHTAKEEAESILKKNKEMLA 80

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K + E  +II   K  A  +  E  +  +  S   +   +++I   K  A  +L  ++AD
Sbjct: 81  KADAEADKIIREGKEYADKVRSELTEKAQVESQKMIAAAKEEIEQEKRRALDVLRNEVAD 140

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V+   +II   ++ D   ++    I+ + +  
Sbjct: 141 MAVKGAEKIIRTTLDADKQKAVVNDMINEMAAKR 174


>gi|110835591|ref|YP_694450.1| ATP synthase F0 subunit B [Alcanivorax borkumensis SK2]
 gi|123050199|sp|Q0VKX0|ATPF_ALCBS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|110648702|emb|CAL18178.1| ATP synthase F0, B subunit [Alcanivorax borkumensis SK2]
          Length = 156

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   +   LD    KI + +  A R     E    +
Sbjct: 1   MNINATLIGQAIWFALFVFFCMKFVWPPISRALDERKQKIAEGLSAADRAERDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + +E+  EII  A  RA  + EE            +     +I     +A+  L
Sbjct: 61  ATANLKESKEKAAEIIDQANRRANQIVEEAKDAARAEGERLIAKAHSEIDQEVNQAREQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              +A  ++    +++  ++N D ++ + E+  + +
Sbjct: 121 RKDVAVLALSGAEKVLGGEVNQDKHTQLLEQLAAEL 156


>gi|116494658|ref|YP_806392.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei ATCC 334]
 gi|122263921|sp|Q03A22|ATPF_LACC3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116104808|gb|ABJ69950.1| ATP synthase F0 subcomplex B subunit [Lactobacillus casei ATCC 334]
          Length = 162

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 24/159 (15%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V        +   +     KI  D+  A + R+ ++ ++ +
Sbjct: 1   MTLGDTLFTLVTFLVLMLAVGK-VAWKPVSKMMADRQQKISGDLDYAEKSRKDADALVAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+    + +  +I+  AK   + L +              K+ + +I   + +A    
Sbjct: 60  RQEELQHSQADAVKIVNQAKENGEKLRQSLVDAANAEVTTMKKNAQTEIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD S+ I +++I +++N D    + +  I  +   
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRLGDA 158


>gi|91762750|ref|ZP_01264715.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718552|gb|EAS85202.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 168

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 78/163 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S +IF+  +VYL+IP  +   L+     I+++I E+ +LR++++ +L  
Sbjct: 4   MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDN 63

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + +I+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 64  AQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEI 123

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
                  +V+ V++II+  ++      +FEK +   +   +  
Sbjct: 124 KDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIALKKI 166


>gi|291615440|ref|YP_003525597.1| ATP synthase F0, B subunit [Sideroxydans lithotrophicus ES-1]
 gi|291585552|gb|ADE13210.1| ATP synthase F0, B subunit [Sideroxydans lithotrophicus ES-1]
          Length = 156

 Score = 89.9 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 69/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L    + +  V      + + +++ LDA   +I D + +A R ++  E    +
Sbjct: 1   MNINATLLAQTIMFVLFVWFCMKFVWTPIVAALDARKKQIADGLADAERAKQDLELASKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E   + +E+  EI+   + RA  + EE     +      +   + +I      AK  L
Sbjct: 61  SAEILREAKEKAGEIVANGEKRASEIVEEAKGQAKLEGDRIIAGAKAEIDQEVFRAKEQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  ++    +I+ ++++   ++ + +K ++ I
Sbjct: 121 RTQVSAIALAGAGKILGREIDAKAHNDLLDKLVAEI 156


>gi|92115403|ref|YP_575331.1| F0F1 ATP synthase subunit B [Chromohalobacter salexigens DSM 3043]
 gi|122419022|sp|Q1QSC6|ATPF_CHRSD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91798493|gb|ABE60632.1| ATP synthase F0 subcomplex B subunit [Chromohalobacter salexigens
           DSM 3043]
          Length = 156

 Score = 89.9 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   ++  L     KI D +  A R     E    Q
Sbjct: 1   MNLNLTLIGQAIAFAVFVWFCMKFVWPPVMQALQERQKKIADGLDAASRATRDLELAQEQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +E+  +II  A  RA  + EE   N        ++    +I      AK  L
Sbjct: 61  AAEQLKESKEQAAQIIEQAHKRANQMIEEARDNARLEGERMIESARGEIEQETQRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +++    I+   +++  +  + +K  + +
Sbjct: 121 RTQVAALAIQGAERILDSSIDEAKHRELVDKLAAEL 156


>gi|90415390|ref|ZP_01223324.1| ATP synthase B chain [marine gamma proteobacterium HTCC2207]
 gi|90332713|gb|EAS47883.1| ATP synthase B chain [marine gamma proteobacterium HTCC2207]
          Length = 156

 Score = 89.5 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M    F V      +  +++  ++    KI D +  A R     E    +
Sbjct: 1   MNINLTLFGQMVTFAFFVWFCMKFVWPVIIESMEERQKKIADGLDAADRALRDLELAQNK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + ++E   I+  A  RA  + +E                E +I      AK  L
Sbjct: 61  ATDQMKEAKQEAAGIVDQANKRANQIVDEAKVQARTEGDRLKVAAEAEIEQEINRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              +A  ++    E++   ++D  N ++ +     +
Sbjct: 121 RTTVAGLALAGAEEVLEASIDDKANRALVDNLAEQL 156


>gi|86137237|ref|ZP_01055815.1| ATP synthase F0, B subunit [Roseobacter sp. MED193]
 gi|85826561|gb|EAQ46758.1| ATP synthase F0, B subunit [Roseobacter sp. MED193]
          Length = 186

 Score = 89.5 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/154 (25%), Positives = 85/154 (55%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ I++++++PS+L   LDA A+ I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTNFVVLLGFLLFVGILLFVKVPSLLGGQLDARAEGIQKELDEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   AEE    +EQ  A  L   E++I   +  A + +  +
Sbjct: 89  KQQEVQAQADRIVASAREDAAAAAEEAKSELEQSIARRLAAAEEQIASAEASAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               +V    ++I+++M     + + +  I+ + 
Sbjct: 149 AISIAVAAADQVIAKQMTATEANKLIDAAITDVN 182


>gi|229819798|ref|YP_002881324.1| ATP synthase F0, B subunit [Beutenbergia cavernae DSM 12333]
 gi|229565711|gb|ACQ79562.1| ATP synthase F0, B subunit [Beutenbergia cavernae DSM 12333]
          Length = 200

 Score = 89.5 bits (220), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/153 (13%), Positives = 63/153 (41%), Gaps = 2/153 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +I +   VY  +   + + LD  + KI   +  A +++ +++    + +   ++
Sbjct: 30  WSLVVTVI-IAFFVYRYLMPKMTAILDERSAKIEGGLEHAAKVQAEADKAREEQEAVLAE 88

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   I   A+     +  E     +  +   ++  +++I   + +A   L +++   
Sbjct: 89  ARGEAARIREEAQGDGAAIVAEARGRAQAEANRIVESAQRQIDAERQQAVVSLRSEVGTL 148

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           + E+   I+ + + +D   S + ++ +  + S 
Sbjct: 149 ATELASRIVGESLADDARQSRLIDRFLEELDSS 181


>gi|254427405|ref|ZP_05041112.1| ATP synthase F0, B subunit [Alcanivorax sp. DG881]
 gi|196193574|gb|EDX88533.1| ATP synthase F0, B subunit [Alcanivorax sp. DG881]
          Length = 156

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   +   LD    KI + +  A R     E    +
Sbjct: 1   MNINATLIGQAIWFALFVFFCMKFVWPPISRALDERKQKIAEGLSAADRAERDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + +E+  EII  A  RA  + EE            +   + +I     +A+  L
Sbjct: 61  ATANLKESKEKAAEIIDQANRRANQIVEEAKDAARTEGERLIAKAQSEIDQEVNQAREQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +++  ++N D ++ + E+  + +
Sbjct: 121 RKEVAVLALSGAEKVLGNEVNQDAHTQLLEQLAAEL 156


>gi|110633056|ref|YP_673264.1| F0F1 ATP synthase subunit B [Mesorhizobium sp. BNC1]
 gi|123058179|sp|Q11KH6|ATPF2_MESSB RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|110284040|gb|ABG62099.1| ATP synthase F0, B subunit [Chelativorans sp. BNC1]
          Length = 159

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 96/158 (60%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   ++LIIF+ I++Y+++P +L   LDA A++I++++ EARRLRE+++ +L +Y+
Sbjct: 1   MDATFWALVALIIFVGILLYMKVPGMLAGSLDARAERIKNELEEARRLREEAQQLLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E+E +E++ AAK  AK++  +     E+  +      EQKI   + +A   + +
Sbjct: 61  RKRREAEQEAKELVDAAKREAKLIVSDAKVKTEEYVSRRTALAEQKIAQAERDAVNEVRS 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +  D +V    +++++K++    S +F+ ++  +++  
Sbjct: 121 RAVDVAVAAAGKLLAEKIDTKTGSELFKASLQDVKTRL 158


>gi|289643103|ref|ZP_06475233.1| ATP synthase F0, B subunit [Frankia symbiont of Datisca glomerata]
 gi|289507067|gb|EFD28036.1| ATP synthase F0, B subunit [Frankia symbiont of Datisca glomerata]
          Length = 196

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  ++  + +    +   P  +       +D+I  ++  A R + ++E++L+ Y+ + +
Sbjct: 30  LIGILAFGLLVAFFFWKVYPQ-IRRTYAERSDRIEGNLARAERTQREAEDLLVSYRRQLA 88

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + ++E   I   A+ + + + +       +  A      E ++   + +    +  +I +
Sbjct: 89  EAQDEAGRIRQDAREQGQQILDSLRAQAGEEVAEIKARGEAQLAAERAQVVAQIRREIGE 148

Query: 127 FSVEIVREIISQKMN-DDVNSSIFEKTISSIQ 157
            ++E+  +I+  ++  DD    + +  I+ + 
Sbjct: 149 IALELATKIVGHELQRDDRQRQLIDDFIAGLD 180


>gi|304320006|ref|YP_003853649.1| ATP synthase F0 subunit B [Parvularcula bermudensis HTCC2503]
 gi|303298909|gb|ADM08508.1| ATP synthase F0, B subunit [Parvularcula bermudensis HTCC2503]
          Length = 194

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 42/157 (26%), Positives = 83/157 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D  F V ++ +I + I ++  +P ++ SFL A A+ ++  + EAR LRE+++  L  +++
Sbjct: 37  DTNFWVLLAFLIVVGIFLWQGVPKMIGSFLSARAEGVQRQLDEARTLREEAQRTLADFQK 96

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  + E E   II  AK  AK +A E    +++  A   K  E +I   + +A   +  +
Sbjct: 97  RQREAETEAEAIIEQAKADAKSVATEARAKLDEQIARRRKAAEDRIARAEAQAIAEIRGR 156

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            AD ++   REII+ +M+D     + ++ I+ + +  
Sbjct: 157 TADMAIAAAREIIANRMDDRSQGQLIDRAINEVGTRL 193


>gi|319784762|ref|YP_004144238.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170650|gb|ADV14188.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 163

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 48/156 (30%), Positives = 89/156 (57%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    ++LIIFL + VY+++P ++   LDA A +I +++ EARRLRE+++ +L QY+ K
Sbjct: 7   ATLWATIALIIFLGVAVYIKVPGMIAKALDARAARISNELDEARRLREEAQQLLGQYQRK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E  +I+ AAK  A +LA +  +  E          EQKI   + +A   + A  
Sbjct: 67  RKEAEQEAADIVAAAKREADMLAADAHKKTEDYVVRRTALAEQKIGQAERDAISEVRASA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            D +VE  R +++ K++    + +F+ +++ ++S  
Sbjct: 127 VDIAVEAARALLAGKIDAKAGADLFKASLADVKSKL 162


>gi|191638157|ref|YP_001987323.1| ATP synthase B chain [Lactobacillus casei BL23]
 gi|239631741|ref|ZP_04674772.1| predicted protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|301066217|ref|YP_003788240.1| F0F1-type ATP synthase subunit b [Lactobacillus casei str. Zhang]
 gi|226741491|sp|B3WDL4|ATPF_LACCB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190712459|emb|CAQ66465.1| ATP synthase B chain [Lactobacillus casei BL23]
 gi|239526206|gb|EEQ65207.1| predicted protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|300438624|gb|ADK18390.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei str. Zhang]
 gi|327382188|gb|AEA53664.1| ATP synthase subunit b 2 [Lactobacillus casei LC2W]
 gi|327385385|gb|AEA56859.1| ATP synthase subunit b 2 [Lactobacillus casei BD-II]
          Length = 162

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 62/159 (38%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V        +   +     KI  D+  A + R+ ++ +  +
Sbjct: 1   MTLGDTLFTLVTFLVLMLAVGK-VAWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+    + +  +I+  AK   +   +              K+ +  I   + +A    
Sbjct: 60  RQEELQHSQADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD S+ I +++I +++N D    + +  I  +   
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRLGDA 158


>gi|227821029|ref|YP_002824999.1| F0F1 ATP synthase subunit B [Sinorhizobium fredii NGR234]
 gi|227340028|gb|ACP24246.1| Fo ATP synthase B chain [Sinorhizobium fredii NGR234]
          Length = 161

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/157 (28%), Positives = 85/157 (54%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF   + LI+FL ++ YL++P  +   LDA ADKI +++ EA+RLRE++++++ +
Sbjct: 1   MALDATFYALVGLILFLALIAYLKVPGKIAEALDARADKIGNELAEAKRLREEAQSLVAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K    E E   I+ AA+  A++L  E  Q  E   A      EQKI   + +A   +
Sbjct: 61  YQRKRKDAEAEAANIVAAAQREAEMLTAEAKQKTEDYVARRTALSEQKIKQAESDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
                D ++    ++++ K +     ++F++ +  ++
Sbjct: 121 RTAAVDLAISAAEKVLATKADATAQETLFKQALGEVK 157


>gi|254455815|ref|ZP_05069244.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082817|gb|EDZ60243.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 165

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 76/163 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S IIF   ++YL+IP  +   L+     I+++I E+ +LR  ++ +L  
Sbjct: 1   MAIDATFWVAVSFIIFFGALIYLKIPQKITEILNKMISDIKNEIDESEKLRTDAKTLLDN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + K    +  + EI+  AK  +  L  E      + S +     E KI  MK  A + +
Sbjct: 61  AQNKLDTAQSVSSEILEEAKKDSDKLIIELNDKFHKSSEIKKNLAENKISQMKEAAIKEI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
                  +V+ V++II+  ++     ++F+K +   +   +  
Sbjct: 121 KDASIKIAVDSVKKIITTSVDKSKLDAVFQKNLDETKEELKKI 163


>gi|269925189|ref|YP_003321812.1| ATP synthase F0, B subunit [Thermobaculum terrenum ATCC BAA-798]
 gi|269788849|gb|ACZ40990.1| ATP synthase F0, B subunit [Thermobaculum terrenum ATCC BAA-798]
          Length = 175

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 65/151 (43%), Gaps = 1/151 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
                 ++ +I + ++        +   LD  A ++R+ I  A R++ ++     + K+ 
Sbjct: 14  PFIWQLVAFLILVYVL-KRFAFGPVTRILDERAARVRESIETAERIQREAAEQEQRTKQM 72

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                 + + I+  A+  A+ +      N  + +   ++  ++ I  MK EA   L  ++
Sbjct: 73  LEDARRQAQAILQQAQQAAERIQSTAQDNAREQANQIIQRAQEDIDRMKAEAIDELRRQV 132

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           AD ++     II ++++   + ++  + ++ 
Sbjct: 133 ADLAIAAASRIIRKELDPATHRALINEVLAE 163


>gi|49080382|gb|AAT50011.1| PA5558 [synthetic construct]
          Length = 157

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 56/157 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EI+  AK RA  + +E                + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            A++   +V    +I+   ++ + +  +  K  + I 
Sbjct: 121 RAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEIG 157


>gi|254487002|ref|ZP_05100207.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
 gi|214043871|gb|EEB84509.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
          Length = 186

 Score = 88.7 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 86/157 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ I+F+ ++ Y ++PS++   LD  A  I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTDFVVLLAFILFIGVLFYFKVPSLIAGMLDKRATGIKSELEEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+++   I+ AAK  A   A++   ++E+  A  +   + +I   +  A + +  +
Sbjct: 89  KQQEVKDQADRIVTAAKAEAHEAADQARADLEKSIARRVATAQDQIESAQAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V   +++I++KM     +++ +  I+ + S  
Sbjct: 149 AIIIAVAAAKDVIAKKMTAAEGNALIDSAIADVDSKL 185


>gi|295394656|ref|ZP_06804875.1| ATP synthase F0 sector subunit B [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972549|gb|EFG48405.1| ATP synthase F0 sector subunit B [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 184

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 71/152 (46%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  II LV+   + +P      LD  A++I+  I +A +++ +++  L +Y+++ + 
Sbjct: 24  WSAVCFIIILVVFWKVILP-KFKKTLDERAERIQGGIEKAEKVQAEADAALAEYQKQLAD 82

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+     +  E  Q   + +   +   + +I   + +A   L  ++   
Sbjct: 83  GRAEAARLRAEAQEEGAQILAETKQRATEEADRIISAAKAQIEAERQQAMNSLRTEVGSL 142

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           + ++   I+ + + +D  ++S+ ++ I+ +++
Sbjct: 143 ATDLASRIVGESLQDDARSASVVDRFIADLEN 174


>gi|115373534|ref|ZP_01460831.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1]
 gi|115369540|gb|EAU68478.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1]
          Length = 200

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++  I + +V+  +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 39  FWTLVTF-ILVAVVLRWKAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKTAIA 97

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++   +   +   +E      + +        ++I   KL+A   +     D
Sbjct: 98  EARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTMAVD 157

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++E+  +++S++M+D  + ++ E+ +  +
Sbjct: 158 LAMEVAGKLLSERMDDAKHRALAEQFVQGL 187


>gi|74318819|ref|YP_316559.1| F-type H+-transporting ATP synthase subunit B [Thiobacillus
           denitrificans ATCC 25259]
 gi|123611105|sp|Q3SF62|ATPF_THIDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|74058314|gb|AAZ98754.1| F-type H+-transporting ATP synthase, subunit B [Thiobacillus
           denitrificans ATCC 25259]
          Length = 156

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      IF V      +   +++ L+    +I D +  A R + + E    +
Sbjct: 1   MNFNATLIGQSITFIFFVWFSMKFVWPPIMNALETRKKQIADGLAAADRGKHELELAAKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +     + +  E+I  A+ RA  + EE     ++     L   +  I      A+  L
Sbjct: 61  AGDNMRDAKAQAAEVIAQAEKRAAQIVEEAKLAAKEEGDRQLAAAQANIEQEANRAREGL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ +++N   ++ +  +  + +
Sbjct: 121 REQVAALAVAGAEKILRREVNAQTHADLLSQLKAEL 156


>gi|315304774|ref|ZP_07874944.1| ATP synthase F0, B subunit [Listeria ivanovii FSL F6-596]
 gi|313626853|gb|EFR95816.1| ATP synthase F0, B subunit [Listeria ivanovii FSL F6-596]
          Length = 170

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 67/159 (42%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F ++F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDSFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKLLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDGK 170


>gi|222147704|ref|YP_002548661.1| F0F1 ATP synthase subunit B [Agrobacterium vitis S4]
 gi|221734692|gb|ACM35655.1| ATP synthase F0 B subunit [Agrobacterium vitis S4]
          Length = 161

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 50/160 (31%), Positives = 91/160 (56%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M +D TF  F+ L++FL ++ YL++P ++   LDA AD IRD++ EA+RLRE+++ +L +
Sbjct: 1   MQYDATFFAFVGLVLFLALIAYLKVPGMMAKSLDARADNIRDELAEAKRLREEAQQLLAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  + E E + I+ AA+  A  L EE  Q  E+         EQKI   + +A   +
Sbjct: 61  YRAKRKQAEAEAQAIVTAAEREAAALTEEARQKTEEFVQRRNALSEQKIKQAETDAINAV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +   D ++     ++ QK++  + S +F  ++S +++  
Sbjct: 121 RSAAVDLAISAAETLLKQKVDAQLQSGLFNSSVSEVKNRL 160


>gi|227535358|ref|ZP_03965407.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|227186954|gb|EEI67021.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
          Length = 162

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 62/159 (38%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V        +   +     KI  D+  A + R+ ++ +  +
Sbjct: 1   MTLGDTLFTLVTFLVLMLAVGK-VAWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+    + +  +I+  AK   +   +              K+ +  I   + +A    
Sbjct: 60  RQEELQHAQADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD S+ I +++I +++N D    + +  I  +   
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKGLIDDYIKRLGDA 158


>gi|84684306|ref|ZP_01012208.1| ATP synthase F0, B subunit [Maritimibacter alkaliphilus HTCC2654]
 gi|84668059|gb|EAQ14527.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2654]
          Length = 185

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 85/157 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ I+F++++VY ++P ++   LD  AD I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 28  NTDFIVLLAFILFVLVLVYFKVPGMIGGMLDKRADTIKAELEEARALREEAQTILASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+++  +I+  AK  A   AE+    I +     L   E++I   +  A + +   
Sbjct: 88  KQQEVKDQAAQIVEHAKTEAAEAAEQAKIQIAESIKRRLAGAEEQIKSAEAAAIKEIRDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++   +E+I++KM     + + + +I  +++  
Sbjct: 148 AIAAAIGASKEVIAKKMTATEANKLIDASIGEVEAKL 184


>gi|126738037|ref|ZP_01753758.1| ATP synthase F0, B subunit [Roseobacter sp. SK209-2-6]
 gi|126720534|gb|EBA17239.1| ATP synthase F0, B subunit [Roseobacter sp. SK209-2-6]
          Length = 185

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +   +V +  ++F+ I++++++PS+L   LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTNLVVALGFLLFVGILLFVKVPSLLGKQLDNRADGIQKELDEARALREEAQTVLADYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   AEE    +E+  A  L   E++I   +  A + +  +
Sbjct: 88  KQQEVQAQADSIVASAREDAARAAEEAKAELEKSIARRLAAAEEQIDSAEASAVKEVRDQ 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V    ++I+++M     + + +  I+ + +  
Sbjct: 148 AITIAVAAADQVIAKQMTAAEANKLIDAAIADVDAKL 184


>gi|229551975|ref|ZP_04440700.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus rhamnosus
           LMS2-1]
 gi|258539389|ref|YP_003173888.1| ATP synthase subunit B [Lactobacillus rhamnosus Lc 705]
 gi|229314710|gb|EEN80683.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus rhamnosus
           LMS2-1]
 gi|257151065|emb|CAR90037.1| ATP synthase B chain [Lactobacillus rhamnosus Lc 705]
          Length = 162

 Score = 87.9 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 62/159 (38%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V        +   +     KI  D+  A + R+ +E +  +
Sbjct: 1   MSLGDTLFTLVTFLVLMIAVGK-VAWKPVSKMMAERQQKISGDLDYAEKSRKDAEALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E     + +  +I+  AK   +   +          A   K+ +  I   + +A    
Sbjct: 60  RREALQHSQADAVKIVNQAKENGEKQRQSLVDAANTEVATLKKNAQADIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD S+ I +++I +++N D    + +  I  +   
Sbjct: 120 KNDVADLSLAIAQKLIGKELNADDQKDLIDDYIKRLGDA 158


>gi|126734941|ref|ZP_01750687.1| ATP synthase F0, B subunit [Roseobacter sp. CCS2]
 gi|126715496|gb|EBA12361.1| ATP synthase F0, B subunit [Roseobacter sp. CCS2]
          Length = 170

 Score = 87.9 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 87/157 (55%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P ++   LD  AD I+ ++ EA+ LRE+++++L  Y+ 
Sbjct: 13  NTDFVVLIAFVIFIGILLYFKVPGLVGGMLDKRADSIKAELDEAKALREEAQSLLASYER 72

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E++  I+ AAK  A   A     +I +     L   E++I   +  A + +  +
Sbjct: 73  KQKEVQEQSARIVAAAKEEATNAATAAKDDIAKSITRRLAAAEEQIASAEASAVKEVRDQ 132

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V   +++I+++M+     ++ + +I+++    
Sbjct: 133 AIAVAVGAAKDVIAKQMDAKSAGALIDDSIATVAEKL 169


>gi|83941574|ref|ZP_00954036.1| ATP synthase F0, B subunit [Sulfitobacter sp. EE-36]
 gi|83847394|gb|EAP85269.1| ATP synthase F0, B subunit [Sulfitobacter sp. EE-36]
          Length = 186

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 90/157 (57%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++Y ++P ++ S LD+ A+ I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTDFIVLLAFLLFVGVLIYFKVPKMMGSMLDSRAEGIKSELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +AK  A   A++   ++E+  A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVKEQADRIVTSAKAEANEAADQARADLEKSIARRMAAAEEQIDSAQAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++   +++I++KM     +++ +  I+ + +  
Sbjct: 149 AVVVAIAAAKDVIAKKMTAAEGNALIDSAIAEVDAKL 185


>gi|284046070|ref|YP_003396410.1| ATP synthase F0 B subunit [Conexibacter woesei DSM 14684]
 gi|283950291|gb|ADB53035.1| ATP synthase F0, B subunit [Conexibacter woesei DSM 14684]
          Length = 194

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 67/150 (44%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ L+++        +   LD    +I + I  A R R++++ +L +Y+++ + 
Sbjct: 36  WTLLAFVVALLVL-RKYAWPQITRILDQRQQQIEESIDAADRTRQEADELLAEYRQRLTD 94

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  EI+  A+   ++   EG    +      L+   + I      A + +  ++AD 
Sbjct: 95  ARAQADEIVAKAERAGEVAEREGLDAAKVKREELLEQTRRDIQAETNRAIQEIRREVADL 154

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           +V+   ++  + ++ D    + E+ +S + 
Sbjct: 155 TVQATEKVTRKTLSPDDQKRLVEEALSELD 184


>gi|126667604|ref|ZP_01738573.1| F0F1 ATP synthase subunit B [Marinobacter sp. ELB17]
 gi|126627873|gb|EAZ98501.1| F0F1 ATP synthase subunit B [Marinobacter sp. ELB17]
          Length = 187

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 58/151 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V+     +   +++ L     KI D +  + R     E    +
Sbjct: 1   MNINLTILGQAIAFFIFVVFCMKMVWPPVIAALQERQKKIADGLAASDRAERDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +++   +I  A  RA  + E    +  +     ++  + +I     +A+  L
Sbjct: 61  SAQELREAKQQAAGLIEQANKRAAQIVEASKDDARKEGEKLIEQAKAEIVQELNQAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEK 151
            A+I   ++    +I+   ++   ++ + E 
Sbjct: 121 RAEIGVIAIAGAEKILETSVDASKHNEMLEN 151


>gi|330812739|ref|YP_004357201.1| ATP synthase subunit B [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380847|gb|AEA72197.1| putative ATP synthase, B subunit [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 156

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAHEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  VGQQLREAKAQAAEIIEQAKKRGTQIVDEAREQARVEADRVKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  +  + I
Sbjct: 121 RAQVGALAVGGASKILGATIDQNAHAELVNQLAAEI 156


>gi|83855051|ref|ZP_00948581.1| ATP synthase F0, B subunit [Sulfitobacter sp. NAS-14.1]
 gi|83842894|gb|EAP82061.1| ATP synthase F0, B subunit [Sulfitobacter sp. NAS-14.1]
          Length = 186

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 90/157 (57%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++Y ++P ++ S LD+ A+ I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 29  NTDFIVLLAFLLFVGVLIYFKVPKMMGSMLDSRAEGIKSELDEARALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +AK  A   A++   ++E+  A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVKEQADRIVTSAKAEANEAADQARADLEKSIARRMAAAEEQIDSAQAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++   +++I++KM     +++ +  I+ + +  
Sbjct: 149 AVVVAIAAAKDVIAKKMTAAEGNALIDSAIAEVDTKL 185


>gi|29377097|ref|NP_816251.1| ATP synthase F0, B subunit [Enterococcus faecalis V583]
 gi|227554107|ref|ZP_03984154.1| ATP synthase F0, B subunit [Enterococcus faecalis HH22]
 gi|229545020|ref|ZP_04433745.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1322]
 gi|229549264|ref|ZP_04437989.1| ATP synthase F0, B subunit [Enterococcus faecalis ATCC 29200]
 gi|256853923|ref|ZP_05559288.1| ATP synthase F0 [Enterococcus faecalis T8]
 gi|256957851|ref|ZP_05562022.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis DS5]
 gi|256961150|ref|ZP_05565321.1| ATP synthase subunit B [Enterococcus faecalis Merz96]
 gi|257081865|ref|ZP_05576226.1| ATP synthase subunit B [Enterococcus faecalis E1Sol]
 gi|257084407|ref|ZP_05578768.1| ATP synthase subunit B [Enterococcus faecalis Fly1]
 gi|257087594|ref|ZP_05581955.1| ATP synthase subunit B [Enterococcus faecalis D6]
 gi|257416801|ref|ZP_05593795.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis AR01/DG]
 gi|257420017|ref|ZP_05597011.1| ATP synthase subunit B [Enterococcus faecalis T11]
 gi|293384096|ref|ZP_06629990.1| ATP synthase F0, B subunit [Enterococcus faecalis R712]
 gi|293386911|ref|ZP_06631480.1| ATP synthase F0, B subunit [Enterococcus faecalis S613]
 gi|300861260|ref|ZP_07107347.1| ATP synthase F0, B subunit [Enterococcus faecalis TUSoD Ef11]
 gi|307285542|ref|ZP_07565681.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0860]
 gi|307290374|ref|ZP_07570289.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0411]
 gi|312899986|ref|ZP_07759304.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0470]
 gi|312902383|ref|ZP_07761589.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0635]
 gi|312907953|ref|ZP_07766936.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 512]
 gi|312953643|ref|ZP_07772480.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0102]
 gi|312978519|ref|ZP_07790257.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 516]
 gi|81722327|sp|Q831A1|ATPF_ENTFA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29344563|gb|AAO82321.1| ATP synthase F0, B subunit [Enterococcus faecalis V583]
 gi|227176733|gb|EEI57705.1| ATP synthase F0, B subunit [Enterococcus faecalis HH22]
 gi|229305501|gb|EEN71497.1| ATP synthase F0, B subunit [Enterococcus faecalis ATCC 29200]
 gi|229309912|gb|EEN75899.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1322]
 gi|256710866|gb|EEU25909.1| ATP synthase F0 [Enterococcus faecalis T8]
 gi|256948347|gb|EEU64979.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis DS5]
 gi|256951646|gb|EEU68278.1| ATP synthase subunit B [Enterococcus faecalis Merz96]
 gi|256989895|gb|EEU77197.1| ATP synthase subunit B [Enterococcus faecalis E1Sol]
 gi|256992437|gb|EEU79739.1| ATP synthase subunit B [Enterococcus faecalis Fly1]
 gi|256995624|gb|EEU82926.1| ATP synthase subunit B [Enterococcus faecalis D6]
 gi|257158629|gb|EEU88589.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ARO1/DG]
 gi|257161845|gb|EEU91805.1| ATP synthase subunit B [Enterococcus faecalis T11]
 gi|291078576|gb|EFE15940.1| ATP synthase F0, B subunit [Enterococcus faecalis R712]
 gi|291083581|gb|EFE20544.1| ATP synthase F0, B subunit [Enterococcus faecalis S613]
 gi|295113591|emb|CBL32228.1| ATP synthase F0 subcomplex B subunit [Enterococcus sp. 7L76]
 gi|300850299|gb|EFK78049.1| ATP synthase F0, B subunit [Enterococcus faecalis TUSoD Ef11]
 gi|306498567|gb|EFM68069.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0411]
 gi|306502766|gb|EFM72031.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0860]
 gi|310626044|gb|EFQ09327.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 512]
 gi|310628481|gb|EFQ11764.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0102]
 gi|310634053|gb|EFQ17336.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0635]
 gi|311288668|gb|EFQ67224.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 516]
 gi|311292982|gb|EFQ71538.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0470]
 gi|315025248|gb|EFT37180.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2137]
 gi|315030331|gb|EFT42263.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4000]
 gi|315035797|gb|EFT47729.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0027]
 gi|315150004|gb|EFT94020.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0012]
 gi|315151910|gb|EFT95926.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0031]
 gi|315159209|gb|EFU03226.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0312]
 gi|315162852|gb|EFU06869.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0645]
 gi|315173363|gb|EFU17380.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1346]
 gi|315576216|gb|EFU88407.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0309B]
 gi|315579207|gb|EFU91398.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0630]
 gi|315582932|gb|EFU95123.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0309A]
 gi|323481548|gb|ADX80987.1| ATP synthase F0, B subunit [Enterococcus faecalis 62]
 gi|327535843|gb|AEA94677.1| ATP synthase F0 sector subunit B [Enterococcus faecalis OG1RF]
          Length = 176

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 68/157 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 19  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 79  LSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           D S++I  +I+++++  D + ++ +  I S+   ++ 
Sbjct: 139 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANET 175


>gi|315170138|gb|EFU14155.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1342]
          Length = 176

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 68/157 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 19  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 79  LSSRSEAAEIIKNAKESGEQTRQKTLKETTVEVTRLREKARTDISQEREEALSSVKNEVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           D S++I  +I+++++  D + ++ +  I S+   ++ 
Sbjct: 139 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANET 175


>gi|301299955|ref|ZP_07206182.1| ATP synthase F0, B subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852437|gb|EFK80094.1| ATP synthase F0, B subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 175

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+ ++   + L+ +V     + +   ++  A KI +DI  A + R+K+E ++ +      
Sbjct: 19  FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVKKRDLALK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   +        +  +       + ++ I   + EA   +   +A+
Sbjct: 79  NSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKTNAKKDIQQERQEALDSVKNDVAE 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
            S+EI  +II +++  D   ++ +  I  +   ++ 
Sbjct: 139 LSIEIASKIIRKELTADDQKALVDSYIEGLGKQNET 174


>gi|296114242|ref|ZP_06832897.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979318|gb|EFG86041.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 164

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 73/160 (45%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F   ++  +F  I+   ++   L + LDA A KIR D+ EA RLR ++E +L  
Sbjct: 1   MLHEPRFWSAVAFFLFF-ILFGAKLWRPLSAALDARAQKIRADLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +      E R ++  +   A  +A +  Q+ + I+    +    +I   +  A R +
Sbjct: 60  ATREREAALAEARAMVEHSLQEAARIAAQASQDADDIARRREQMARDRIAAAERGAIREV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
                D +++  RE ++  ++ D + S+ +  IS + S  
Sbjct: 120 REAAIDIAMQATRETLAASLSADGDKSLIDSAISGLPSAL 159


>gi|152985533|ref|YP_001351671.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PA7]
 gi|226694439|sp|A6VF36|ATPF_PSEA7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150960691|gb|ABR82716.1| ATP synthase F0, B subunit [Pseudomonas aeruginosa PA7]
          Length = 156

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EI+  AK RA  + +E                + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARAEGERLKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + +  +  K  + I
Sbjct: 121 RAQVGTLAVTGAEKILGASIDANAHEQLVSKLAAEI 156


>gi|138896939|ref|YP_001127392.1| F0F1 ATP synthase subunit B [Geobacillus thermodenitrificans
           NG80-2]
 gi|134268452|gb|ABO68647.1| ATPase subunit b [Geobacillus thermodenitrificans NG80-2]
          Length = 207

 Score = 87.5 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 69/149 (46%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +   I L++++       L+  +    + I ++I +A + R+++E +L + +E   +  
Sbjct: 54  QLVAFILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSR 113

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E + I+  A+  A+   E+   +    +    +  +Q+I   K +A   L  ++A  SV
Sbjct: 114 QEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSV 173

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            I  ++I +++ +     + E  I  IQ 
Sbjct: 174 LIASKVIERELTEQDQRKLIEAYIKDIQE 202


>gi|163751418|ref|ZP_02158643.1| ATP synthase subunit B [Shewanella benthica KT99]
 gi|161328721|gb|EDP99869.1| ATP synthase subunit B [Shewanella benthica KT99]
          Length = 156

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + TF+      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNLNATFIGQTVAFILFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|90961572|ref|YP_535488.1| ATP synthase B chain [Lactobacillus salivarius UCC118]
 gi|227890658|ref|ZP_04008463.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus salivarius
           ATCC 11741]
 gi|122449154|sp|Q1WUD0|ATPF_LACS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|90820766|gb|ABD99405.1| ATP synthase B chain [Lactobacillus salivarius UCC118]
 gi|227867596|gb|EEJ75017.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus salivarius
           ATCC 11741]
 gi|300214396|gb|ADJ78812.1| ATP synthase subunit b (ATP synthase F(0) sector subunit b) (F-type
           ATPase subunit b) (F-ATPase subunit b) (ATPase subunit
           I) [Lactobacillus salivarius CECT 5713]
          Length = 175

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+ ++   + L+ +V     + +   ++  A KI +DI  A + R+K+E ++ +      
Sbjct: 19  FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVEKRDLALK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   +        +  +       + ++ I   + EA   +   +A+
Sbjct: 79  NSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKANAKKDIQQERQEALDSVKNDVAE 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
            S+EI  +II +++  D   ++ +  I  +   ++ 
Sbjct: 139 LSIEIASKIIRKELTADDQKALVDSYIEGLGKQNET 174


>gi|199597580|ref|ZP_03211009.1| F0F1-type ATP synthase, subunit b [Lactobacillus rhamnosus HN001]
 gi|258508174|ref|YP_003170925.1| ATP synthase subunit B [Lactobacillus rhamnosus GG]
 gi|199591603|gb|EDY99680.1| F0F1-type ATP synthase, subunit b [Lactobacillus rhamnosus HN001]
 gi|257148101|emb|CAR87074.1| ATP synthase B chain [Lactobacillus rhamnosus GG]
 gi|259649492|dbj|BAI41654.1| F0F1-type ATP synthase subunit B [Lactobacillus rhamnosus GG]
          Length = 162

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 62/159 (38%), Gaps = 1/159 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M   +T    ++ ++ ++ V        +   +     KI  D+  A + R+ +E +  +
Sbjct: 1   MSLGDTLFTLVTFLVLMIAVGK-VAWKPVSKMMAERQQKISGDLDYAEKSRKDAEALAAK 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E     + +  +I+  AK   +   +          A   K+ +  I   + +A    
Sbjct: 60  RREALQHAQADAVKIVNQAKENGEKQRQSLVDAANTEVATLKKNAQADIDQARKDALASA 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +AD S+ I +++I +++N D    + +  I  +   
Sbjct: 120 KNDVADLSLTIAQKLIGKELNADDQKDLIDDYIKRLGDA 158


>gi|158312874|ref|YP_001505382.1| F0F1 ATP synthase subunit B [Frankia sp. EAN1pec]
 gi|226741457|sp|A8L3W1|ATPF_FRASN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158108279|gb|ABW10476.1| ATP synthase F0, B subunit [Frankia sp. EAN1pec]
          Length = 193

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  + +    +   P  +       A++I   +  A R   +++ +L QY+ + ++  
Sbjct: 32  LLAFGLLVGFFFWKIYPQ-IRKTYAERAERIEGGLNRAERAEREAQALLEQYRSQLAEAR 90

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+ + + + EE    ++Q  A   +  +  +   + +    +  +I + ++
Sbjct: 91  SEAARIREDAQAQGRQIVEELRTQVQQEVAEIRERADAALVAERAQVVASVRREIGEIAL 150

Query: 130 EIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           E+   I+ +++ ND     + +  I+ +   
Sbjct: 151 ELATRIVGRELENDTRQRQLVDDFIAGLDEA 181


>gi|56698065|ref|YP_168436.1| F0F1 ATP synthase subunit B [Ruegeria pomeroyi DSS-3]
 gi|81349060|sp|Q5LNH2|ATPF_SILPO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56679802|gb|AAV96468.1| ATP synthase F0, B subunit [Ruegeria pomeroyi DSS-3]
          Length = 190

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 83/157 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ ++ Y ++PS++   LD  A+ I+ D+ EAR+LRE+++++L  ++ 
Sbjct: 33  NTDFVVTIAFLVFIAVLFYFKVPSMIGGALDKRAEGIQSDLDEARKLREEAQSLLASFER 92

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +++ +   I+ AAK  A+  AE+   ++E   A  L   + +I   +  A + +  +
Sbjct: 93  KQKEMQGQADAIVAAAKEEAQRSAEQAKVDLEASIARRLAAAQDQIASAEAAAVKDVRDR 152

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V    ++I+  M     + + +  I+   +  
Sbjct: 153 AIAIAVAAAGDVIASSMTAAEANKLIDAGIADAGAKL 189


>gi|289435794|ref|YP_003465666.1| ATP synthase F0, B subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172038|emb|CBH28584.1| ATP synthase F0, B subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 170

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 67/159 (42%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F ++F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDSFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|89897662|ref|YP_521149.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219670791|ref|YP_002461226.1| ATP synthase F0 subunit beta [Desulfitobacterium hafniense DCB-2]
 gi|122480523|sp|Q24MN7|ATPF_DESHY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|89337110|dbj|BAE86705.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219541051|gb|ACL22790.1| ATP synthase F0, B subunit [Desulfitobacterium hafniense DCB-2]
          Length = 164

 Score = 87.5 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 34/158 (21%), Positives = 71/158 (44%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD T +V +   + LV ++     + L++ ++    +I  +I  A + R ++E I  +Y
Sbjct: 5   HFDLTLVVQVLSFLLLVYILRRFAWNPLINMMEERRSQIEANIANAEKERLQAEQIKREY 64

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           +E+  K  +E +E+I  A   ++  A E        +    +     I   +  A   + 
Sbjct: 65  QEEMRKARQEAQEVIAKATKLSEQRAAEILAAAHGEAEKIKQSALADIERERDRAIAQVQ 124

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           A++AD SV +  +II + ++      + E+ I  +   
Sbjct: 125 AQVADLSVAVAEKIIRKNLDVRGQEDMIEQFIQEVGEL 162


>gi|163733901|ref|ZP_02141343.1| ATP synthase F0, B subunit [Roseobacter litoralis Och 149]
 gi|161393012|gb|EDQ17339.1| ATP synthase F0, B subunit [Roseobacter litoralis Och 149]
          Length = 191

 Score = 87.2 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 42/157 (26%), Positives = 88/157 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+VF+ L++F+ I+VY ++P ++   LD  A+ I  ++ EAR LRE+++ +L  Y+ 
Sbjct: 34  NTDFVVFLGLVVFIGILVYFKVPGMIGKMLDGRAEGIEGELNEARALREEAQTLLASYER 93

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           KH +V+E+   I+ AAK  A I AE+   ++E   A  +   E +I   +  A + +  +
Sbjct: 94  KHREVQEQADRIVEAAKEEATIAAEQARADLEVSLARRVAAAEDQIASAQAAAIKDVRDQ 153

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++   RE+I++++     + + +  I+ +++  
Sbjct: 154 SVSVAIAAAREVIAKQLTAADANQLIDGAIAEVEAKL 190


>gi|15600751|ref|NP_254245.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PAO1]
 gi|116053709|ref|YP_794036.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894661|ref|YP_002443531.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa LESB58]
 gi|254237766|ref|ZP_04931089.1| ATP synthase B chain [Pseudomonas aeruginosa C3719]
 gi|254243103|ref|ZP_04936425.1| ATP synthase B chain [Pseudomonas aeruginosa 2192]
 gi|296392425|ref|ZP_06881900.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PAb1]
 gi|81783492|sp|Q9HT16|ATPF_PSEAE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122256271|sp|Q02DF0|ATPF_PSEAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|9951898|gb|AAG08943.1|AE004967_14 ATP synthase B chain [Pseudomonas aeruginosa PAO1]
 gi|115588930|gb|ABJ14945.1| ATP synthase B chain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169697|gb|EAZ55208.1| ATP synthase B chain [Pseudomonas aeruginosa C3719]
 gi|126196481|gb|EAZ60544.1| ATP synthase B chain [Pseudomonas aeruginosa 2192]
 gi|218774890|emb|CAW30708.1| ATP synthase B chain [Pseudomonas aeruginosa LESB58]
          Length = 156

 Score = 87.2 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EI+  AK RA  + +E                + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + +  +  K  + I
Sbjct: 121 RAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEI 156


>gi|308234031|ref|ZP_07664768.1| ATP synthase F0, B subunit [Atopobium vaginae DSM 15829]
 gi|328944385|ref|ZP_08241847.1| ATP synthase F0 sector subunit B [Atopobium vaginae DSM 15829]
 gi|327490969|gb|EGF22746.1| ATP synthase F0 sector subunit B [Atopobium vaginae DSM 15829]
          Length = 212

 Score = 87.2 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 66/161 (40%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             FL  ++  + +  ++       ++  ++    KI+ D+  A   + K+E    +  + 
Sbjct: 52  AEFLPALAAFLVVWFIMARFAWPSIVKMMEKRELKIKGDLDSAEEAKLKAEQDRKESAKT 111

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               + +  EII  AK  A+   E    + ++ ++  ++     I   + +A   L   +
Sbjct: 112 IGDAQIKAAEIIATAKREAEQEREHILADAQRNASGLIEKARDAITTERHKAMIELSGFV 171

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKN 165
            D SVEI  +II   +++     + E  +  + + H  ++ 
Sbjct: 172 VDLSVEIAGKIIGNSLSEAQQRDLAEHYLHEVGAKHDEEQA 212


>gi|313111491|ref|ZP_07797292.1| ATP synthase B chain [Pseudomonas aeruginosa 39016]
 gi|310883794|gb|EFQ42388.1| ATP synthase B chain [Pseudomonas aeruginosa 39016]
          Length = 156

 Score = 87.2 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EI+  AK RA  + +E                + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERMKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + +  +  K  + I
Sbjct: 121 RAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEI 156


>gi|46908705|ref|YP_015094.1| F0F1 ATP synthase subunit B [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47094112|ref|ZP_00231836.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858]
 gi|226225081|ref|YP_002759188.1| H+-transporting ATP synthase chain b [Listeria monocytogenes
           Clip81459]
 gi|254825344|ref|ZP_05230345.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194]
 gi|254853938|ref|ZP_05243286.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503]
 gi|254932225|ref|ZP_05265584.1| F0F1 ATP synthase subunit B [Listeria monocytogenes HPB2262]
 gi|254993668|ref|ZP_05275858.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J2-064]
 gi|255519771|ref|ZP_05387008.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-175]
 gi|300764967|ref|ZP_07074955.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017]
 gi|81565274|sp|Q71WP5|ATPF_LISMF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46881977|gb|AAT05271.1| ATP synthase F0, B subunit [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017519|gb|EAL08328.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858]
 gi|225877543|emb|CAS06257.1| Putative H+-transporting ATP synthase chain b [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258607327|gb|EEW19935.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503]
 gi|293583782|gb|EFF95814.1| F0F1 ATP synthase subunit B [Listeria monocytogenes HPB2262]
 gi|293594587|gb|EFG02348.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194]
 gi|300514267|gb|EFK41326.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017]
 gi|308445536|gb|ADO32954.1| AtpF [Listeria monocytogenes]
 gi|332312963|gb|EGJ26058.1| ATP synthase subunit b [Listeria monocytogenes str. Scott A]
          Length = 170

 Score = 87.2 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|728929|sp|P41172|ATPF_THIFE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|154670|gb|AAA53123.1| F1F0-ATPase b subunit [Acidithiobacillus ferrooxidans]
          Length = 159

 Score = 87.2 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 66/154 (42%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T +V +   + LV ++Y  +   L   +D    KI D +  A R +E+      +  
Sbjct: 6   INGTLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRAT 65

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E   + +++  EII  A+ R   L EE      + +   +     +I      A+ +L  
Sbjct: 66  ELVREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAREVLRG 125

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++ +  V   + I+ ++++D  +  I ++ +  +
Sbjct: 126 QVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159


>gi|116873897|ref|YP_850678.1| F0F1 ATP synthase subunit B [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461425|sp|A0ALL7|ATPF_LISW6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116742775|emb|CAK21899.1| ATP synthase F0, B subunit [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 170

 Score = 87.2 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|227519703|ref|ZP_03949752.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0104]
 gi|256616876|ref|ZP_05473722.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ATCC 4200]
 gi|256963731|ref|ZP_05567902.1| ATP synthase subunit B [Enterococcus faecalis HIP11704]
 gi|257079789|ref|ZP_05574150.1| ATP synthase subunit B [Enterococcus faecalis JH1]
 gi|257421804|ref|ZP_05598794.1| ATP synthase F0 subunit B [Enterococcus faecalis X98]
 gi|294781388|ref|ZP_06746730.1| ATP synthase F0, B subunit [Enterococcus faecalis PC1.1]
 gi|307270672|ref|ZP_07551963.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4248]
 gi|307271678|ref|ZP_07552949.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0855]
 gi|307276860|ref|ZP_07557971.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2134]
 gi|307287563|ref|ZP_07567606.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0109]
 gi|227072791|gb|EEI10754.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0104]
 gi|256596403|gb|EEU15579.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ATCC 4200]
 gi|256954227|gb|EEU70859.1| ATP synthase subunit B [Enterococcus faecalis HIP11704]
 gi|256987819|gb|EEU75121.1| ATP synthase subunit B [Enterococcus faecalis JH1]
 gi|257163628|gb|EEU93588.1| ATP synthase F0 subunit B [Enterococcus faecalis X98]
 gi|294451515|gb|EFG19975.1| ATP synthase F0, B subunit [Enterococcus faecalis PC1.1]
 gi|306501301|gb|EFM70604.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0109]
 gi|306506497|gb|EFM75656.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2134]
 gi|306511556|gb|EFM80555.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0855]
 gi|306512982|gb|EFM81623.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4248]
 gi|315032745|gb|EFT44677.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0017]
 gi|315143756|gb|EFT87772.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2141]
 gi|315148587|gb|EFT92603.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4244]
 gi|315155494|gb|EFT99510.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0043]
 gi|315164960|gb|EFU08977.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1302]
 gi|315168603|gb|EFU12620.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1341]
 gi|329578104|gb|EGG59516.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1467]
          Length = 176

 Score = 87.2 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 68/157 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 19  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 78

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 79  LSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVA 138

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           D S++I  +I+++++  D + ++ +  I S+   ++ 
Sbjct: 139 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANET 175


>gi|114565199|ref|YP_752713.1| F0F1 ATP synthase subunit B [Shewanella frigidimarina NCIMB 400]
 gi|122298237|sp|Q07VU0|ATPF_SHEFN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114336492|gb|ABI73874.1| ATP synthase F0, B subunit [Shewanella frigidimarina NCIMB 400]
          Length = 156

 Score = 87.2 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T        I  V      +   L++ ++    KI D + +A R  +  E   ++
Sbjct: 1   MNFNATLFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATEQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++ + +S I  K ++ I
Sbjct: 121 RKQVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI 156


>gi|319947326|ref|ZP_08021559.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
 gi|319746568|gb|EFV98828.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
          Length = 164

 Score = 87.2 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S LDA A+KI +DI EA   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKFAWGNITSILDARAEKITNDIDEAEAARKKAEELATKREAELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  AK  A+           Q +    +  + +I   K EA   +   +AD
Sbjct: 72  GSRQEATTILETAKETAEKNKAHILSEANQEALRLKEKAQLEISQNKEEAMNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +++SQ+++ + +  + ++ ++ +   
Sbjct: 132 LTVNLAGKLLSQQLDSEGHRQLIDRYLNELGDA 164


>gi|283856305|ref|YP_162406.2| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|283775301|gb|AAV89295.2| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 212

 Score = 87.2 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 80/151 (52%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +S+I+FL+++V+ ++PSI+ S LD   D+IR  + +A RLR+++E +  +Y EK  +
Sbjct: 56  WVSVSIIVFLLVLVWKKVPSIITSGLDKQIDEIRTRLGDAERLRKEAEALKAEYDEKTRQ 115

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   II  AK  A  +  +     +Q+     K   ++I   + EA   +    A  
Sbjct: 116 ATSEAEAIIERAKEDASSIIADAKIQSQQLVERRQKMATEQIAAAEQEAVAEIRQTAAKL 175

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +++   +II ++ +   +  + ++TI S++ 
Sbjct: 176 ALQAATQIIQKQNDASHDKVLIDQTIDSLKQ 206


>gi|83591198|ref|YP_431207.1| ATP synthase F0, B subunit [Moorella thermoacetica ATCC 39073]
 gi|123523801|sp|Q2RFX5|ATPF_MOOTA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|1929509|gb|AAB51462.1| ATP synthase subunit b [Moorella thermoacetica]
 gi|83574112|gb|ABC20664.1| ATP synthase F0 subcomplex B subunit [Moorella thermoacetica ATCC
           39073]
          Length = 168

 Score = 87.2 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 69/153 (45%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            TFL     ++ ++ ++Y+ +   L   L     +I  ++ +A   REK+ENIL +Y+++
Sbjct: 13  WTFLFQTLNLLVVMGLLYVFLYKPLGKVLADREARIEGNLNDAAAAREKAENILAEYRQQ 72

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                +E + I+  A   A+    E      + +   L    ++I   K +A   + ++ 
Sbjct: 73  LQGARQEAQAILDRATKMAEETRAEIINRAREEAERTLAQARREIEGEKSKALAAIRSEA 132

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           A  ++    +++ + +  D    +  + I+ ++
Sbjct: 133 ASLAILAAGKVLERSLTPDDQERLAREAIAEVE 165


>gi|153002865|ref|YP_001368546.1| F0F1 ATP synthase subunit B [Shewanella baltica OS185]
 gi|160877612|ref|YP_001556928.1| F0F1 ATP synthase subunit B [Shewanella baltica OS195]
 gi|217975452|ref|YP_002360203.1| F0F1 ATP synthase subunit B [Shewanella baltica OS223]
 gi|304412691|ref|ZP_07394294.1| ATP synthase F0, B subunit [Shewanella baltica OS183]
 gi|307305844|ref|ZP_07585590.1| ATP synthase F0, B subunit [Shewanella baltica BA175]
 gi|226694477|sp|A6WUJ4|ATPF_SHEB8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694478|sp|A9KX10|ATPF_SHEB9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|151367483|gb|ABS10483.1| ATP synthase F0, B subunit [Shewanella baltica OS185]
 gi|160863134|gb|ABX51668.1| ATP synthase F0, B subunit [Shewanella baltica OS195]
 gi|217500587|gb|ACK48780.1| ATP synthase F0, B subunit [Shewanella baltica OS223]
 gi|304348901|gb|EFM13316.1| ATP synthase F0, B subunit [Shewanella baltica OS183]
 gi|306911337|gb|EFN41763.1| ATP synthase F0, B subunit [Shewanella baltica BA175]
 gi|315269810|gb|ADT96663.1| ATP synthase F0, B subunit [Shewanella baltica OS678]
          Length = 156

 Score = 87.2 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I  K ++ I
Sbjct: 121 RKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|16801738|ref|NP_472006.1| F0F1 ATP synthase subunit B [Listeria innocua Clip11262]
 gi|255023753|ref|ZP_05295739.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-208]
 gi|81774204|sp|Q927W0|ATPF_LISIN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|16415213|emb|CAC97903.1| atpF [Listeria innocua Clip11262]
 gi|313622353|gb|EFR92833.1| ATP synthase F0, B subunit [Listeria innocua FSL J1-023]
          Length = 170

 Score = 86.8 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKADIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|198284883|ref|YP_002221204.1| ATP synthase F0 subunit B [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667443|ref|YP_002427563.1| ATP synthase F0, B subunit [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226694421|sp|B7JB88|ATPF_ACIF2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694422|sp|B5ER46|ATPF_ACIF5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|198249404|gb|ACH84997.1| ATP synthase F0, B subunit [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519656|gb|ACK80242.1| ATP synthase F0, B subunit [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 159

 Score = 86.8 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 66/154 (42%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T +V +   + LV ++Y  +   L   +D    KI D +  A R +E+      +  
Sbjct: 6   INGTLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRAT 65

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E   + +++  EII  A+ R   L EE      + +   +     +I      A+ +L  
Sbjct: 66  ELLREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAREVLRG 125

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++ +  V   + I+ ++++D  +  I ++ +  +
Sbjct: 126 QVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159


>gi|330961490|gb|EGH61750.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 156

 Score = 86.8 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  VGQQLREAKTQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|47096956|ref|ZP_00234532.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854]
 gi|217963364|ref|YP_002349042.1| ATP synthase F0, B subunit [Listeria monocytogenes HCC23]
 gi|254900329|ref|ZP_05260253.1| F0F1 ATP synthase subunit B [Listeria monocytogenes J0161]
 gi|254913432|ref|ZP_05263444.1| ATP synthase F0 [Listeria monocytogenes J2818]
 gi|254937813|ref|ZP_05269510.1| ATP synthase F0 [Listeria monocytogenes F6900]
 gi|290892696|ref|ZP_06555688.1| ATP synthase F0 [Listeria monocytogenes FSL J2-071]
 gi|47014666|gb|EAL05623.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854]
 gi|217332634|gb|ACK38428.1| ATP synthase F0, B subunit [Listeria monocytogenes HCC23]
 gi|258610417|gb|EEW23025.1| ATP synthase F0 [Listeria monocytogenes F6900]
 gi|290557756|gb|EFD91278.1| ATP synthase F0 [Listeria monocytogenes FSL J2-071]
 gi|293591439|gb|EFF99773.1| ATP synthase F0 [Listeria monocytogenes J2818]
 gi|307572060|emb|CAR85239.1| ATP synthase F0, B subunit [Listeria monocytogenes L99]
 gi|313606755|gb|EFR83455.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL F2-208]
          Length = 170

 Score = 86.8 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDAFFTLFAFSILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|302039013|ref|YP_003799335.1| ATP synthase F0 subunit B [Candidatus Nitrospira defluvii]
 gi|300607077|emb|CBK43410.1| ATP synthase F0, subunit B [Candidatus Nitrospira defluvii]
          Length = 170

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 72/153 (47%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +S  I   ++     P  LL  L+    KI+D + +A R R ++E  L +Y+ K +
Sbjct: 14  FWEVLSFGILFFLLYKYAFPG-LLGMLEEREKKIKDSLDQAERHRSEAERRLKEYEAKLA 72

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              ++   ++  AK RA+ L EE  Q +   +     D  ++I   + +A + + ++  D
Sbjct: 73  TAAKDAEALLAQAKERAQRLMEENEQRMTADAERIKGDATREIETERRKAIQDIRSQTTD 132

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +++ + + +  +  + ++ + ++   
Sbjct: 133 LAMMVAEKVVGRALTEGDHRRLADEALDALAKS 165


>gi|62318459|dbj|BAD94433.1| b subunit of F1F0-ATP synthase [Acidithiobacillus ferrooxidans]
          Length = 159

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 66/154 (42%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T +V +   + LV ++Y  +   L   +D    KI D +  A R +E+      +  
Sbjct: 6   INGTLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALAQKRAT 65

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E   + +++  EII  A+ R   L EE      + +   +     +I      A+ +L  
Sbjct: 66  ELVREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAREVLRG 125

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++ +  V   + I+ ++++D  +  I ++ +  +
Sbjct: 126 QVVELVVNGTQRILHREIDDQAHRDIIDRMVGQL 159


>gi|108800843|ref|YP_641040.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. MCS]
 gi|119869983|ref|YP_939935.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. KMS]
 gi|126436441|ref|YP_001072132.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. JLS]
 gi|123178312|sp|Q1B550|ATPFD_MYCSS RecName: Full=ATP synthase subunit b-delta; Includes: RecName:
           Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2; Includes: RecName: Full=ATP
           synthase subunit delta; AltName: Full=ATP synthase F(1)
           sector subunit delta; AltName: Full=F-type ATPase
           subunit delta; Short=F-ATPase subunit delta
 gi|226694392|sp|A3Q3B4|ATPFD_MYCSJ RecName: Full=ATP synthase subunit b-delta; Includes: RecName:
           Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2; Includes: RecName: Full=ATP
           synthase subunit delta; AltName: Full=ATP synthase F(1)
           sector subunit delta; AltName: Full=F-type ATPase
           subunit delta; Short=F-ATPase subunit delta
 gi|226694408|sp|A1UJY7|ATPFD_MYCSK RecName: Full=ATP synthase subunit b-delta; Includes: RecName:
           Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2; Includes: RecName: Full=ATP
           synthase subunit delta; AltName: Full=ATP synthase F(1)
           sector subunit delta; AltName: Full=F-type ATPase
           subunit delta; Short=F-ATPase subunit delta
 gi|108771262|gb|ABG09984.1| ATP synthase F0 subcomplex B subunit / ATP synthase F1 subcomplex
           delta subunit [Mycobacterium sp. MCS]
 gi|119696072|gb|ABL93145.1| ATP synthase F0 subcomplex B subunit / ATP synthase F1 subcomplex
           delta subunit [Mycobacterium sp. KMS]
 gi|126236241|gb|ABN99641.1| ATP synthase F1 subcomplex delta subunit / ATP synthase F0
           subcomplex B subunit [Mycobacterium sp. JLS]
          Length = 443

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/170 (15%), Positives = 73/170 (42%), Gaps = 3/170 (1%)

Query: 6   TFLV-FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           TF+   +   + + ++V   +P  +   + A  + +R  + E+     K      Q+ + 
Sbjct: 3   TFIGQLIGFAVIVFLLVRFVVP-PVRRMMTAQQETVRRQLEESSTAANKVAQADQQHAKA 61

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + + + R ++  A+  A+ +AE+     +          + ++  ++ +  R L + +
Sbjct: 62  VEEAKADARRVVDEARSDAEKIAEQMRAQADAEVERIKVQGQAQVQLLRQQLIRELRSHL 121

Query: 125 ADFSVEIVREIISQKMNDDVN-SSIFEKTISSIQSCHQMDKNTTETLGSQ 173
              SV   RE++   ++DD N S+  ++ +  + +    D    + +GS+
Sbjct: 122 GTESVARARELVRDHVSDDDNRSATVDRFLDELDAMAPSDAALDDAVGSR 171


>gi|108804478|ref|YP_644415.1| ATP synthase F0 subunit B [Rubrobacter xylanophilus DSM 9941]
 gi|122381737|sp|Q1AVH5|ATPF_RUBXD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|108765721|gb|ABG04603.1| ATP synthase F0, B subunit [Rubrobacter xylanophilus DSM 9941]
          Length = 174

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I L ++ Y  +  I+   +     +I   I EA + R ++  +L +Y+ +  
Sbjct: 16  FWEVVTFLILLALL-YRYVYPIIRDQIQKRQAQIEQAIEEAEKTRAEARELLEEYRRQIE 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E R+I+  A+ +AK   E   +   +     ++   ++I   +  A R +  ++AD
Sbjct: 75  AARGEARQILDEARRQAKAQRERAREEAREEGDRIIQRAREEISRERDAALREVRREVAD 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +     +I ++++   +  +  + + S+++
Sbjct: 135 MVIMASSRVIGRELDAAEHERLINEALESLEA 166


>gi|254465155|ref|ZP_05078566.1| ATP synthase B chain [Rhodobacterales bacterium Y4I]
 gi|206686063|gb|EDZ46545.1| ATP synthase B chain [Rhodobacterales bacterium Y4I]
          Length = 186

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++  ++P +L + LD  A+ I+ ++ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTDFVVLLAFLLFVGILLLAKVPGLLGNQLDNRAEAIQKELDEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +  +I+ AA+  A   AE    ++E   A  L   +++I   +  A R +  +
Sbjct: 89  KQQEVQAQADQIVAAARDEAARAAEVAKADLETSIARRLAAAQEQIASAEASAVREVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V    E+IS++M     + + +  I+ + +  
Sbjct: 149 AISIAVAAADEVISKQMTAAEANKLIDAAIADVDAKL 185


>gi|322385219|ref|ZP_08058866.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
 gi|321270843|gb|EFX53756.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
          Length = 164

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S L+  + KI DDI  A   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKFAWGNITSILEERSKKITDDIDGAESARKKAEELAQKRENELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   II  AK  A+        +  + +        Q+I   K EA   +   +AD
Sbjct: 72  GSRQEATTIIEHAKETAEKNKAGILADAAEEAGRLKAKANQEIAQSKAEALNSIKDDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++   +S + ++ I  +   
Sbjct: 132 LTVSLASKILSQQLDTKAHSELIDRYIDKLGDA 164


>gi|284992520|ref|YP_003411074.1| ATP synthase F0 subunit B [Geodermatophilus obscurus DSM 43160]
 gi|284065765|gb|ADB76703.1| ATP synthase F0, B subunit [Geodermatophilus obscurus DSM 43160]
          Length = 195

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 61/151 (40%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++  I   ++    +         A  + I   I  A  ++ +++  L QY+ + ++
Sbjct: 21  IGTITFAIAFFVLGKF-VWPRFEQVFRARREAIEGGIERAESMQAEAKAALEQYRAQLAE 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+   + + EE     ++ SA  +   E+++   + +    L  +I   
Sbjct: 80  ARTEAAQIRDQARAEGQQILEELRAQAQEESARIVARGEEQLATSRQQVVNELRGQIGRL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQ 157
           +V++   ++ + + +    S   ++ +  + 
Sbjct: 140 AVDLAGRVVGESLEDQARRSGTVDRFLDQLD 170


>gi|330505860|ref|YP_004382729.1| ATP synthase F0 subunit B [Pseudomonas mendocina NK-01]
 gi|328920146|gb|AEB60977.1| ATP synthase F0, B subunit [Pseudomonas mendocina NK-01]
          Length = 156

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKFVWPPVITALQERQKKIADGLDAANRAARDLELAHEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  A  RA  + +E        +       + +I       K  L
Sbjct: 61  VAQQLREAKGQAAEIIEQANKRAAQIVDEARDQARVEADRVKAQAQAEIEQEINGIKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQVGSLAVSGAEKILGASIDQNAHAELVNKLAAEI 156


>gi|126176551|ref|YP_001052700.1| F0F1 ATP synthase subunit B [Shewanella baltica OS155]
 gi|226694476|sp|A3DAR8|ATPF_SHEB5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125999756|gb|ABN63831.1| ATP synthase F0, B subunit [Shewanella baltica OS155]
          Length = 156

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + EE         A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEANAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I  K ++ I
Sbjct: 121 RKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|24376223|ref|NP_720267.1| F0F1 ATP synthase subunit B [Shewanella oneidensis MR-1]
 gi|81744607|sp|Q8E8B6|ATPF_SHEON RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24351283|gb|AAN57710.1|AE015907_8 ATP synthase F0, B subunit [Shewanella oneidensis MR-1]
          Length = 156

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      I  V      +   L++ ++A   +I D + +A R  +  E    +
Sbjct: 1   MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I  K ++ I
Sbjct: 121 RKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|331701225|ref|YP_004398184.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
 gi|329128568|gb|AEB73121.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
          Length = 169

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++ ++ +  +V +     +   +   +DKI +DI  A+  R K+  +  + + +  
Sbjct: 17  LFVMITFLVLMW-LVKIVAWKPITKMMQDRSDKIVNDIDSAKESRTKAAELAQKRQAELD 75

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K  ++   II  AK   +   E+  ++    ++      E+ I   + EA       +A 
Sbjct: 76  KTRDDANTIINTAKQNGQRQQEQIVEDARNEASNLKSSAEKDIEQERQEALANSRKDVAS 135

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            SVEI  +IIS+++N+D    + +  I  +    
Sbjct: 136 LSVEIASKIISKELNEDDQKGLVDSYIEGLGKQK 169


>gi|84500334|ref|ZP_00998600.1| ATP synthase F0, B subunit [Oceanicola batsensis HTCC2597]
 gi|84392268|gb|EAQ04536.1| ATP synthase F0, B subunit [Oceanicola batsensis HTCC2597]
          Length = 185

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 81/157 (51%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ +++Y  +P +L+  LD  AD+IR ++ EA+ LRE+++ +L  Y+ 
Sbjct: 28  NTDFIVLLGFLLFIAVLIYFGVPGMLMGMLDKRADQIRSELDEAKSLREEAQALLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+  A+  A   A +   ++E      L   E +I   +  A + +  +
Sbjct: 88  KQKEVQAQADRIVETARKEASDSAAQAKLDLEASIQRRLAAAEDQIASAEASAVKEVKDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++   RE+I+ ++     + + + +I +++   
Sbjct: 148 AVAVAIAAAREVIAGQVKAADANKMIDDSIDTVEQKL 184


>gi|239831260|ref|ZP_04679589.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
 gi|239823527|gb|EEQ95095.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
          Length = 244

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 69/146 (47%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 98  LWLAITFGLFYLFMSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 156

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A     + E      LK+ E++I  +K +A   +     +
Sbjct: 157 QARTKAASIAEAAREKGKGEANAERASAEAALEGKLKEAEERIAAIKAKAMNDVGNIAEE 216

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            + EIV +++  K +    ++  +  
Sbjct: 217 TTAEIVEQLLGTKADKASVTAAVKAA 242


>gi|255971976|ref|ZP_05422562.1| ATP synthase subunit B [Enterococcus faecalis T1]
 gi|255975033|ref|ZP_05425619.1| ATP synthase subunit B [Enterococcus faecalis T2]
 gi|256763250|ref|ZP_05503830.1| ATP synthase subunit B [Enterococcus faecalis T3]
 gi|257090753|ref|ZP_05585114.1| ATP synthase subunit B [Enterococcus faecalis CH188]
 gi|255962994|gb|EET95470.1| ATP synthase subunit B [Enterococcus faecalis T1]
 gi|255967905|gb|EET98527.1| ATP synthase subunit B [Enterococcus faecalis T2]
 gi|256684501|gb|EEU24196.1| ATP synthase subunit B [Enterococcus faecalis T3]
 gi|256999565|gb|EEU86085.1| ATP synthase subunit B [Enterococcus faecalis CH188]
          Length = 171

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 68/157 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       ++  L    +KI +D+  A + R  +  +  + +++ 
Sbjct: 14  TMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEKERQQQL 73

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  EII  AK   +   ++  +          +     I   + EA   +  ++A
Sbjct: 74  LSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSSVKNEVA 133

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           D S++I  +I+++++  D + ++ +  I S+   ++ 
Sbjct: 134 DLSLQIAAKILNKELTPDAHEALIDSYIESLGKANET 170


>gi|28872702|ref|NP_795321.1| ATP synthase F0 subunit B [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213968455|ref|ZP_03396598.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato T1]
 gi|301384258|ref|ZP_07232676.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato Max13]
 gi|302063891|ref|ZP_07255432.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato K40]
 gi|302131975|ref|ZP_07257965.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|81728855|sp|Q87TT0|ATPF_PSESM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28855958|gb|AAO59016.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213926743|gb|EEB60295.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato T1]
 gi|330876340|gb|EGH10489.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|331017740|gb|EGH97796.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 156

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  VGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|227501701|ref|ZP_03931750.1| F0F1 ATP synthase subunit B [Corynebacterium accolens ATCC 49725]
 gi|306835878|ref|ZP_07468873.1| ATP synthase F0 sector subunit B [Corynebacterium accolens ATCC
           49726]
 gi|227077726|gb|EEI15689.1| F0F1 ATP synthase subunit B [Corynebacterium accolens ATCC 49725]
 gi|304568243|gb|EFM43813.1| ATP synthase F0 sector subunit B [Corynebacterium accolens ATCC
           49726]
          Length = 189

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 65/159 (40%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  I+ L +     +P      L+   D+I   +  A   + +++  L +Y  + +
Sbjct: 32  FWSLLCFIVILWLFWKFVLPR-YTKLLEEREDRIEGGMKRAEAQQAEAKAALEKYNAQLA 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  EI   A+ R K +  +     E+ S   + + E+++   + +    L +++  
Sbjct: 91  DARAEAAEIREQARERGKQIEADAKSQAEEESRRIVANGEKQLEASRAQVVTELRSEMGQ 150

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
            S+ +  +I+  ++ +    SS  +  +S + S     K
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDSVAPAGK 189


>gi|330996916|ref|ZP_08320781.1| ATP synthase F0, B subunit [Paraprevotella xylaniphila YIT 11841]
 gi|329571990|gb|EGG53661.1| ATP synthase F0, B subunit [Paraprevotella xylaniphila YIT 11841]
          Length = 168

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   I   I+     P ++   +D     I   +  AR+  E+ + +  + +   +
Sbjct: 12  FWMVIIFGIVFFILAKYAFP-VITGMVDKRKQYIDSSLEAARQANEQLQQVKAESEALLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      +  E  +     +   L +   +I   K  A   +  ++A 
Sbjct: 71  RAHEEQTAILKEASATRDRIIAEARERARTEARKALDETRHQIAAEKESAINDIRRQVAI 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV++  +++ +K+ +D     +  + +  ++S + ++
Sbjct: 131 LSVDVAEKVLRKKLSDDKEQLELVNRLLDEVKSNNDIE 168


>gi|332701904|ref|ZP_08421992.1| ATP synthase subunit b [Desulfovibrio africanus str. Walvis Bay]
 gi|332552053|gb|EGJ49097.1| ATP synthase subunit b [Desulfovibrio africanus str. Walvis Bay]
          Length = 266

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/161 (13%), Positives = 60/161 (37%), Gaps = 1/161 (0%)

Query: 1   MHFDE-TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M  D  T    +   + L+ ++   +   +L  +    +++R  + +AR  R ++E  L 
Sbjct: 1   MLIDWFTVGAQIINFLILIWLLKRLLYGPILRAMHEREERVRSRLEDARNTRREAEEELQ 60

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           + + +  ++E    E +  A+   K   +E                +Q +   +      
Sbjct: 61  RLQSERQELERAREEHMAQARREIKEWKDEAMDKAHAEVEEKRASWQQAVRQERERELEK 120

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +  +I    + + R  ++   ++ +     +K +S ++   
Sbjct: 121 MRKRIVGQVLTVSRRALADLADESLERKAADKFLSELRRRK 161


>gi|261879473|ref|ZP_06005900.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
 gi|270333898|gb|EFA44684.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
          Length = 173

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 73/159 (45%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++   ++     P  + + ++     I D + +A    E+ ENI  + +    
Sbjct: 16  FWMLLAFLVVFGVLAKFGFP-AITNMVEDRKKYIDDSLRKAHEASERLENIRQEGESMLQ 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +++  A     ++ E+  +  +      L D + +I   K  A R + +++A+
Sbjct: 75  EAREKQAQLLKEATETRDVIVEKAQEKAKAEGTRLLSDAKAQIEAEKQNAIRDIRSQVAE 134

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
            SV+I   I+ Q++ ++D    + +K +  +   ++ ++
Sbjct: 135 LSVKIAERIVKQQLSSNDKQMELIDKLLDEVSEDNKREQ 173


>gi|119385601|ref|YP_916656.1| F0F1 ATP synthase subunit B [Paracoccus denitrificans PD1222]
 gi|226694341|sp|A1B616|ATPF_PARDP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119376196|gb|ABL70960.1| H+-transporting two-sector ATPase, B/B' subunit [Paracoccus
           denitrificans PD1222]
          Length = 184

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 43/157 (27%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I+VY R+P I+   LD  A+ IR+D+ EARRLRE+++ I   Y+ 
Sbjct: 27  NTDFIVTLAFLLFVGILVYFRVPQIVGGLLDKRAEGIRNDLAEARRLREEAQEIYASYER 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +  +V+ +  +I+  AK  A   AE+  + ++      LK  E++I   + EA R +  +
Sbjct: 87  RQREVKSQADDIVANAKREAVAEAEKAKKALQLSIERRLKAAEEQIAGAEAEAVRAVRDR 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++    EI+ ++ +    S+  +K I  +    
Sbjct: 147 AIQTAIAAATEILGKQASPAERSAGIDKAIDEVAQRL 183


>gi|229593485|ref|YP_002875604.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens SBW25]
 gi|229365351|emb|CAY53731.1| ATP synthase B chain [Pseudomonas fluorescens SBW25]
          Length = 156

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 55/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVVFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +    + +  EII  AK R   + EE  +     +         +I       K  L
Sbjct: 61  VGHQLRDAKAQAAEIIEQAKKRGNQIVEEAVEKARVEADRVKASAHAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|91795101|ref|YP_564752.1| F0F1 ATP synthase subunit B [Shewanella denitrificans OS217]
 gi|122968365|sp|Q12HP7|ATPF_SHEDO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91717103|gb|ABE57029.1| ATP synthase F0, B subunit [Shewanella denitrificans OS217]
          Length = 156

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      +  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNFNATLIGQSVAFLIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELARSK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I  K ++ I
Sbjct: 121 RKQVATLAILGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|325688345|gb|EGD30364.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK72]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + ++  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREDALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|114769967|ref|ZP_01447577.1| ATP synthase F0, B subunit [alpha proteobacterium HTCC2255]
 gi|114549672|gb|EAU52554.1| ATP synthase F0, B subunit [alpha proteobacterium HTCC2255]
          Length = 185

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/154 (26%), Positives = 80/154 (51%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ +++YL++P  L   LD  A+ I+ ++ EAR LRE++++IL +Y+ 
Sbjct: 28  NTNFVVLIAFLLFVGLLIYLKVPGKLSGMLDERANGIQSELDEARSLREEAQSILAEYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +  +IIL AK  AK  A     N++      L   E +I   +  A + +   
Sbjct: 88  KQKEVQNQADQIILHAKEEAKNAAAAAKDNLKASIKRRLASAEDQILSAQTAAVKEVKDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               ++   +++IS  MN    + + E  I    
Sbjct: 148 AVIVAIAAAKDVISSGMNASHANELIETAIKDTN 181


>gi|330964194|gb|EGH64454.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 156

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  VGQQLREAKAQAAEIIEQAKKRGTQIVDEALETARVEADRVKAQAQAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|315221772|ref|ZP_07863686.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
 gi|315189158|gb|EFU22859.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L++++       + S  +  A KI DDI  A   R+K+E++  + + + +
Sbjct: 12  FILVAGSFLLLIVLIKKFAWDNITSTFEQRAKKISDDIDGAESARQKAEDLAQKRETELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   II  AK  A+        +    +    +   Q+I   K EA   +   +AD
Sbjct: 72  GSRQEATTIIENAKETAEKNKAGILADAADEAGRLKEKANQEIAQTKAEAMNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+ QK++ + +  + ++ I  +   
Sbjct: 132 LTVNLASKILGQKLDQEAHKELIDRYIDKLGDA 164


>gi|313631930|gb|EFR99069.1| ATP synthase F0, B subunit [Listeria seeligeri FSL N1-067]
 gi|313636295|gb|EFS02099.1| ATP synthase F0, B subunit [Listeria seeligeri FSL S4-171]
          Length = 170

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + ++    S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDXKEQSNLIQDYIERLGDDK 170


>gi|255324523|ref|ZP_05365640.1| ATP synthase F0, B subunit [Corynebacterium tuberculostearicum
           SK141]
 gi|255298429|gb|EET77729.1| ATP synthase F0, B subunit [Corynebacterium tuberculostearicum
           SK141]
          Length = 189

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 68/159 (42%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  I+ L++   L +P      L    D+I   +  A+  + +++  L +Y  + +
Sbjct: 32  FWSLLCFIVILLLFWKLVLP-KYTKMLQEREDRIEGGLNRAKAQQAEAKAALEKYNAQLA 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  EI   A+ R K +  E   N E+ S   + + E+++   + +    L +++  
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTNAEEESRRIVANGEKQLEASRSQVVTELRSEMGQ 150

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
            S+ +  +I+  ++ +    SS  +  +S + S     K
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDSVAPAGK 189


>gi|222152830|ref|YP_002562007.1| F0F1 ATP synthase subunit B [Streptococcus uberis 0140J]
 gi|222113643|emb|CAR41544.1| ATP synthase B chain [Streptococcus uberis 0140J]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 66/153 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    I+ L +++       +   L+  + KI  DI  A + R ++EN+  + + + +
Sbjct: 12  FILVTGSILVLYLLLKKFAWGSISGILEERSAKISSDIDRAEQARIEAENLAQKRENELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             ++E  +II  AK   ++  E+         +   +  +  I   K +A   + +++ D
Sbjct: 72  GAKQEASKIITDAKELGQVKGEQLVAEASAEVSRLKEKAQADIQQSKTDAISSVKSEMTD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +++   ++    S + +  +  +   
Sbjct: 132 LTVLLAEKVLGANLDKSAQSQLIDSYLDDLGEA 164


>gi|313903640|ref|ZP_07837030.1| ATP synthase F0, B subunit [Thermaerobacter subterraneus DSM 13965]
 gi|313466193|gb|EFR61717.1| ATP synthase F0, B subunit [Thermaerobacter subterraneus DSM 13965]
          Length = 160

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/161 (15%), Positives = 69/161 (42%), Gaps = 2/161 (1%)

Query: 1   MHFDETF-LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           MH        F++  +F++++        ++  LD   ++I  ++  A R RE++     
Sbjct: 1   MHISPELIWAFINFFLFVIVLARFF-WRPVMELLDRRREEIEVNLAAAERAREEAARAEA 59

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           +Y+++ +  + E + I+  A   A+   +E  +   + +   L+     I   K +A   
Sbjct: 60  EYRQRLAVAQREAQSILERATQLAEQERQERLEAARREAEQLLERARATIEREKEQAIAA 119

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           L  ++AD ++     ++ + ++ +    +  + +  + S  
Sbjct: 120 LRREVADLTLLATERVLGRVLDAEDQRRLVTEAVEEVASLR 160


>gi|258593692|emb|CBE70033.1| putative Sodium-transporting two-sector ATPase [NC10 bacterium
           'Dutch sediment']
          Length = 201

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 69/157 (43%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           + + T LV +   + L+ V+Y  + + L  FL   AD I+  + EA+  RE +     +Y
Sbjct: 43  NLNMTLLVQVVNFLILIAVLYKFLFTPLTQFLATRADGIKRSLEEAKAAREAAAQTQKEY 102

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + +      E   +  +A    +   +   +   + +   + + + +I      AK  L 
Sbjct: 103 EAQILATRREAAAMRESAIREVEEERQRLLKVSREEATRLVTEAKAQIEQEVKRAKAELR 162

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           A++   S+ +   +I++ +  D +  + E+ ++ I S
Sbjct: 163 AEVVGLSLGVAERVIARSLTTDDHRRLAEQVVAEIGS 199


>gi|125717632|ref|YP_001034765.1| F0F1 ATP synthase subunit B [Streptococcus sanguinis SK36]
 gi|226696182|sp|A3CM10|ATPF_STRSV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125497549|gb|ABN44215.1| Proton-translocating ATPase, F0 sector, subunit b, putative
           [Streptococcus sanguinis SK36]
 gi|332365950|gb|EGJ43706.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1059]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + ++  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREDALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|256823845|ref|YP_003147808.1| ATP synthase F0 subunit B [Kangiella koreensis DSM 16069]
 gi|256797384|gb|ACV28040.1| ATP synthase F0, B subunit [Kangiella koreensis DSM 16069]
          Length = 156

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T  + M   +  V      +   ++  +    DKI + +  + R ++  E    +
Sbjct: 1   MNINATLFINMIFFVGFVWFCMKFVWPFIIKAIKERQDKIAEGLAASERSQKDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E   + ++++ EI+ +AK R   + +    +    +         +I      A+  L
Sbjct: 61  AAELLREAKQQSAEIVDSAKKRHAEIVDSAKGDARTEADKIKNGAMAEIEQEVNRAREQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +K+A  +V    ++I + ++   N+ +F+K +  +
Sbjct: 121 RSKVATLAVAGAEKVIERNIDAAANNDLFDKLVKEL 156


>gi|332523942|ref|ZP_08400194.1| ATP synthase F0, B subunit [Streptococcus porcinus str. Jelinkova
           176]
 gi|332315206|gb|EGJ28191.1| ATP synthase F0, B subunit [Streptococcus porcinus str. Jelinkova
           176]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    ++ L +++       +   L+  + KI  DI +A   R+ +E +  + + + +
Sbjct: 12  FILVSGSVLVLYLLIKKFAWGAISGILEERSAKIATDIDKAEEARQSAETLAQKRELELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             ++E  +II  AK   ++  ++   +  + ++      E  I   K +A   + A+++D
Sbjct: 72  GAKQEANQIITDAKELGQVKGDKIIADASEEASRLKTQAEADIQQSKTDAIASVKAEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SV +  +I+   ++ D  S + +  +  +   
Sbjct: 132 LSVLLAEKIMGSNLDKDAQSHLIDTYLDELGDA 164


>gi|16804571|ref|NP_466056.1| F0F1 ATP synthase subunit B [Listeria monocytogenes EGD-e]
 gi|224499886|ref|ZP_03668235.1| F0F1 ATP synthase subunit B [Listeria monocytogenes Finland 1988]
 gi|224503227|ref|ZP_03671534.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-561]
 gi|254828108|ref|ZP_05232795.1| atpF [Listeria monocytogenes FSL N3-165]
 gi|255016866|ref|ZP_05288992.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL F2-515]
 gi|284802971|ref|YP_003414836.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5578]
 gi|284996112|ref|YP_003417880.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5923]
 gi|81768746|sp|Q8Y4B8|ATPF_LISMO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|16412021|emb|CAD00611.1| atpF [Listeria monocytogenes EGD-e]
 gi|258600493|gb|EEW13818.1| atpF [Listeria monocytogenes FSL N3-165]
 gi|284058533|gb|ADB69474.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5578]
 gi|284061579|gb|ADB72518.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5923]
          Length = 170

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R +SE +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|157377620|ref|YP_001476220.1| F0F1 ATP synthase subunit B [Shewanella sediminis HAW-EB3]
 gi|226694917|sp|A8G1W9|ATPF_SHESH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157319994|gb|ABV39092.1| ATP synthase F0, B subunit [Shewanella sediminis HAW-EB3]
          Length = 156

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNINATLLGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQSK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++    +    EII  A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKDAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVATLAIYGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|332361636|gb|EGJ39440.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1056]
 gi|332363074|gb|EGJ40861.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK355]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAESARKKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|332880274|ref|ZP_08447952.1| ATP synthase F0, B subunit [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332681719|gb|EGJ54638.1| ATP synthase F0, B subunit [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 168

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   I   I+     P ++   +D     I   +  AR+  E+ + +  + +   +
Sbjct: 12  FWMVIIFGIVFFILAKYAFP-VITGMVDKRKQYIDSSLEAARQANEQLQQVKAESEALLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      +  E  +     +   L +   +I   K  A   +  ++A 
Sbjct: 71  RAHEEQTAILKEASATRDRIIAEARERARTEARKALDETRHQIAAEKESAINDIRRQVAI 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV++  +++ +K+ +D     +  + +  ++S + ++
Sbjct: 131 LSVDVAEKVLRKKLSDDKEQLELVNRLLDEVKSNNNIE 168


>gi|170729220|ref|YP_001763246.1| F0F1 ATP synthase subunit B [Shewanella woodyi ATCC 51908]
 gi|226694919|sp|B1KQ38|ATPF_SHEWM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|169814567|gb|ACA89151.1| ATP synthase F0, B subunit [Shewanella woodyi ATCC 51908]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNINATLLGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++    +    EII  A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKDAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVATLAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|104784438|ref|YP_610936.1| F0F1 ATP synthase subunit B [Pseudomonas entomophila L48]
 gi|122401174|sp|Q1I2I3|ATPF_PSEE4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|95113425|emb|CAK18153.1| ATP synthase F0, B subunit [Pseudomonas entomophila L48]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  +K RA  L +E  +     +       + +I       K  L
Sbjct: 61  VGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVKAQAQAEIEQELNSVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|149173279|ref|ZP_01851910.1| F0F1 ATP synthase subunit B [Planctomyces maris DSM 8797]
 gi|148848085|gb|EDL62417.1| F0F1 ATP synthase subunit B [Planctomyces maris DSM 8797]
          Length = 196

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 64/153 (41%), Gaps = 1/153 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D      +  ++F+ ++        L+  LD    ++   I  A   +++SE ++ ++  
Sbjct: 40  DLALWSLIVFVVFIFVL-RAFAWGPLIQALDERELRVITAINTAESKQKESEELVKEHAR 98

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K    ++E + +++ A+  A  + ++      Q +         +I   +  A + L+ +
Sbjct: 99  KIEAAQDEIQAMMVEARSDADRIKQDVLAQARQEAESIKTHAVDEIERARELALKDLFDQ 158

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           I    ++   +++ + +N+     +  + +S I
Sbjct: 159 INGRVIDATEQVLGRALNESDRDRLINEALSQI 191


>gi|145588211|ref|YP_001154808.1| ATP synthase F0, B subunit [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|226694351|sp|A4SUT0|ATPF_POLSQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145046617|gb|ABP33244.1| ATP synthase F0 subcomplex B subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M +   L  VV   +   L+  LD  + KI D +  A R +E       +
Sbjct: 1   MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ +K  +E  + +  A+ RA++ A+E   N +  +A  +   +Q        A+ +L
Sbjct: 61  AEQELTKARQEGVQRVAEAEKRAQMSADEIRANAQAEAARIITQAKQDADQQVTSAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  +V+   +I+ ++++   +  + ++  + +
Sbjct: 121 RAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL 156


>gi|294143110|ref|YP_003559088.1| ATP synthase F0 subunit B [Shewanella violacea DSS12]
 gi|293329579|dbj|BAJ04310.1| ATP synthase F0, B subunit [Shewanella violacea DSS12]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNINATLIGQTVAFILFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|70725929|ref|YP_252843.1| F0F1 ATP synthase subunit B [Staphylococcus haemolyticus JCSC1435]
 gi|88909587|sp|Q4L7Y8|ATPF_STAHJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68446653|dbj|BAE04237.1| ATP synthase B chain [Staphylococcus haemolyticus JCSC1435]
          Length = 176

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 66/152 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +     L+ ++       L   +D     I  DI EA   +  ++ +  + K+  
Sbjct: 23  TVIVTVITFAILLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E + I+  A+ +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 83  KQTQDEVQRILEDARVQARKQHEEIIHEANIRANGMIETAQSEINSEKERALADINNQVS 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + +K +    
Sbjct: 143 ELSVLIASKVLKKEISEQDQKELVDKYLKEAG 174


>gi|87121033|ref|ZP_01076924.1| ATP synthase subunit B [Marinomonas sp. MED121]
 gi|86163525|gb|EAQ64799.1| ATP synthase subunit B [Marinomonas sp. MED121]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +       F V      +   +++ L+  + KI D +  A R     E    +
Sbjct: 1   MNLNLTLIGQAISFAFFVWFCMKFVWPPVIAALEERSKKIADGLEAANRASRDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + +E+  EII  A  RA  + +E  +               +I    + AK  L
Sbjct: 61  ATHTLRESKEQAAEIIEQANKRANQIIDEAKEQALADGQRLRDAANSEIEQDVIRAKEAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++  ++    +I+   +++  +S + EK    +
Sbjct: 121 RAQVSQLALIGAEKILGASVDEKAHSELVEKLAQEL 156


>gi|224477096|ref|YP_002634702.1| F0F1 ATP synthase subunit B [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421703|emb|CAL28517.1| ATP synthase B chain [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 174

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 67/151 (44%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  ++ +I L ++        L   +D     I  DI +A + +  ++ +  + ++   
Sbjct: 23  LVTLITFLILLALL-KKFAWGPLKQVMDKREQDINKDIDDAEQAKINAQKLEEENRQTLR 81

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + + E ++I+  AK +A+   E+      Q +   ++  + +I+  K  A   +  +++ 
Sbjct: 82  ETQNEVQKILEEAKVQARDQHEQIIHEANQRANGMIETAQSEINSQKERAISEINDEVSK 141

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            SV I  +I+ + +++     + +K I  + 
Sbjct: 142 LSVLIASKILQKDISEKDQKELIDKYIKEVG 172


>gi|220936464|ref|YP_002515363.1| F0F1 ATP synthase subunit B [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997774|gb|ACL74376.1| F0F1 ATP synthase subunit B [Thioalkalivibrio sp. HL-EbGR7]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L  M     LV V    +   ++  +     KI D +  A R + + +    +
Sbjct: 1   MNINLTLLGQMITFGLLVWVTMKFVWPPIIQAMQERQKKIADGLAAAERGKHEQQLAEEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K+   + +++  EI+  A+ RA  + E                 + +I      A+  L
Sbjct: 61  AKQVLHEAKQQAAEIVAQAQKRANEIVEASKDTARVEGERIKASAQTEIEQEVHRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++   +V     I+ ++++   +  + +  ++ I
Sbjct: 121 RKQVGAIAVVGAERILKKEIDPKAHDQVIQDLVAQI 156


>gi|254831044|ref|ZP_05235699.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 10403S]
          Length = 170

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R +SE +L + 
Sbjct: 13  TFGDAFFTLFAFSILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEREQSNLIQDYIERLGDDK 170


>gi|73543032|ref|YP_297552.1| F0F1 ATP synthase subunit B [Ralstonia eutropha JMP134]
 gi|123623789|sp|Q46VX6|ATPF_RALEJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|72120445|gb|AAZ62708.1| ATP synthase F0, subunit B [Ralstonia eutropha JMP134]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 72/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + TF   M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATFFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +  ++   E  + +  A+ RA++ AEE  QN +  +A  +   + +       A+  L
Sbjct: 61  VDQAMAEARTEGAQRVADAEKRAQLTAEEIKQNAQAEAARIIAQAKAEAEQQVTRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V+S +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHSDLLNQLKAEL 156


>gi|319939419|ref|ZP_08013779.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
 gi|319811405|gb|EFW07700.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
          Length = 164

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L++++       + S  +  A KI DDI  A   R+K+E++  + + + +
Sbjct: 12  FILVAGSFLLLIVLIKKFAWDNITSTFEQRAKKISDDIDSAESARQKAEDLAQKRETELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   II  AK  A+        +    +    +   Q+I   K EA   +   +AD
Sbjct: 72  GSRQEATTIIENAKETAEKNKAGILADAADEAGRLKEKANQEIAQTKAEAMNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+ QK++ + +  + ++ I  +   
Sbjct: 132 LTVNLASKILGQKLDQEAHKELIDRYIDKLGDA 164


>gi|167036421|ref|YP_001671652.1| F0F1 ATP synthase subunit B [Pseudomonas putida GB-1]
 gi|170724360|ref|YP_001752048.1| F0F1 ATP synthase subunit B [Pseudomonas putida W619]
 gi|226694442|sp|B0KRB2|ATPF_PSEPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694443|sp|B1JFU5|ATPF_PSEPW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|166862909|gb|ABZ01317.1| ATP synthase F0, B subunit [Pseudomonas putida GB-1]
 gi|169762363|gb|ACA75679.1| ATP synthase F0, B subunit [Pseudomonas putida W619]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  +K RA  L EE        +         +I      AK  L
Sbjct: 61  AGQQLREAKAQAAEIIEQSKKRAAQLVEEARDQARVEADRVKAQALAEIEQELNSAKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|312964002|ref|ZP_07778473.1| ATP synthase F0, B subunit [Pseudomonas fluorescens WH6]
 gi|311282037|gb|EFQ60647.1| ATP synthase F0, B subunit [Pseudomonas fluorescens WH6]
          Length = 156

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVVFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  + + +  EII  AK R   + EE  +     +         +I       K  L
Sbjct: 61  VGHQLREAKAQAAEIIEQAKKRGNQIVEEAVEKARVEADRVKASAHAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|329113592|ref|ZP_08242372.1| ATP synthase subunit b [Acetobacter pomorum DM001]
 gi|326697114|gb|EGE48775.1| ATP synthase subunit b [Acetobacter pomorum DM001]
          Length = 167

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 70/147 (47%), Gaps = 1/147 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F V +S ++F  ++V  +I   + + LD+ A++IR+++ EA RLR ++E +L      
Sbjct: 8   AGFWVAVSFVLFF-VLVGKKIWGPIATILDSRANRIREELDEAARLRREAEQMLEDATRD 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +   E +  +  A  +A  +A++     E     + +    +I  ++  A + +    
Sbjct: 67  REQALAEAKSYVEQAHQQAAEMAQKARAEAEAAVQRHEQMARDRIAAVERAAIKEVRQLA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEK 151
            D +V+    +I Q +++   + + ++
Sbjct: 127 IDVAVQAANGVIPQTLDEQKAAGLVDQ 153


>gi|85858473|ref|YP_460675.1| ATP synthase B chain [Syntrophus aciditrophicus SB]
 gi|123515870|sp|Q2LQZ9|ATPF1_SYNAS RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|85721564|gb|ABC76507.1| ATP synthase B chain [Syntrophus aciditrophicus SB]
          Length = 202

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 67/149 (44%), Gaps = 1/149 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  II + +  +L   S + SF     ++I+  + EAR  +E +E+   +Y EK  K
Sbjct: 51  WRVLDFIILVGLFYWLLA-SKVKSFFSGRREEIKTTLEEARLAKEAAEHKFKEYSEKLDK 109

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E   +    + + +   E+  ++  + +A   +D + +I     +A + L  +    
Sbjct: 110 ASKEIEGVYEMIRAQGQAEKEKILEDARKAAAKMKEDTQARIEQELKKASQQLRMEAVQL 169

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
           SV +  +I+ + +  + + S+ +  +  +
Sbjct: 170 SVHVAEDILKRNITPEDHQSMVKDYLDKV 198


>gi|260432718|ref|ZP_05786689.1| ATP synthase B chain [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416546|gb|EEX09805.1| ATP synthase B chain [Silicibacter lacuscaerulensis ITI-1157]
          Length = 186

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 78/154 (50%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  I+F+ ++ Y ++P ++   LD  A  I+ ++ EAR L E++  +L  Y+ 
Sbjct: 29  NTDFVVSLGFIVFIAVLFYFKVPGMIGGALDNRAQGIQAELDEARALHEEARALLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ AAK  A + AE+   ++E+  A  L   + +I   +  A + +  +
Sbjct: 89  KQREVQAQADAIVAAAKEDAVLAAEQAKADLEKSIARRLAAAQDQIASAEAAAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               +V   + +++Q+M     + + +  I  + 
Sbjct: 149 AVAAAVAAAKSVLAQQMTAAQANKLIDDAIGEVG 182


>gi|32476313|ref|NP_869307.1| protein ATP synthase B chain [Rhodopirellula baltica SH 1]
 gi|32446858|emb|CAD78764.1| probable protein ATP synthase B chain [Rhodopirellula baltica SH 1]
          Length = 261

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 68/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +  L I+    +   +L  L A  +KIR+D+  A +   +++ +L  Y+ K  +
Sbjct: 110 WNLIIFLCVLAILSKF-VWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLDE 168

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              + + ++  A+  A+   ++     +  +A   +     I   K  A   +  + +  
Sbjct: 169 AASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSKL 228

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++++ R ++ ++++ D ++ +  +++  + S
Sbjct: 229 AMQVARSVVGRELSADDHADLIRQSMERLPS 259


>gi|313890505|ref|ZP_07824133.1| ATP synthase F0, B subunit [Streptococcus pseudoporcinus SPIN
           20026]
 gi|313121022|gb|EFR44133.1| ATP synthase F0, B subunit [Streptococcus pseudoporcinus SPIN
           20026]
          Length = 164

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    ++ L +++       +   L+  + KI  DI +A   R+ +E +  + + + +
Sbjct: 12  FILVSGSVLVLYLLIKKFAWGAISGILEERSVKIATDIDKAEEARQSAETLAQKRELELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             ++E  +II  AK   ++  ++   +  + ++      E  I   K +A   + A+++D
Sbjct: 72  GAKQEASQIITDAKELGQVKGDQIIADASEEASRLKTQAEADIQQSKTDAIASVKAEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SV +  +I+   ++ D  S + +  +  +   
Sbjct: 132 LSVLLAEKIMGSNLDKDAQSQLIDTYLDELGDA 164


>gi|227487989|ref|ZP_03918305.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227542631|ref|ZP_03972680.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227092080|gb|EEI27392.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227181829|gb|EEI62801.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 195

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ ++ L +     +P      L    D I+  I  A   + +++  L +Y  + +
Sbjct: 38  FWSLVAFLVILFVFWKFVLP-KFQEVLSEREDLIKGGIQRAEAAQAEAKQALEKYNSQLA 96

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E ++I   A+ R + +  E      + S   ++  E+++   + +    L   +  
Sbjct: 97  EARAEAQQIREEARERGEQIKAEMRAQAAEESNRIIEAGEKQLAAQREQVVSELRRDMGR 156

Query: 127 FSVEIVREIISQKMNDDVNSS-IFEKTISSIQ 157
            SV++   ++ Q+++DD+  S   +K ++ + 
Sbjct: 157 NSVDLAERLLGQQLSDDLTRSGTIDKFLADLD 188


>gi|257069068|ref|YP_003155323.1| ATP synthase F0 subcomplex B subunit [Brachybacterium faecium DSM
           4810]
 gi|256559886|gb|ACU85733.1| ATP synthase F0 subcomplex B subunit [Brachybacterium faecium DSM
           4810]
          Length = 179

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 70/154 (45%), Gaps = 2/154 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L+IF  + +   +P +  + LD  A+KI   I  A +++E+ + +    +++ + 
Sbjct: 23  WSLIFLVIFAGVFMKFVLPRM-NAVLDERAEKIEGGIRNAEKVQEQVDQLKSDQEQELAA 81

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E   I   A+   + + +E     +  S   L    Q++   ++ A   L  ++   
Sbjct: 82  ARQEAASIREKARADGQKIVDEARARADAESERVLAAGRQQLSAERIAASTELRGEVGTL 141

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCH 160
           + ++  +I+ + + +D+ +  + ++ +  ++S  
Sbjct: 142 ASDLASKIVGESLSDDERSRRVIDRFLDDLESSQ 175


>gi|327468904|gb|EGF14376.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK330]
          Length = 164

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|311740607|ref|ZP_07714434.1| ATP synthase F0 sector subunit B [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304127|gb|EFQ80203.1| ATP synthase F0 sector subunit B [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 189

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 68/159 (42%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  I+ L++   L +P      L    D+I   +  A+  + +++  L +Y  + +
Sbjct: 32  FWSLLCFIVILLLFWKLVLP-KYTKMLQEREDRIEGGLKRAKAQQAEAKAALEKYNAQLA 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  EI   A+ R K +  E   N E+ S   + + E+++   + +    L +++  
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTNAEEESRRIVANGEKQLEASRSQVVTELRSEMGQ 150

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
            S+ +  +I+  ++ +    SS  +  +S + S     K
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDSVAPAGK 189


>gi|255264092|ref|ZP_05343434.1| ATP synthase B chain (Subunit I) [Thalassiobium sp. R2A62]
 gi|255106427|gb|EET49101.1| ATP synthase B chain (Subunit I) [Thalassiobium sp. R2A62]
          Length = 185

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ ++ Y ++PS+L   LD  A  I+ D+ EA+ LRE+++ +L  Y+ 
Sbjct: 28  NTDFVVLLAFLLFIGVLFYFKVPSLLSGMLDGRATGIQADLDEAKALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ AAK  A   A++  ++I+   A  L   E +I   +  A + +   
Sbjct: 88  KQKEVQAQADRIVEAAKADASAAADQAREDIKTSVARRLSAAEDQIASAQASAVKEVRDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++    ++I+++      +S+ ++ I+++ +  
Sbjct: 148 AVTVAIAAATDVIAKQTTAADQNSLIDEAIATVGAKL 184


>gi|327458649|gb|EGF04997.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1057]
          Length = 164

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI +DI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISEDIDGAEAARQKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ D  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKDAQSELIDRYIKQLGDA 164


>gi|66048349|ref|YP_238190.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae
           B728a]
 gi|302185827|ref|ZP_07262500.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae 642]
 gi|81307752|sp|Q4ZL20|ATPF_PSEU2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|63259056|gb|AAY40152.1| ATP synthase F0, subunit B [Pseudomonas syringae pv. syringae
           B728a]
 gi|330970312|gb|EGH70378.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 156

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|241761302|ref|ZP_04759390.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752834|ref|YP_003225727.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|241374209|gb|EER63706.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258552197|gb|ACV75143.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 212

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 40/151 (26%), Positives = 79/151 (52%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V  S+I+FL+++V+ ++PSI+ S LD   D+IR  + +A RLR+++E +  +Y EK  +
Sbjct: 56  WVSASIIVFLLVLVWKKVPSIITSGLDKQIDEIRTRLGDAERLRKEAEALKAEYDEKTRQ 115

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   II  AK  A  +  +     +Q+     K   ++I   + EA   +    A  
Sbjct: 116 ATSEAEAIIERAKEDASSIIADAKIQSQQLVERRQKMATEQIAAAEQEAVAEIRQTAAKL 175

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +++   +II ++ +   +  + ++TI S++ 
Sbjct: 176 ALQAATQIIQKQNDASHDKVLIDQTIDSLKQ 206


>gi|99082431|ref|YP_614585.1| F0F1 ATP synthase subunit B [Ruegeria sp. TM1040]
 gi|123378663|sp|Q1GDE3|ATPF_SILST RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|99038711|gb|ABF65323.1| H+-transporting two-sector ATPase B/B' subunit [Ruegeria sp.
           TM1040]
          Length = 185

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 83/157 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++  ++PS++   LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTDFVVILAFLLFIGILLAAKVPSLIGKQLDNRADSIKSELEEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+  A+  A   AE+   ++    A  L   E++I   +  A + +  +
Sbjct: 88  KQQDVQAQAERIVANARDEAAAAAEQAKADLAASIARRLTAAEEQIASAEASAVKEVRDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +VE+  ++IS++M     + + +  I  +++  
Sbjct: 148 AITIAVEVADQVISKQMTAADANKLIDAAIQDVEAKL 184


>gi|121602072|ref|YP_988698.1| F0F1 ATP synthase subunit B [Bartonella bacilliformis KC583]
 gi|226741307|sp|A1URU5|ATPF_BARBK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120614249|gb|ABM44850.1| ATP synthase F0, B subunit family protein [Bartonella bacilliformis
           KC583]
          Length = 159

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 45/155 (29%), Positives = 91/155 (58%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ LI+FL ++ Y ++P++ L  LD  A +I  ++ EA RLRE+++ IL +Y++K 
Sbjct: 4   TFWAFIGLILFLALLFYFKVPAMALRSLDERAKRIAGELDEALRLREEAQGILAEYQQKC 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           + +E++ +EII AAKH A+I+  E     E+      K +EQKI   + +A + + +   
Sbjct: 64  AGIEQDVQEIITAAKHEAEIIVAEARVKTEEYVKNRNKLVEQKIAQAESDAIQEISSSAV 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + ++    +II+ ++     + + +++I  +++  
Sbjct: 124 NLAISSASKIINNELGAKKANDLIKESIIKVKTNL 158


>gi|269794327|ref|YP_003313782.1| ATP synthase F0 subcomplex subunit B [Sanguibacter keddieii DSM
           10542]
 gi|269096512|gb|ACZ20948.1| ATP synthase F0 subcomplex B subunit [Sanguibacter keddieii DSM
           10542]
          Length = 194

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 64/153 (41%), Gaps = 2/153 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + ++  + ++ Y  +     + LD    KI   + +A   + +++ +L QYK +  +
Sbjct: 34  WSAVVMVA-VGLMFYKLVLPKFTAILDERTAKIEGGLSKAEHAQAEADALLAQYKAQLQE 92

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +   I   A+  A  +  E      + SA   +  +++I   + +A   L   +   
Sbjct: 93  ARTDAARIREEARGEATAIVAEAKAKASEESARIFETAQRQIEAERQQASTSLRNDVGAL 152

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           + E+  +I+ + + +    S + ++ +  +++ 
Sbjct: 153 ATELASKIVGESLEDTARQSRVVDRFLDELEAS 185


>gi|289677533|ref|ZP_06498423.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae FF5]
 gi|330898622|gb|EGH30041.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330937316|gb|EGH41322.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330976389|gb|EGH76446.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 156

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         VI     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +         +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAHAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|88705413|ref|ZP_01103124.1| ATP synthase B chain [Congregibacter litoralis KT71]
 gi|88700503|gb|EAQ97611.1| ATP synthase B chain [Congregibacter litoralis KT71]
          Length = 156

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M   +  V+     +   +L+ +     KI + +  A +     E    +
Sbjct: 1   MNINLTLIGQMLAFVAFVVFCMKYVWPPILAAMQEREQKISEGLAAADQASHDLELAKEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +EE   I+ AA  RA  + +E  +     +       + +I      A+  L
Sbjct: 61  AVERLKEAKEEAAGIVDAANRRAAQIVDEAKEAAVAEADRVKAAAQAEIEQESNRAREQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  S+    +++   ++   ++ + +K  + +
Sbjct: 121 RGQVAMLSLAGAEKVLGASIDASAHAELVDKLAAEL 156


>gi|325690060|gb|EGD32064.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK115]
 gi|328945467|gb|EGG39618.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1087]
          Length = 164

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|317494639|ref|ZP_07953051.1| ATP synthase F0 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917241|gb|EFV38588.1| ATP synthase F0 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 156

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   ++  ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFILFVWFCMKYVWPPIMDAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQVIIEQANKRKAQIIDEAKVEAEQERNKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVATLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|315283685|ref|ZP_07871801.1| ATP synthase F0, B subunit [Listeria marthii FSL S4-120]
 gi|313612673|gb|EFR86699.1| ATP synthase F0, B subunit [Listeria marthii FSL S4-120]
          Length = 170

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 66/159 (41%), Gaps = 1/159 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R +SE +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARIESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   SV I  ++I + +++   S++ +  I  +    
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLGDDK 170


>gi|295697751|ref|YP_003590989.1| ATP synthase F0, B subunit [Bacillus tusciae DSM 2912]
 gi|295413353|gb|ADG07845.1| ATP synthase F0, B subunit [Bacillus tusciae DSM 2912]
          Length = 161

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 68/151 (45%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  ++ +I L  +        L+  L+   + I + +  A R RE++E +L +++    
Sbjct: 9   LVQLIAFLILLWFLSKF-AWKPLVKMLNDRREYIENQLSSAEREREEAERVLEEHRALVE 67

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K  ++  E +  A+  ++  A E     E  +    ++   +I   K +A   L  ++ +
Sbjct: 68  KARQDAHEWMENARRTSERQAAEILAAAETEARRIKEEALAEIQSEKEKALAELRDQVGE 127

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            SV +   I++++++   +  + ++ ++ + 
Sbjct: 128 LSVMLAGRILAKELDAKSHRELVDRALAEMG 158


>gi|332362652|gb|EGJ40450.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK49]
          Length = 164

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 70/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREESLA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              EE   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSREEAATIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVALASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|312114303|ref|YP_004011899.1| H+transporting two-sector ATPase B/B' subunit [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219432|gb|ADP70800.1| H+transporting two-sector ATPase B/B' subunit [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 161

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 42/160 (26%), Positives = 82/160 (51%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D    V ++ ++F+ +++Y  IP + L  LD  +D I  ++ EAR+LR ++E +L  
Sbjct: 1   MLMDPEVWVAIAFVLFICLILYYNIPGMALKALDQRSDAIGRELEEARKLRAEAETLLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK++ +  E E  EII  A+  A   A E   + +++    L   EQKI   + +A++ +
Sbjct: 61  YKQRAANAEIEAGEIIAQAEREAAAYATEARASFDELITRRLSVAEQKIKLEEEKARKQI 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            AK A+ +V    +++  K+   +  +    ++  I+   
Sbjct: 121 RAKAAELAVSAAEQLLQHKVTGKIAENTITASLDRIKKRL 160


>gi|26992092|ref|NP_747517.1| F0F1 ATP synthase subunit B [Pseudomonas putida KT2440]
 gi|81733163|sp|Q88BX0|ATPF_PSEPK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24987234|gb|AAN70981.1|AE016742_10 ATP synthase F0, B subunit [Pseudomonas putida KT2440]
 gi|313496407|gb|ADR57773.1| AtpF [Pseudomonas putida BIRD-1]
          Length = 156

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  +K RA  L +E  +     +         +I      AK  L
Sbjct: 61  AGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVKAQALAEIEQELNSAKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|323352618|ref|ZP_08087588.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
 gi|322121654|gb|EFX93400.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
          Length = 164

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + ++  +
Sbjct: 12  FIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREDALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|212637837|ref|YP_002314362.1| F0F1 ATP synthase subunit B [Shewanella piezotolerans WP3]
 gi|212559321|gb|ACJ31775.1| ATP synthase F0, subunit B [Shewanella piezotolerans WP3]
          Length = 156

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNINATLLGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++    +    EII +A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKDAKATANEIIESANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVAVLAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|258543512|ref|YP_003188945.1| ATP synthase F0 subunit beta' [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634590|dbj|BAI00566.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01]
 gi|256637646|dbj|BAI03615.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-03]
 gi|256640700|dbj|BAI06662.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-07]
 gi|256643755|dbj|BAI09710.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-22]
 gi|256646810|dbj|BAI12758.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-26]
 gi|256649863|dbj|BAI15804.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-32]
 gi|256652853|dbj|BAI18787.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655907|dbj|BAI21834.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-12]
          Length = 167

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 70/147 (47%), Gaps = 1/147 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F V +S ++F  ++V  +I   + + LD+ A++IR+++ EA RLR ++E +L      
Sbjct: 8   AGFWVAVSFVLFF-VLVGKKIWLPITTVLDSRANRIREELDEAARLRREAEQMLEDATRD 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +   E +  +  A  +A  +A++     E     + +    +I  ++  A + +    
Sbjct: 67  REQALAEAKSYVEQAHQQAAEMAQKARAEAEAAVQRHEQMARDRIAAVERAAVKEVRQLA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEK 151
            D +V+    +I Q +++   + + ++
Sbjct: 127 IDVAVQAANGVIPQTLDEQKAAGLVDQ 153


>gi|35436116|gb|AAO45674.1| AtpB [Streptococcus viridans]
          Length = 164

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 71/153 (46%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|325693993|gb|EGD35911.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK150]
          Length = 164

 Score = 84.9 bits (208), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVALASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|308051491|ref|YP_003915057.1| ATP synthase F0 subcomplex B subunit [Ferrimonas balearica DSM
           9799]
 gi|307633681|gb|ADN77983.1| ATP synthase F0 subcomplex B subunit [Ferrimonas balearica DSM
           9799]
          Length = 156

 Score = 84.9 bits (208), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T +      I  V      +   LL+ ++    KI D +  A R  +  +   ++
Sbjct: 1   MSINATLIGQAIAFIIFVWFCMKFVWPPLLAAIEERQKKIADGLANAERASKDLDLAQLK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +++  EII  A  R   + EE     E + A  +     +I   +  A+  L
Sbjct: 61  ATDQIKEGKQQAAEIIEQANKRGAQIVEEAKAEAEAVRAKIIAQGHAEIEAERNRARDQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  +V    +I+ + ++ D +S I EK  + +
Sbjct: 121 RAQVATLAVAGAEKILQRSIDADAHSDIVEKLAAEL 156


>gi|71736509|ref|YP_277284.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257485612|ref|ZP_05639653.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289628227|ref|ZP_06461181.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649117|ref|ZP_06480460.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298489525|ref|ZP_07007534.1| ATP synthase B chain [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|123634474|sp|Q48BG1|ATPF_PSE14 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71557062|gb|AAZ36273.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298155952|gb|EFH97063.1| ATP synthase B chain [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320321674|gb|EFW77773.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331123|gb|EFW87094.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330870062|gb|EGH04771.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330881921|gb|EGH16070.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330890264|gb|EGH22925.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. mori str.
           301020]
 gi|330952348|gb|EGH52608.1| F0F1 ATP synthase subunit B [Pseudomonas syringae Cit 7]
 gi|330987006|gb|EGH85109.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331011901|gb|EGH91957.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 156

 Score = 84.9 bits (208), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         VI     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|226695885|sp|A9GHS2|ATPF_SORC5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 247

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  +  +IVV       +   L      I  ++  A RL++++E  L +Y++K +++E
Sbjct: 83  VLNFGLLALIVVRFG-RKPIAEALKKRKQTITQELDNASRLKQEAELRLEEYEDKLTRLE 141

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           E   E+      +A++         EQ      +D E +       A+ +L  +    +V
Sbjct: 142 ETLAELKAEHAAQAEVEKAHVLAEAEQRRVRMRRDAEFRAEQELKAARAMLLQEAVQNAV 201

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSC 159
               E++ Q++       + E  + +I + 
Sbjct: 202 VAAEELLRQRIGQQDLDRVNEDYLKAIPAA 231


>gi|167626203|ref|YP_001676497.1| F0F1 ATP synthase subunit B [Shewanella halifaxensis HAW-EB4]
 gi|226694479|sp|B0TQF8|ATPF_SHEHH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167356225|gb|ABZ78838.1| ATP synthase F0, B subunit [Shewanella halifaxensis HAW-EB4]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L      +  V      +   L++ ++    KI D + +A R  +  E   ++
Sbjct: 1   MSINATLLGQAISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    +    EII  A  R   + +E     +   A  +     +I   +   K  L
Sbjct: 61  ATEQLKDAKATANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|310825289|ref|YP_003957647.1| ATP synthase B chain [Stigmatella aurantiaca DW4/3-1]
 gi|309398361|gb|ADO75820.1| ATP synthase B chain [Stigmatella aurantiaca DW4/3-1]
          Length = 182

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++  I + +V+  +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 21  FWTLVTF-ILVAVVLRWKAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKTAIA 79

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++   +   +   +E      + +        ++I   KL+A   +     D
Sbjct: 80  EARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTMAVD 139

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++E+  +++S++M+D  + ++ E+ +  +
Sbjct: 140 LAMEVAGKLLSERMDDAKHRALAEQFVQGL 169


>gi|56461723|ref|YP_157004.1| F0F1 ATP synthase subunit B [Idiomarina loihiensis L2TR]
 gi|81678428|sp|Q5QZI2|ATPF_IDILO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56180733|gb|AAV83455.1| F0F1-type ATP synthase, subunit b [Idiomarina loihiensis L2TR]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      I  V      +   ++  ++    KI D +    R ++  E    +
Sbjct: 1   MNINATLIGQTIAFIVFVWFCMKFVWPPIIKAIEERQKKIADGLNAGERAQKDLEKAQQE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +++  EII  +K R   + EE  Q   +     +    +++   +   +  L
Sbjct: 61  IAEQLKEAKQQAAEIIEQSKKRGAKIVEEETQRGHEEREKIVAAGHEEVAAERNRVREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V   ++II ++++ D +S I EK ++ +
Sbjct: 121 RKQVAVLAVSGAQKIIEREIDKDAHSDIVEKLVAEL 156


>gi|110678647|ref|YP_681654.1| F0F1 ATP synthase subunit B [Roseobacter denitrificans OCh 114]
 gi|123172761|sp|Q16AM5|ATPF_ROSDO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|109454763|gb|ABG30968.1| ATP synthase F0, B subunit [Roseobacter denitrificans OCh 114]
          Length = 188

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 38/157 (24%), Positives = 89/157 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V + L++F+ I+VY ++P ++   LD+ A+ I  ++ EAR LRE+++++L  Y+ 
Sbjct: 31  NTDFVVLLGLLVFIGILVYFKVPGMIGKMLDSRAEGIEAELNEARALREEAQSLLASYER 90

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ AAK  A I AE+   ++E   A  +   E +I   +  A + +  +
Sbjct: 91  KQREVQEQADRIVEAAKEEATIAAEQARADLEVSLARRMAAAEDQIASAQAAAIKEVRDQ 150

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++   +++I++++     +++ +  I+ +++  
Sbjct: 151 SVSIAIAAAQDVIAKQLTAADANALIDGAITEVEAKL 187


>gi|94312429|ref|YP_585639.1| F0F1 ATP synthase subunit B [Cupriavidus metallidurans CH34]
 gi|226694447|sp|Q1LHK6|ATPF_RALME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|93356281|gb|ABF10370.1| F0 sector of membrane-bound ATP synthase, subunit b [Cupriavidus
           metallidurans CH34]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 72/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + TF   M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATFFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +  ++   E  + +  A+ RA++ A+E  QN +  +A  +   + +       A+  L
Sbjct: 61  VDQAMAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQVTRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHADLLNQLKAEL 156


>gi|28378942|ref|NP_785834.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum WCFS1]
 gi|254557147|ref|YP_003063564.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300769657|ref|ZP_07079540.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181150|ref|YP_003925278.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|81631034|sp|Q88UT9|ATPF_LACPL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28271779|emb|CAD64685.1| H(+)-transporting two-sector ATPase, B subunit [Lactobacillus
           plantarum WCFS1]
 gi|254046074|gb|ACT62867.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300492700|gb|EFK27885.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308046641|gb|ADN99184.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 171

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 67/145 (46%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L+ ++ +     +   +   ADKI +DI  A++ R+++ ++  Q ++  S    E  
Sbjct: 24  FIVLMALISVVAWKPITKMMADRADKIANDIDSAQKSRQEASDLADQRRDALSHSRAEAS 83

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           EI+  AK   +        + +  +  Y ++  + I   + +A + + + +AD SV I  
Sbjct: 84  EIVADAKKSGEKQRSSIVADAQNEATQYKQNARKDIEQERQDALKNVQSDVADISVAIAT 143

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           +II ++++ +   ++    I  +  
Sbjct: 144 KIIKKQLDPEGQQALINSYIEGLGK 168


>gi|84385789|ref|ZP_00988819.1| hypothetical ATP synthase B chain [Vibrio splendidus 12B01]
 gi|86145160|ref|ZP_01063491.1| hypothetical ATP synthase B chain [Vibrio sp. MED222]
 gi|218676673|ref|YP_002395492.1| ATP synthase subunit B [Vibrio splendidus LGP32]
 gi|84379105|gb|EAP95958.1| hypothetical ATP synthase B chain [Vibrio splendidus 12B01]
 gi|85836737|gb|EAQ54857.1| hypothetical ATP synthase B chain [Vibrio sp. MED222]
 gi|218324941|emb|CAV26757.1| ATP synthase subunit B [Vibrio splendidus LGP32]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + +        +  V +    +   L + LD    +I D +  +    ++ E     
Sbjct: 1   MNLNASMFGQAISFVIFVWLCMKYVWPPLTAMLDERQKEIADGLRHSENAAKELELAKSN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +  +  ++   E+I   K R   +     Q  EQ  A  L+    ++   + + +R L
Sbjct: 61  GAQLVADAKKNVTELIEQGKKRRNEIITLAHQEGEQEKARILEQGRAELEGERQKLRREL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A +AD  ++  +++IS+ ++ + N ++ ++ IS +
Sbjct: 121 QADMADAVIQSAQKLISKNLDSETNRALVDQMISEL 156


>gi|329118576|ref|ZP_08247280.1| ATP synthase F0 sector subunit B [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465311|gb|EGF11592.1| ATP synthase F0 sector subunit B [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  ADKI + +  A R +   E    +
Sbjct: 1   MNLNATIFAQIIVFGILVWFTMKYVWPPIAKALDERADKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  +    +  E++  A+ RA  + E+   +    +A      +  +      A+  L
Sbjct: 61  VAELLADGRSQVAELVANAEKRASQIVEDAKSHAAVEAARITAQAKADVEQEVNRAREGL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  ++N   ++ +       +
Sbjct: 121 REQVAVLAVKGAEAILRSEVNAAKHADLLSNLKQEL 156


>gi|407170|emb|CAA81449.1| Adenosine Triphosphatase [Streptococcus pneumoniae]
 gi|1589420|prf||2211259C F0F1 ATPase:SUBUNIT=b
          Length = 164

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 71/153 (46%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEQSKANILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +IIS+ ++   +  + ++ I  +   
Sbjct: 132 LTVSLAGKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|148550499|ref|YP_001270601.1| F0F1 ATP synthase subunit B [Pseudomonas putida F1]
 gi|325275316|ref|ZP_08141269.1| F0F1 ATP synthase subunit B [Pseudomonas sp. TJI-51]
 gi|226694441|sp|A5WBA7|ATPF_PSEP1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148514557|gb|ABQ81417.1| ATP synthase F0, B subunit [Pseudomonas putida F1]
 gi|324099564|gb|EGB97457.1| F0F1 ATP synthase subunit B [Pseudomonas sp. TJI-51]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  +K RA  L EE  +     +         +I      AK  L
Sbjct: 61  AGQQLREAKAQAAEIIEQSKKRAAQLVEEAREQARVEADRVKAQALAEIEQELNSAKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|15642761|ref|NP_232394.1| F0F1 ATP synthase subunit B [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591532|ref|ZP_01678795.1| ATP synthase F0, B subunit [Vibrio cholerae 2740-80]
 gi|147674150|ref|YP_001218417.1| F0F1 ATP synthase subunit B [Vibrio cholerae O395]
 gi|153820050|ref|ZP_01972717.1| ATP synthase F0, B subunit [Vibrio cholerae NCTC 8457]
 gi|153821985|ref|ZP_01974652.1| ATP synthase F0, B subunit [Vibrio cholerae B33]
 gi|229508281|ref|ZP_04397785.1| ATP synthase B chain [Vibrio cholerae BX 330286]
 gi|229508633|ref|ZP_04398128.1| ATP synthase B chain [Vibrio cholerae B33]
 gi|229517151|ref|ZP_04406597.1| ATP synthase B chain [Vibrio cholerae RC9]
 gi|229606555|ref|YP_002877203.1| F0F1 ATP synthase subunit B [Vibrio cholerae MJ-1236]
 gi|254851559|ref|ZP_05240909.1| F0F1 ATP synthase subunit B [Vibrio cholerae MO10]
 gi|15213932|sp|Q9KNH1|ATPF_VIBCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696197|sp|A5F475|ATPF_VIBC3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|9657369|gb|AAF95907.1| ATP synthase F0, B subunit [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121546617|gb|EAX56809.1| ATP synthase F0, B subunit [Vibrio cholerae 2740-80]
 gi|126509407|gb|EAZ72001.1| ATP synthase F0, B subunit [Vibrio cholerae NCTC 8457]
 gi|126520524|gb|EAZ77747.1| ATP synthase F0, B subunit [Vibrio cholerae B33]
 gi|146316033|gb|ABQ20572.1| ATP synthase F0, B subunit [Vibrio cholerae O395]
 gi|227012004|gb|ACP08214.1| ATP synthase F0, B subunit [Vibrio cholerae O395]
 gi|229346214|gb|EEO11186.1| ATP synthase B chain [Vibrio cholerae RC9]
 gi|229354347|gb|EEO19275.1| ATP synthase B chain [Vibrio cholerae B33]
 gi|229354554|gb|EEO19476.1| ATP synthase B chain [Vibrio cholerae BX 330286]
 gi|229369210|gb|ACQ59633.1| ATP synthase B chain [Vibrio cholerae MJ-1236]
 gi|254847264|gb|EET25678.1| F0F1 ATP synthase subunit B [Vibrio cholerae MO10]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   ++  ++    KI D +  A R ++  +     
Sbjct: 1   MNMNATLLGQAISFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L
Sbjct: 61  ASDQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 RKQVATLAIAGAEKILERSIDKDTHKDILDNITAKL 156


>gi|329115988|ref|ZP_08244705.1| ATP synthase F0, B subunit [Streptococcus parauberis NCFD 2020]
 gi|326906393|gb|EGE53307.1| ATP synthase F0, B subunit [Streptococcus parauberis NCFD 2020]
          Length = 164

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 70/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    I+ L +++       +   LD  A KI +DI +A   R  +EN+ ++ +++  
Sbjct: 12  FILVTGSILVLYLLLKKFAWGQISGILDERAAKISNDIDKAENARINAENLQVERQKELD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + E  +II+ AK   +  + +  +     ++   +  +  I   K EA   +  +++D
Sbjct: 72  GAKSEASQIIVDAKEIGQAQSTKLIEEANDEASRLKEKADIDIERSKAEALSDVKNQMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            S+ +  +II   ++ D  S + +  ++ +   
Sbjct: 132 LSISLAEKIIGANLDKDAQSKLIDSYLNDLGEA 164


>gi|148975560|ref|ZP_01812431.1| hypothetical ATP synthase B chain [Vibrionales bacterium SWAT-3]
 gi|145964988|gb|EDK30239.1| hypothetical ATP synthase B chain [Vibrionales bacterium SWAT-3]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + +        +  V +    +   L + LD    +I D +  +    ++ E     
Sbjct: 1   MNLNASMFGQAISFVIFVWLCMKYVWPPLTAMLDERQKEIADGLRHSENAAKELELAKSN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +     +    E+I   K R   +     +  EQ  A  L+    ++   + + +R L
Sbjct: 61  GAQLVEDAKRNVTELIEQGKKRRNEIISLAHEEAEQEKARILEQGRAELESERQKLRREL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A +AD  ++  +++I++ ++ + N ++ ++ IS +
Sbjct: 121 QADMADAVIQSAQKLINKNLDSETNRALVDQLISEL 156


>gi|288922991|ref|ZP_06417148.1| ATP synthase F0, B subunit [Frankia sp. EUN1f]
 gi|288345667|gb|EFC80039.1| ATP synthase F0, B subunit [Frankia sp. EUN1f]
          Length = 192

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/151 (11%), Positives = 60/151 (39%), Gaps = 2/151 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  + +    +   P  +        ++I   +  A   + +++ +L QY+ + ++  
Sbjct: 31  LLAFGLLVGFFFWKIYPQ-VRKTYAERTERIEGGLKRAETAQAEAQVLLEQYRSQLAEAR 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+ + + + EE     +Q  A   +  +  +   + +    +  +I + ++
Sbjct: 90  TEAARIREDAQAQGRQIVEELRAQAQQEVAEIRERADATLVAERAQVVASVRREIGEIAL 149

Query: 130 EIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           E+   I+  ++ +D     + +  I+ +   
Sbjct: 150 ELATRIVGHELESDASQRQLVDDFIAGLDEA 180


>gi|319893058|ref|YP_004149933.1| ATP synthase B chain [Staphylococcus pseudintermedius HKU10-03]
 gi|317162754|gb|ADV06297.1| ATP synthase B chain [Staphylococcus pseudintermedius HKU10-03]
          Length = 172

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 70/150 (46%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V +   + L+ ++       L   +D     I  DI +A R +  ++ +  + ++K  +
Sbjct: 21  IVTVVTFLILLALLRKFAWGPLKKVMDDRERSINQDIDDAERAKLNAQRLEEENRQKLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E  +I+  AK +A+   EE      Q +   L+  + +I   K  A   +  ++++ 
Sbjct: 81  TQDEVHKILEDAKLQARRQQEEILHEANQRANGMLETAQSEIKSEKERALAEINNQVSEL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           SV I  +++ +++++    ++ EK +  + 
Sbjct: 141 SVLIASKVLRKEISEQDQKALIEKYVKEVG 170


>gi|307706800|ref|ZP_07643605.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
 gi|307617885|gb|EFN97047.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
          Length = 164

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 71/153 (46%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEILAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  A+  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENARETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|90409879|ref|ZP_01217896.1| hypothetical ATP synthase B chain [Photobacterium profundum 3TCK]
 gi|90329232|gb|EAS45489.1| hypothetical ATP synthase B chain [Photobacterium profundum 3TCK]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V +    +   L + +D    +I + + +     ++ E     
Sbjct: 1   MNLNATMLGQAISFVIFVWLCMKYVWPPLTALIDERQREIAEGLSQMDLAAKELELAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + ++   +++     R   + E+     +   A  +   + ++   +   ++ L
Sbjct: 61  GDQLMVEAKQSASDLVEQGNKRRSQIIEDAKLEGDTEKARIIAQGQSELESERNRLRQEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++D  +E   ++I + +++  N     K I+ +
Sbjct: 121 RQEMSDLVIESAEKLIKRNLDNAANREFVNKLITEM 156


>gi|146309624|ref|YP_001190089.1| ATP synthase F0, B subunit [Pseudomonas mendocina ymp]
 gi|226694440|sp|A4Y191|ATPF_PSEMY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145577825|gb|ABP87357.1| ATP synthase F0 subcomplex B subunit [Pseudomonas mendocina ymp]
          Length = 156

 Score = 84.9 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 53/156 (33%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T           V      +   L   +     KI + +  A R     +    +
Sbjct: 1   MNINLTLFGQTIAFAIFVWFCMKFVWPPLTQAMQERQKKIAEGLDAAGRAERDLQLAQER 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + +E+  EI+  A   A  + EE            +   + +I      AK  L
Sbjct: 61  AAQMLRETKEQAAEILDRANKTANAIVEEAKAQARSEGEKLIAGAKAEIDLEVNRAKDQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  +V    +I+   ++   ++ +  K  S +
Sbjct: 121 RAQVAALAVTGAEQILQSTVDGAAHNDLVAKLASQL 156


>gi|324995407|gb|EGC27319.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK678]
          Length = 164

 Score = 84.5 bits (207), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|322387997|ref|ZP_08061604.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
 gi|321141270|gb|EFX36768.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
          Length = 164

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ +V       + S LD  A+KI  DI  A   R+K+E +  + + + +
Sbjct: 12  FILIAGSFLLLIFLVKKYAWGNITSVLDERAEKISSDIDGAEEARKKAEELASKREAELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +     +  +    +   Q+I   K EA + +   +AD
Sbjct: 72  GSRTEAKTIIENAKETAEKSKADILAEAKLEAGRLKEKANQEIAQNKAEALQSVKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGQAHKELIDQYIDQLGEA 164


>gi|154251150|ref|YP_001411974.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|226694373|sp|A7HQY4|ATPF1_PARL1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|154155100|gb|ABS62317.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 161

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 47/160 (29%), Positives = 80/160 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M     F +   L+ F  I+ Y ++   L + LD  A  I  ++ EARRLRE+++ +L  
Sbjct: 1   MFATAEFWILACLVAFFAILGYFKVHRTLAATLDKRAADIAAELDEARRLREEAQQLLAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K  +  +E  +I+  AK  A+ LA+E   N+E       K  E KI   + +A   +
Sbjct: 61  YQRKQREAMKEAEDIVAQAKVEAEQLAKETRANMEIQVERRTKLAEDKIAQAETQALNDV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            A  A+ +V   R +I+ K++   ++   EK+IS + S  
Sbjct: 121 RATAAEVAVGAARRVIAAKVDAGKDAEFVEKSISELTSKL 160


>gi|113972256|ref|YP_736049.1| F0F1 ATP synthase subunit B [Shewanella sp. MR-4]
 gi|114049505|ref|YP_740055.1| F0F1 ATP synthase subunit B [Shewanella sp. MR-7]
 gi|123030130|sp|Q0HPF7|ATPF_SHESR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123129970|sp|Q0HD75|ATPF_SHESM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|113886940|gb|ABI40992.1| ATP synthase F0, B subunit [Shewanella sp. MR-4]
 gi|113890947|gb|ABI44998.1| ATP synthase F0, B subunit [Shewanella sp. MR-7]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      I  V      +   L++ ++A   +I D + +A R  +  E    +
Sbjct: 1   MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I  K ++ I
Sbjct: 121 RKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|197124854|ref|YP_002136805.1| ATP synthase F0 subunit beta [Anaeromyxobacter sp. K]
 gi|226741291|sp|B4UJU5|ATPF_ANASK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|196174703|gb|ACG75676.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. K]
          Length = 179

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 69/155 (44%), Gaps = 1/155 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ LV++        ++  L      IR+ I  A++ R ++E +L   KE  
Sbjct: 24  TLWTAITFLVMLVVLGKF-AWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +K + E  E+    +   + L +E      + +   + +  ++I     +AK  L A++ 
Sbjct: 83  AKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELGKAKTELKAQVV 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           D +++    ++   +++    ++ E+ I+ + +  
Sbjct: 143 DLAIDAASRLVKANLDEKAQRALVEEYIAQLPANR 177


>gi|70733503|ref|YP_263278.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens Pf-5]
 gi|123651840|sp|Q4K3A5|ATPF_PSEF5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68347802|gb|AAY95408.1| ATP synthase F0, B subunit [Pseudomonas fluorescens Pf-5]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     I   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKFIWPPVIAALHERQKKIADGLDAASRAARDLELAQDK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +       + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIIEQAKKRGSQIVDEAREQARVEAERVKAQAQAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|298294369|ref|YP_003696308.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
 gi|296930880|gb|ADH91689.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
          Length = 204

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 59/147 (40%), Gaps = 1/147 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            + ++     +++  + +P  + + L+   D+I DD+ EA +L+ +SE     Y++  + 
Sbjct: 58  WLAIAFGALYLLMSRIALPR-IANILEERHDRIADDLEEAGKLKAESEAAAYAYEQALAS 116

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +   I    + +    +E G +++E   +  L   E +I   K  A   +     D 
Sbjct: 117 ARNKAHGIATETRDKLAADSEAGRKSLEAELSAKLAAAETQIAATKDAAMSNVRGIAVDA 176

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTIS 154
           +  IV  +I          +  +  I 
Sbjct: 177 AGAIVGNLIGTAPAPQAVEAAVDTAIK 203


>gi|269128117|ref|YP_003301487.1| ATP synthase F0 subunit B [Thermomonospora curvata DSM 43183]
 gi|268313075|gb|ACY99449.1| ATP synthase F0, B subunit [Thermomonospora curvata DSM 43183]
          Length = 182

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 65/152 (42%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +S  I L++V +  +P  +   L    D I   +  A   + +++  L +Y+++ ++
Sbjct: 24  FGTISFAIVLIVVGWKLVPQ-IQKTLAERTDAIEGGLKRAEEAQREAQATLAEYQKQLAE 82

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+     +  +  +  +  +   ++  +  I   + +A + L  ++   
Sbjct: 83  ARAEAARLREKAREEGAQIVAQMREEAQAEARRIVESAQATIEAERQQALQQLRTEVGAL 142

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +VE+   ++ + + +    S + ++ ++ ++ 
Sbjct: 143 AVELASRVVGEALADQAAQSRVIDRFLAELEE 174


>gi|227513062|ref|ZP_03943111.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227524277|ref|ZP_03954326.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083637|gb|EEI18949.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227088508|gb|EEI23820.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
          Length = 169

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +S +I +  ++ L   + +   +   +DKI +DI  A+  R+K+  +  Q + +  K
Sbjct: 18  FVMISFLILM-FLIKLIAWNPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQAQLDK 76

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             E+   +I  AK   +   E+  ++    ++      E+ I   + EA       +A  
Sbjct: 77  TREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRKDVASL 136

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           S+EI  +IIS+++N+     + +  I  +    
Sbjct: 137 SIEIATKIISKELNEQDQKGLVDSYIEGLGKQK 169


>gi|205354548|ref|YP_002228349.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|226694466|sp|B5RFV9|ATPF_SALG2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|205274329|emb|CAR39353.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|326629683|gb|EGE36026.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEVQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|116493069|ref|YP_804804.1| F0F1-type ATP synthase, subunit b [Pediococcus pentosaceus ATCC
           25745]
 gi|122265467|sp|Q03EL0|ATPF_PEDPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116103219|gb|ABJ68362.1| ATP synthase F0 subcomplex B subunit [Pediococcus pentosaceus ATCC
           25745]
          Length = 173

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 61/149 (40%)

Query: 12  SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEE 71
            L I L+ ++       + + L   AD+I +DI  A + R ++E +  Q KE       E
Sbjct: 25  ILFIVLMALIAKFAWGPVNAMLKERADRISNDIDSAEQSRIEAEKLAKQRKEALDNSHAE 84

Query: 72  TREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI 131
              II  AK       E    N +  +       +Q I   + +A +     IA  S+EI
Sbjct: 85  ATSIINNAKDSGAKERELIIGNAQNEAKSLKDKAKQDIEQERADALKSAQDDIASLSIEI 144

Query: 132 VREIISQKMNDDVNSSIFEKTISSIQSCH 160
             ++I ++++++    + +  I  +    
Sbjct: 145 ASKVIKKELDENSQKDLIDSYIEGLGDSK 173


>gi|313669156|ref|YP_004049440.1| ATP synthase B chain [Neisseria lactamica ST-640]
 gi|313006618|emb|CBN88084.1| ATP synthase B chain [Neisseria lactamica 020-06]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +   Q +A  +   +  +      A+ +L
Sbjct: 61  VAELMAEGRNQVTEMVANAEKRAAKIVEEAKEQASQEAARIVAQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVASLAVKGAESILRKEVDASKHADLLSTLKQEL 156


>gi|113869577|ref|YP_728066.1| F0F1 ATP synthase subunit B [Ralstonia eutropha H16]
 gi|123133498|sp|Q0K5M3|ATPF_RALEH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|113528353|emb|CAJ94698.1| Membrane-bound ATP synthase, F0 sector,subunitb [Ralstonia eutropha
           H16]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 72/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + TF   M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATFFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +  ++   E  + +  A+ RA++ A+E  QN +  +A  +   + +       A+  L
Sbjct: 61  VDQAMAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQVTRAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHTDLLNQLKAEL 156


>gi|332143477|ref|YP_004429215.1| F0F1 ATP synthase subunit B [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553499|gb|AEB00218.1| F0F1 ATP synthase subunit B [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ TF+  +      V+     +   L++ ++    KI D +  + R  +  E    +
Sbjct: 1   MNFNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  EII  AK RA  L +E  Q         +     +I   +  AK  L
Sbjct: 61  ATEQLKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYAEIEAERNRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V   ++I+ ++++    + I EK ++ +
Sbjct: 121 RKQVSALAVAGAQQILQREIDASAQNDIVEKLVAEL 156


>gi|229515965|ref|ZP_04405422.1| ATP synthase B chain [Vibrio cholerae TMA 21]
 gi|229347065|gb|EEO12027.1| ATP synthase B chain [Vibrio cholerae TMA 21]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   ++  ++    KI D +  A R ++  +     
Sbjct: 1   MNMNATLLGQTIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L
Sbjct: 61  ASDQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 RKQVATLAIAGAEKILERSIDKDTHKDILDNITAKL 156


>gi|145301176|ref|YP_001144017.1| F0F1 ATP synthase subunit B [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|226694427|sp|A4STP7|ATPF_AERS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|142853948|gb|ABO92269.1| F0F1 ATP synthase subunit B [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L      I  V      +   L++ ++A    I D +  A R ++  +     
Sbjct: 1   MSINATLLGQTLAFIIFVWCCMKFVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  +II  A  R   + +E            L     +I   +  AK  L
Sbjct: 61  ATDQLKEAKLQAAQIIEQANKRKAQIIDEAAVGAHTEREKILAQGRAEIDAERHRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+++ ++   NS I +K ++ +
Sbjct: 121 RKQVAALAIAGAEKILARHIDQAANSDIVDKLVAEL 156


>gi|227503865|ref|ZP_03933914.1| F0F1 ATP synthase subunit B [Corynebacterium striatum ATCC 6940]
 gi|227199488|gb|EEI79536.1| F0F1 ATP synthase subunit B [Corynebacterium striatum ATCC 6940]
          Length = 188

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 63/159 (39%), Gaps = 2/159 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  ++ L  + +  +       L    D+I   +  A   + +++  L +Y  + +
Sbjct: 31  FWSLICFVVILW-LFWKFVLPAYNKMLQEREDRIEGGMKRAEAQQAEAKAALEKYNAQLA 89

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  EI   A+ R K +  E     E+ S   +   E+++   + +    L ++I  
Sbjct: 90  DARAEAAEIREQARERGKQIEAEAKSQAEEESRRIVASGEKQLQASRAQVISELRSEIGQ 149

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQMDK 164
            S+ +  +++  +++     SS  +  +S + S     K
Sbjct: 150 NSINLAEKLLGGELSSATKQSSTIDTFLSELDSVAPAGK 188


>gi|260590645|ref|ZP_05856103.1| ATP synthase F0, B subunit [Prevotella veroralis F0319]
 gi|260537386|gb|EEX20003.1| ATP synthase F0, B subunit [Prevotella veroralis F0319]
          Length = 170

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 69/154 (44%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  ++   I+     PSI+   ++   + I + + +A     +  NI  Q +E   
Sbjct: 12  FWMTIVFLVVFFILWRWGFPSII-KMVNERKNYIDESLAKAEEANLRLANIQKQGEELLM 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E+  +   + SA  L + + +I   K  A R + +++A+
Sbjct: 71  EAREKQAQILREASQTRDSIVEQAQEKAHEESARILSEAKAEIESQKQAAIRDIRSQVAE 130

Query: 127 FSVEIVREIISQKMNDDV-NSSIFEKTISSIQSC 159
            SV+I  +I+ +++      + + +  +  + S 
Sbjct: 131 LSVQIAEKILRKQLTTSAEQAQLIDSLLDEVASS 164


>gi|153869493|ref|ZP_01999080.1| ATP synthase F0, subunit B [Beggiatoa sp. PS]
 gi|152074016|gb|EDN70920.1| ATP synthase F0, subunit B [Beggiatoa sp. PS]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M    T    +     LVI V+  +   +   ++    KI D +  A R +   E    +
Sbjct: 1   MSITVTLFGQILTFAALVIFVWQFLWGPMTKMMEERRAKIADGLAAADRGKHDLELAEHR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +     +++  + I +   RA  + EE  Q         L     +I      A+  L
Sbjct: 61  AAQIIRDAKQDATDFIASGNKRATEIIEEAKQQARVEGKRQLDVALSEIEQEINRAREDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++ + +++   +I+ ++++   +    +  +  I
Sbjct: 121 RKQVVNLALKTAEKILEREVDVKTHDVFIDDMMKKI 156


>gi|117922565|ref|YP_871757.1| F0F1 ATP synthase subunit B [Shewanella sp. ANA-3]
 gi|226694916|sp|A0L2T2|ATPF_SHESA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117614897|gb|ABK50351.1| ATP synthase F0, B subunit [Shewanella sp. ANA-3]
          Length = 156

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ T +      I  V      +   L++ ++A   +I D + +A R  +  E    +
Sbjct: 1   MNFNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKATANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I  K ++ I
Sbjct: 121 RKQVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|4100653|gb|AAD00914.1| proton-translocating ATPase b subunit [Streptococcus sanguinis]
          Length = 164

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 69/153 (45%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDGAEAARKKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        +  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|289168152|ref|YP_003446421.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307705151|ref|ZP_07642026.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|322376879|ref|ZP_08051372.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
 gi|288907719|emb|CBJ22556.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307621290|gb|EFO00352.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|321282686|gb|EFX59693.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
          Length = 164

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 71/153 (46%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|323463887|gb|ADX76040.1| ATP synthase F0, B subunit [Staphylococcus pseudintermedius ED99]
          Length = 172

 Score = 84.5 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 71/150 (47%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V ++  + L+ ++       L   +D     I  DI +A R +  ++ +  + ++K  +
Sbjct: 21  IVTVATFLILLALLRKFAWGPLKKVMDDRERSINQDIDDAERAKLNAQRLEEENRQKLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E  +I+  AK +A+   EE      Q +   L+  + +I   K  A   +  ++++ 
Sbjct: 81  TQDEVHKILEDAKLQARRQQEEILHEANQRANGMLETAQSEIKSEKERALAEINNQVSEL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           SV I  +++ +++++    ++ EK +  + 
Sbjct: 141 SVLIASKVLRKEISEQDQKALIEKYVKEVG 170


>gi|221195234|ref|ZP_03568290.1| ATP synthase F0, B subunit [Atopobium rimae ATCC 49626]
 gi|221185137|gb|EEE17528.1| ATP synthase F0, B subunit [Atopobium rimae ATCC 49626]
          Length = 203

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 60/154 (38%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +   + +  V+       +L  +++  +KI++D+  A     K+          
Sbjct: 45  AEFIPALIAFLIIWFVLGKFAWPSILKMMESRQEKIQEDLDAAENSHIKAAEDQKAAAAS 104

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +   +  EI+ AAK   +       +  ++ ++  +      +   +      L + +
Sbjct: 105 IDEARRKADEIVSAAKREGEEERAHIIEQAKKEASDIIAKGHSAVDSERRRCLTDLSSSV 164

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D SVEI  +II  ++++     + EK ++ +  
Sbjct: 165 VDLSVEIAGKIIGNELDEAQQRRLAEKYLAEVGK 198


>gi|227510133|ref|ZP_03940182.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227190338|gb|EEI70405.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 169

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
            V +S +I +  ++ L   + +   +   +DKI +DI  A+  R+K+  +  Q + +  K
Sbjct: 18  FVMISFLILMY-LIKLIAWNPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQAQLDK 76

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             E+   +I  AK   +   E+  ++    ++      E+ I   + EA       +A  
Sbjct: 77  TREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRKDVASL 136

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           S+EI  +IIS+++N+     + +  I  +    
Sbjct: 137 SIEIATKIISKELNEQDQKGLVDSYIEGLGKQK 169


>gi|35436123|gb|AAO45677.1| AtpB [Streptococcus viridans]
          Length = 164

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 71/153 (46%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IIS+ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISENLDGHAHKELIDQYIDQLGEA 164


>gi|293365285|ref|ZP_06612002.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307703825|ref|ZP_07640766.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
 gi|291316735|gb|EFE57171.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307622660|gb|EFO01656.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
          Length = 164

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +IIS+ ++   +  + ++ I  +   
Sbjct: 132 LTVSLAGKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|299821857|ref|ZP_07053745.1| ATP synthase F0 sector subunit B [Listeria grayi DSM 20601]
 gi|299817522|gb|EFI84758.1| ATP synthase F0 sector subunit B [Listeria grayi DSM 20601]
          Length = 176

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               ++ II L  ++ +     L+  +    + I  +I  A   R ++E +L + K+   
Sbjct: 25  LFTLVAFIILLA-LIRIFAWKPLMGIMKEREEHIASEIDAAEESRAQAEGLLEEQKQVLK 83

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E + +I  AK   +   E   Q     S    ++ +  I   K +A   L  ++  
Sbjct: 84  EARVEAQNMIENAKQLGEKERESIIQTARSESERLKEEAKSDIAREKEDAIAALRDQVGS 143

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            SV I  ++I + ++++  SS+ E+ I  + 
Sbjct: 144 LSVLIASKVIEKNLDEEAQSSLIEEYIERLD 174


>gi|221135165|ref|ZP_03561468.1| F0F1 ATP synthase subunit B [Glaciecola sp. HTCC2999]
          Length = 156

 Score = 84.5 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   LL  ++    KI D +  + R  +   +   Q
Sbjct: 1   MNINATLIGQAIAFAVFVWFCMKFVWPPLLGAIEERQKKIADGLEASDRAEQDLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + + +  +II  AK RA +L +E  Q         +     +I   +  AK  L
Sbjct: 61  AAEQLKEAKAQAADIIEQAKKRANVLVDEETQRGHSEREKIIAQGYAEIEAERNRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  ++    +I++++++ D  + I  K +  +
Sbjct: 121 RKQVSALAIAGAEKILAREIDKDAQADIVAKLVDEL 156


>gi|332995864|gb|AEF05919.1| F0F1 ATP synthase subunit B [Alteromonas sp. SN2]
          Length = 156

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 68/156 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ TF+  +      V+     +   L++ ++    KI D +  + R  +  E    +
Sbjct: 1   MNFNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  EII  AK RA  L +E  Q         +     +I   +  AK  L
Sbjct: 61  ATEQMKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYTEIEAERNRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V   ++I+ ++++ +  + I EK ++ +
Sbjct: 121 RKQVSALAVAGAQQILQREIDANAQNDIVEKLVAEL 156


>gi|242241383|ref|YP_002989564.1| F0F1 ATP synthase subunit B [Dickeya dadantii Ech703]
 gi|242133440|gb|ACS87742.1| ATP synthase F0, B subunit [Dickeya dadantii Ech703]
          Length = 156

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++        
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + I+  A  +   + EE     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQHIVEQANKQRAQILEEAKTEAEVERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|121729378|ref|ZP_01682045.1| ATP synthase F0, B subunit [Vibrio cholerae V52]
 gi|153212960|ref|ZP_01948554.1| ATP synthase F0, B subunit [Vibrio cholerae 1587]
 gi|153803701|ref|ZP_01958287.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-3]
 gi|153827185|ref|ZP_01979852.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-2]
 gi|153829657|ref|ZP_01982324.1| ATP synthase F0, B subunit [Vibrio cholerae 623-39]
 gi|227082880|ref|YP_002811431.1| ATP synthase F0, B subunit [Vibrio cholerae M66-2]
 gi|229520157|ref|ZP_04409584.1| ATP synthase B chain [Vibrio cholerae TM 11079-80]
 gi|229524897|ref|ZP_04414302.1| ATP synthase B chain [Vibrio cholerae bv. albensis VL426]
 gi|229530220|ref|ZP_04419609.1| ATP synthase B chain [Vibrio cholerae 12129(1)]
 gi|254226936|ref|ZP_04920502.1| ATP synthase F0, B subunit [Vibrio cholerae V51]
 gi|254291144|ref|ZP_04961941.1| ATP synthase F0, B subunit [Vibrio cholerae AM-19226]
 gi|297581986|ref|ZP_06943906.1| ATP synthase F0 [Vibrio cholerae RC385]
 gi|298501180|ref|ZP_07010979.1| ATP synthase F0, B subunit [Vibrio cholerae MAK 757]
 gi|121628659|gb|EAX61131.1| ATP synthase F0, B subunit [Vibrio cholerae V52]
 gi|124116186|gb|EAY35006.1| ATP synthase F0, B subunit [Vibrio cholerae 1587]
 gi|124120763|gb|EAY39506.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-3]
 gi|125620541|gb|EAZ48909.1| ATP synthase F0, B subunit [Vibrio cholerae V51]
 gi|148874833|gb|EDL72968.1| ATP synthase F0, B subunit [Vibrio cholerae 623-39]
 gi|149738908|gb|EDM53232.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-2]
 gi|150422989|gb|EDN14939.1| ATP synthase F0, B subunit [Vibrio cholerae AM-19226]
 gi|227010768|gb|ACP06980.1| ATP synthase F0, B subunit [Vibrio cholerae M66-2]
 gi|229332353|gb|EEN97840.1| ATP synthase B chain [Vibrio cholerae 12129(1)]
 gi|229338478|gb|EEO03495.1| ATP synthase B chain [Vibrio cholerae bv. albensis VL426]
 gi|229342751|gb|EEO07742.1| ATP synthase B chain [Vibrio cholerae TM 11079-80]
 gi|297533853|gb|EFH72694.1| ATP synthase F0 [Vibrio cholerae RC385]
 gi|297540052|gb|EFH76114.1| ATP synthase F0, B subunit [Vibrio cholerae MAK 757]
          Length = 156

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   ++  ++    KI D +  A R ++  +     
Sbjct: 1   MNMNATLLGQAIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L
Sbjct: 61  ASDQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 RKQVATLAIAGAEKILERSIDKDTHKDILDNITAKL 156


>gi|149675735|dbj|BAF64749.1| FOF1-type ATP synthase b subunit [Shewanella livingstonensis]
          Length = 159

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 63/155 (40%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           +F+ T        I  V      +   L++ ++    KI D + +A R  +  E   ++ 
Sbjct: 5   NFNATLFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKA 64

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
            E+  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L 
Sbjct: 65  TEQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLR 124

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++A  ++    +I+ + ++ + +S I  K ++ I
Sbjct: 125 KQVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI 159


>gi|327482895|gb|AEA86205.1| ATP synthase B chain [Pseudomonas stutzeri DSM 4166]
          Length = 152

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++  IF+   + L +   + + + A   KI + +  A R ++  +    +      
Sbjct: 4   FGQTLAFAIFVWFCMKL-VWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDKVSHTLR 62

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + +E+  +II  A   A  + EE  Q         +     +I      A+  L +++A 
Sbjct: 63  ETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQLRSQVAA 122

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +V    +I+  +++  V++ + EK  S +
Sbjct: 123 LAVAGAEKILESQVDAKVHNELVEKLASQL 152


>gi|157150236|ref|YP_001450825.1| F0F1 ATP synthase subunit B [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283124|ref|ZP_06060891.1| predicted protein [Streptococcus sp. 2_1_36FAA]
 gi|226695878|sp|A8AYG5|ATPF_STRGC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157075030|gb|ABV09713.1| ATP synthase F0, B subunit [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262261376|gb|EEY80075.1| predicted protein [Streptococcus sp. 2_1_36FAA]
          Length = 164

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 67/153 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L++++       + S  +  A KI DDI  A   R+ +E +  + +E  +
Sbjct: 12  FILVAGSFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARKNAEVLEQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              EE   I+  AK  A+        +  +  +   +   Q+I   K EA R +   +AD
Sbjct: 72  GSREEAATIVETAKETAEKNKASILADTTEEVSRLKQKANQEIAQSKAEALRSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            S+++  +II Q ++ +  S + +  I  +   
Sbjct: 132 LSIDLASKIIGQTLDKEAQSQLIDSYIDKLGDA 164


>gi|90409085|ref|ZP_01217209.1| ATP synthase subunit B [Psychromonas sp. CNPT3]
 gi|90309812|gb|EAS37973.1| ATP synthase subunit B [Psychromonas sp. CNPT3]
          Length = 156

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   LL  ++A    I D + +A R  +  +    +
Sbjct: 1   MNINATLLGQAIAFIMFVWFCMKFVWPPLLDAIEARQKLIADGLTQAERAGKDLQLAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +K  + + +  EII  A  R   + +E     E      +     ++   +  A+  L
Sbjct: 61  ATDKLKEAKVQAAEIIDQANKRRAQIVDEAKTEGETERQKIITQGTAEVESERNRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++   ++    +II   ++ + NS I +K ++ +
Sbjct: 121 RQQVTILAIAGAEKIIKHSIDKNANSDIIDKLVTEL 156


>gi|157964055|ref|YP_001504089.1| F0F1 ATP synthase subunit B [Shewanella pealeana ATCC 700345]
 gi|226694914|sp|A8HAG7|ATPF_SHEPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157849055|gb|ABV89554.1| ATP synthase F0, B subunit [Shewanella pealeana ATCC 700345]
          Length = 156

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L      +  V      +   L++ ++    KI D + +A R  +  E   ++
Sbjct: 1   MSINATLLGQAISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    +    EII  A  R   + +E     +   A  +     +I   +   K  L
Sbjct: 61  ATEQLKDAKATANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ +
Sbjct: 121 RKQVAILAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|296137187|ref|YP_003644429.1| ATP synthase F0, B subunit [Thiomonas intermedia K12]
 gi|295797309|gb|ADG32099.1| ATP synthase F0, B subunit [Thiomonas intermedia K12]
          Length = 156

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 74/156 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MH D T +  + + + L       +   +   LD  A KI D +  A R + +  +   +
Sbjct: 1   MHLDATLIAQIIVFLLLAWFTKKFVWPPITKALDERATKIADGLAAADRAKSELASANRK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+ ++  +E+   +  A+ RA+ + EE  +  E+++A  L   + +     ++A+  L
Sbjct: 61  VEEELARSHQESAGRLADAERRAQAVIEEARKKAEEVAANILAQAKSEADQQAVKAREQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAALAVKGAEAILHREINPQVHADLLNRLKAEL 156


>gi|322392089|ref|ZP_08065551.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
 gi|321144989|gb|EFX40388.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
          Length = 164

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLIVLVKKFAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+    +     +  +        Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIDNAKDTAEKSKADILAEAKLEAGRLKDKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +IIS+ ++   +  + ++ I  +   
Sbjct: 132 LTVSLAGKIISKNLDGHAHKELIDQYIDQLGEA 164


>gi|294341485|emb|CAZ89902.1| putative Sodium-transporting two-sector ATPase AtpF [Thiomonas sp.
           3As]
          Length = 156

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 74/156 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MH D T +  + + + L       +   +   LD  A KI D +  A R + +  +   +
Sbjct: 1   MHLDATLIAQIIVFLLLAWFTKKFVWPPITKALDERATKIADGLAAADRAKSELASANRK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+ ++  +E+   +  A+ RA+ + EE  +  E+++A  +   + +     ++A+  L
Sbjct: 61  VEEELARSHQESAGRLADAERRAQAVIEEARKKAEEVAANIVAQAKSEADQQAVKAREQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAALAVKGAEAILHREINPQVHADLLNRLKAEL 156


>gi|77461951|ref|YP_351458.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens Pf0-1]
 gi|123602672|sp|Q3K437|ATPF_PSEPF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77385954|gb|ABA77467.1| ATP synthase F0 subcomplex B subunit [Pseudomonas fluorescens
           Pf0-1]
          Length = 156

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      +  V+     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFLIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + EE  +     +       + +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIIEQAKKRGNQIVEEAVEKARIDADRVKVQAQAEIEQELNSVKDKL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  +  + I
Sbjct: 121 RAQVGLLAVGGAEKILGATIDQNAHAELVNQLAAEI 156


>gi|306825333|ref|ZP_07458674.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432465|gb|EFM35440.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 165

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I LV++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 13  FILIAGSFILLVVLVKKYAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKREDELA 72

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +     +  +    +   Q+I   K EA + +  ++AD
Sbjct: 73  GSRSEAKTIIENAKETAEKSKSDILAEAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 132

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +IISQ ++   +  + ++ I  +   
Sbjct: 133 LTVSLAGKIISQNLDSHAHKELIDQYIDQLGEA 165


>gi|302334939|ref|YP_003800146.1| ATP synthase F0 subcomplex B subunit [Olsenella uli DSM 7084]
 gi|301318779|gb|ADK67266.1| ATP synthase F0 subcomplex B subunit [Olsenella uli DSM 7084]
          Length = 201

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +   + + IV+       +L  ++    KI+DD+  A   R ++      Y  +
Sbjct: 44  AEFVPALLAFLVIWIVLAKFAWPSILGMMEERQQKIQDDLEAAEESRAQAAEEAKNYTAQ 103

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            ++   E   II  A+  A     +     ++ +A  +      +   + +A   L  ++
Sbjct: 104 ITEAHREAEAIISKARKDATEERTQILAKAQREAADIISKAHGAVGSERKKAMIELSGQV 163

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            D SVEI  +II   +++     + EK ++ + + H
Sbjct: 164 VDLSVEIAGKIIGNDLSEAEQRKLAEKYLAEVSAPH 199


>gi|237801677|ref|ZP_04590138.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024536|gb|EGI04592.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 156

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         VI     +   +++ L     KI D +  A R     E    +
Sbjct: 1   MNINATLIGQSVAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  AK R   + +E  +     +         +I       K  L
Sbjct: 61  AGQQLREAKAQAAEIIEQAKKRGTQIVDEARETARVEADRVKAQALAEIEQELNGVKDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++   +V    +I+   ++ + ++ +  K  + I
Sbjct: 121 RAQLGSLAVNGAEKILGATIDQNAHAELVNKLAAEI 156


>gi|259417462|ref|ZP_05741381.1| ATP synthase B chain (Subunit I) [Silicibacter sp. TrichCH4B]
 gi|259346368|gb|EEW58182.1| ATP synthase B chain (Subunit I) [Silicibacter sp. TrichCH4B]
          Length = 185

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 83/157 (52%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++  ++PS++   LD  AD I+ ++ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTDFVVVLAFLLFIGILLAAKVPSLIGKQLDNRADSIKSELEEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+ +   I+  A+  A   AE+   ++    A  L   E++I   +  A + +  +
Sbjct: 88  KQQDVQAQAERIVANARDEAAAAAEQAKADLAASIARRLAAAEEQISSAEASAVKEVRDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +VE+  ++IS++M+    + + +  I  + +  
Sbjct: 148 AITIAVEVADQVISKQMSAADANKLIDAAIQDVDAKL 184


>gi|581169|emb|CAA23592.1| unnamed protein product [Escherichia coli]
          Length = 156

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++  +    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAFEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEDQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|148988556|ref|ZP_01819989.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|168483879|ref|ZP_02708831.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|168487555|ref|ZP_02712063.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|147925757|gb|EDK76832.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|172042717|gb|EDT50763.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|183569630|gb|EDT90158.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|332073846|gb|EGI84324.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41301]
 gi|332200072|gb|EGJ14145.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47368]
          Length = 164

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FVLITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K+EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   + ++ ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDSHAHKALIDQYIDQLGEA 164


>gi|239993098|ref|ZP_04713622.1| F0F1 ATP synthase subunit B [Alteromonas macleodii ATCC 27126]
          Length = 156

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 68/156 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ TF+  +      V+     +   L++ ++    KI D +  + R  +  E    +
Sbjct: 1   MNFNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  EII  AK RA  L +E  Q         +     +I   +  AK  L
Sbjct: 61  ATEQLKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYAEIEAERNRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V   ++I+ ++++ +  + I EK ++ +
Sbjct: 121 RKQVSALAVAGAQQILQREIDANAQNDIVEKLVAEL 156


>gi|183597133|ref|ZP_02958626.1| hypothetical protein PROSTU_00372 [Providencia stuartii ATCC 25827]
 gi|188023443|gb|EDU61483.1| hypothetical protein PROSTU_00372 [Providencia stuartii ATCC 25827]
          Length = 156

 Score = 83.7 bits (205), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++  E     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +   + EE     E      +   + +I   +  A+  L
Sbjct: 61  ATDRLKKAKAEAQVIIEQANKQRNQMIEEAKAEAEAERTKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|15901359|ref|NP_345963.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae TIGR4]
 gi|15903407|ref|NP_358957.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae R6]
 gi|111657414|ref|ZP_01408167.1| hypothetical protein SpneT_02001384 [Streptococcus pneumoniae
           TIGR4]
 gi|116515510|ref|YP_816801.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae D39]
 gi|148984855|ref|ZP_01818108.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|148992604|ref|ZP_01822272.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|148997428|ref|ZP_01825033.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|149003274|ref|ZP_01828170.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|149007582|ref|ZP_01831217.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|149011746|ref|ZP_01832942.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|149021779|ref|ZP_01835786.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168489672|ref|ZP_02713871.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|168492581|ref|ZP_02716724.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|168493413|ref|ZP_02717556.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|168575967|ref|ZP_02721882.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|169832491|ref|YP_001694918.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Hungary19A-6]
 gi|182684466|ref|YP_001836213.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|194396745|ref|YP_002038142.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae G54]
 gi|221232224|ref|YP_002511377.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225854956|ref|YP_002736468.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae JJA]
 gi|225857137|ref|YP_002738648.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae P1031]
 gi|225859269|ref|YP_002740779.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae 70585]
 gi|225861345|ref|YP_002742854.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649217|ref|ZP_04523469.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974]
 gi|237821826|ref|ZP_04597671.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974M2]
 gi|298255868|ref|ZP_06979454.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298503247|ref|YP_003725187.1| H (+)-transporting two-sector ATPase subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|303254151|ref|ZP_07340264.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|303260734|ref|ZP_07346694.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|303263061|ref|ZP_07348993.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|303264465|ref|ZP_07350385.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|303267443|ref|ZP_07353297.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|303269782|ref|ZP_07355531.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|307068156|ref|YP_003877122.1| F0F1-type ATP synthase subunit b [Streptococcus pneumoniae AP200]
 gi|307127716|ref|YP_003879747.1| ATP synthase F0 subunit B [Streptococcus pneumoniae 670-6B]
 gi|61219603|sp|P0A2Z2|ATPF_STRPN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219605|sp|P0A2Z3|ATPF_STRR6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122277701|sp|Q04HT5|ATPF_STRP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695882|sp|B5E675|ATPF_STRP4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696178|sp|B1ICT3|ATPF_STRPI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696179|sp|B2IQX4|ATPF_STRPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15004343|gb|AAK77043.1|AF334396_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|15004348|gb|AAK77047.1|AF334397_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|18253301|gb|AAL66413.1|AF368465_3 proton-translocating ATPase b subunit [Streptococcus pneumoniae]
 gi|14973002|gb|AAK75603.1| ATP synthase F0, B subunit [Streptococcus pneumoniae TIGR4]
 gi|15459012|gb|AAL00168.1| Proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           pneumoniae R6]
 gi|116076086|gb|ABJ53806.1| ATP synthase F0, B subunit [Streptococcus pneumoniae D39]
 gi|147756483|gb|EDK63524.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|147758734|gb|EDK65731.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|147760941|gb|EDK67911.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|147764177|gb|EDK71109.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|147922877|gb|EDK73993.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|147928621|gb|EDK79635.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|147930015|gb|EDK81002.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168994993|gb|ACA35605.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Hungary19A-6]
 gi|182629800|gb|ACB90748.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|183571984|gb|EDT92512.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|183573266|gb|EDT93794.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|183576602|gb|EDT97130.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|183578325|gb|EDT98853.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|194356412|gb|ACF54860.1| ATP synthase F0, B chain [Streptococcus pneumoniae G54]
 gi|220674685|emb|CAR69258.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225721806|gb|ACO17660.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 70585]
 gi|225722344|gb|ACO18197.1| ATP synthase F0, B subunit [Streptococcus pneumoniae JJA]
 gi|225726166|gb|ACO22018.1| ATP synthase F0, B subunit [Streptococcus pneumoniae P1031]
 gi|225726416|gb|ACO22267.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238842|gb|ADI69973.1| H (+)-transporting two-sector ATPase, subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301794524|emb|CBW36966.1| ATP synthase B chain [Streptococcus pneumoniae INV104]
 gi|301800348|emb|CBW32977.1| ATP synthase B chain [Streptococcus pneumoniae OXC141]
 gi|301802232|emb|CBW34982.1| ATP synthase B chain [Streptococcus pneumoniae INV200]
 gi|302598877|gb|EFL65910.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|302635824|gb|EFL66327.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|302638137|gb|EFL68612.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|302640675|gb|EFL71073.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|302643034|gb|EFL73327.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|302646277|gb|EFL76504.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|306409693|gb|ADM85120.1| F0F1-type ATP synthase, subunit b [Streptococcus pneumoniae AP200]
 gi|306484778|gb|ADM91647.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 670-6B]
 gi|327389695|gb|EGE88040.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA04375]
 gi|332072303|gb|EGI82786.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17570]
 gi|332074263|gb|EGI84740.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17545]
 gi|332199556|gb|EGJ13631.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41317]
 gi|332200951|gb|EGJ15022.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47901]
          Length = 164

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S +    +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K+EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   + ++ ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDSHAHKALIDQYIDQLGEA 164


>gi|188587438|ref|YP_001918983.1| ATP synthase F0, B subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226694327|sp|B2A3G6|ATPF_NATTJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|179352125|gb|ACB86395.1| ATP synthase F0, B subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 162

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 80/152 (52%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF++ +  I+ L  ++   +   +  F++   ++I+ ++ +A + R+++E +  QY EK 
Sbjct: 8   TFVLTIVNILVLFYLLKRFLFKPIGEFMENRKNEIKQNLEDAEKERQEAEKLKEQYYEKL 67

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + E +EII  A+ R + + +E  Q  +Q +   +    ++I+  + +A   L ++++
Sbjct: 68  RGAKSEAQEIIQQARQREEEIIKEAKQEAKQEADDMIARAREEINQEQKKAIESLRSEVS 127

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           D +++I   +++  ++ D    + +K +  + 
Sbjct: 128 DLTIQITERVLNDTIDKDQQKKLVQKYLKEVG 159


>gi|325291358|ref|YP_004267539.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324966759|gb|ADY57538.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 185

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 69/156 (44%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           FD T    M   + LV ++       L+  ++     I D++  A   R+++E I  +Y+
Sbjct: 27  FDYTLPAQMLSFLILVYILAKFAWRPLMDMMEKRRQFIEDNLSRAENERKEAEKIKKEYQ 86

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+  K  +E +EII  A   ++  A E        S    +     I   +  A   + A
Sbjct: 87  EEMRKARQEAQEIINKATKISEERASEILAEARIDSEKTKQAALADIQRERDNAVLEVKA 146

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++AD SV +  +I+  K+N +   ++ ++ I  + +
Sbjct: 147 QVADMSVAVAEKILRAKLNLEGQETLIDQFIQEVGN 182


>gi|153833314|ref|ZP_01985981.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
 gi|156977322|ref|YP_001448228.1| ATP synthase B chain [Vibrio harveyi ATCC BAA-1116]
 gi|226694400|sp|A7N2U5|ATPF2_VIBHB RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|148870450|gb|EDL69371.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
 gi|156528916|gb|ABU74001.1| hypothetical protein VIBHAR_06108 [Vibrio harveyi ATCC BAA-1116]
          Length = 156

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + +        +  V +    +   L+  LD    +I   + +  +  ++ E     
Sbjct: 1   MNLNASMFGQAISFVIFVWLCMKYVWPPLVKLLDERRAEIAQGLEQTEKAAQELELAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +   ++   + + II   K R + +  E      Q  A  + + + ++   + + ++ L
Sbjct: 61  GEALLTEARSKAQAIINQGKQRQEQMVAEAVDLANQEKARIVAEGKAEVESERSKVRQEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++AD  +E   ++I++ ++   N  +  + I+ +
Sbjct: 121 KDEMADLVIESASKLINRNLDSSANRDLVNRFINEM 156


>gi|16762457|ref|NP_458074.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767153|ref|NP_462768.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143945|ref|NP_807287.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415737|ref|YP_152812.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62182351|ref|YP_218768.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161505606|ref|YP_001572718.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|161616989|ref|YP_001590954.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167994873|ref|ZP_02575963.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168263235|ref|ZP_02685208.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168464796|ref|ZP_02698688.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194444961|ref|YP_002043115.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450958|ref|YP_002047898.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472738|ref|ZP_03078722.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194737006|ref|YP_002116810.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197248823|ref|YP_002148804.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197261971|ref|ZP_03162045.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197364665|ref|YP_002144302.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245044|ref|YP_002217815.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200386880|ref|ZP_03213492.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204928728|ref|ZP_03219927.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207859092|ref|YP_002245743.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213028745|ref|ZP_03343192.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213052666|ref|ZP_03345544.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213427466|ref|ZP_03360216.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213649862|ref|ZP_03379915.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|224585664|ref|YP_002639463.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913122|ref|ZP_04656959.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289810104|ref|ZP_06540733.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|75505460|sp|Q57HX5|ATPF_SALCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81678058|sp|Q5PKW8|ATPF_SALPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81706850|sp|Q7CPE4|ATPF_SALTY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81766285|sp|Q8XGD7|ATPF_SALTI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694461|sp|B5EZ00|ATPF_SALA4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694463|sp|A9MJR5|ATPF_SALAR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694464|sp|B5FN37|ATPF_SALDC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694465|sp|B5QVD6|ATPF_SALEP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694467|sp|B4TAX6|ATPF_SALHS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694468|sp|B4SYD5|ATPF_SALNS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694469|sp|A9MXB0|ATPF_SALPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694470|sp|B5BIP0|ATPF_SALPK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694472|sp|B4TN35|ATPF_SALSV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|25290581|pir||AB0954 ATP synthase chain B [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16422443|gb|AAL22727.1| membrane-bound ATP synthase, F0 sector, subunit b [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16504762|emb|CAD03126.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139581|gb|AAO71147.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56129994|gb|AAV79500.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62129984|gb|AAX67687.1| membrane-bound ATP synthase, F0 sector, subunit b [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|160866953|gb|ABX23576.1| hypothetical protein SARI_03782 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366353|gb|ABX70121.1| hypothetical protein SPAB_04810 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403624|gb|ACF63846.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409262|gb|ACF69481.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459102|gb|EDX47941.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194712508|gb|ACF91729.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195632223|gb|EDX50707.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197096142|emb|CAR61738.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197212526|gb|ACH49923.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240226|gb|EDY22846.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197939560|gb|ACH76893.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199603978|gb|EDZ02523.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204322161|gb|EDZ07359.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205327334|gb|EDZ14098.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205348062|gb|EDZ34693.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710895|emb|CAR35259.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224470192|gb|ACN48022.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261249009|emb|CBG26867.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996156|gb|ACY91041.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160401|emb|CBW19927.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915000|dbj|BAJ38974.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088294|emb|CBY98055.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321222165|gb|EFX47238.1| ATP synthase B chain [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322617218|gb|EFY14123.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619094|gb|EFY15980.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625161|gb|EFY21989.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630212|gb|EFY26983.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634363|gb|EFY31097.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635247|gb|EFY31962.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642876|gb|EFY39461.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645080|gb|EFY41610.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650429|gb|EFY46841.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653621|gb|EFY49948.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322661551|gb|EFY57774.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322661633|gb|EFY57852.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669795|gb|EFY65937.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671988|gb|EFY68107.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675001|gb|EFY71087.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683691|gb|EFY79704.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686078|gb|EFY82063.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716844|gb|EFZ08415.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132231|gb|ADX19661.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323192005|gb|EFZ77242.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200499|gb|EFZ85577.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202728|gb|EFZ87765.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208305|gb|EFZ93246.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211740|gb|EFZ96573.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218602|gb|EGA03309.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220003|gb|EGA04473.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224774|gb|EGA09039.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323232518|gb|EGA16620.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235293|gb|EGA19378.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323241081|gb|EGA25118.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241370|gb|EGA25402.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248600|gb|EGA32530.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252101|gb|EGA35961.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258595|gb|EGA42258.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262373|gb|EGA45931.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268210|gb|EGA51686.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270624|gb|EGA54069.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625602|gb|EGE31947.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332990718|gb|AEF09701.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 156

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|317050174|ref|YP_004117822.1| ATP synthase F0 subunit B [Pantoea sp. At-9b]
 gi|316951791|gb|ADU71266.1| ATP synthase F0, B subunit [Pantoea sp. At-9b]
          Length = 156

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +EE + II  A  R   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKEEAQVIIEQANKRRAQILDEAKTEAETERNRIVAQAQAEIEAERSRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVALLALAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|325696687|gb|EGD38575.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK160]
 gi|327461561|gb|EGF07892.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1]
 gi|327489415|gb|EGF21208.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1058]
          Length = 164

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L++++       + S  +  A KI DDI  A   R+K+E +  + + + +
Sbjct: 12  FILVAGSFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARQKAEELAQKREHELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSRAEAVTIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|319638947|ref|ZP_07993705.1| ATP synthase subunit B [Neisseria mucosa C102]
 gi|317399851|gb|EFV80514.1| ATP synthase subunit B [Neisseria mucosa C102]
          Length = 156

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+ +L
Sbjct: 61  VAELMAEGRNQVTEMVANAEKRAAKIVEEAKEQASHEAARIAVQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVASLAVKGAESILRKEVDASKHADLLSALKQEL 156


>gi|73662086|ref|YP_300867.1| F0F1 ATP synthase subunit B [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|88909588|sp|Q49Z54|ATPF_STAS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|72494601|dbj|BAE17922.1| F0F1-type ATP synthase b subunit' [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 175

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 70/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   + L+ ++       L   +D     I  DI +A + +  ++ +  Q K+  
Sbjct: 22  TIIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDIDDAEQAKLNAQKLEEQNKQTL 81

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  +K +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 82  KETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIETAQNEINSEKERAIADINNQVS 141

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ ++++D    ++ EK I    
Sbjct: 142 ELSVLIASKVLQKEISDKDQKALVEKYIKEAG 173


>gi|157368253|ref|YP_001476242.1| F0F1 ATP synthase subunit B [Serratia proteamaculans 568]
 gi|270264090|ref|ZP_06192357.1| ATP synthase subunit b [Serratia odorifera 4Rx13]
 gi|226694474|sp|A8G7M4|ATPF_SERP5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157320017|gb|ABV39114.1| ATP synthase F0, B subunit [Serratia proteamaculans 568]
 gi|270041739|gb|EFA14836.1| ATP synthase subunit b [Serratia odorifera 4Rx13]
          Length = 156

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++    + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|126732371|ref|ZP_01748171.1| ATP synthase F0, B subunit [Sagittula stellata E-37]
 gi|126707240|gb|EBA06306.1| ATP synthase F0, B subunit [Sagittula stellata E-37]
          Length = 185

 Score = 83.7 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 39/157 (24%), Positives = 86/157 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++FLV++VY  +P++L   LD  A+ I+ ++ EARR+RE+++ +L  Y+ 
Sbjct: 28  NTNFIVLIAFLLFLVVLVYFNVPAMLGKLLDKRAEDIQSELDEARRIREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K   V+++   I+  A+  A++ AEE    + +     L   E +I   +  A + +   
Sbjct: 88  KQRDVQDQADRIVAHARQEAELAAEEAKAKLAESIKRRLAAAESQIASAEAAAVKEVRDT 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            A  ++   RE+++++M+      + + +IS + +  
Sbjct: 148 AATVAIAAAREVVAEQMDAAKAGQMIDASISEVGAKL 184


>gi|114619|sp|P26681|ATPF_ENTHR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|153569|gb|AAA26855.1| H+ ATPase [Enterococcus faecalis]
 gi|153577|gb|AAA26862.1| F1F0-ATPase beta subunit [Enterococcus faecalis]
          Length = 174

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 66/149 (44%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L+ ++       +   L    DKI +D+  A + R  S  +  + +++      +  
Sbjct: 25  FLILMFLLKHFAWGPISDILKKREDKIANDLDSAEKSRINSAKMEQEREQQLLASRSDAA 84

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK   ++  +   +  ++  A      +  I   +  A   +   +AD S++I  
Sbjct: 85  DIIKNAKESGELSRQNILKETQEEVARLKSKAQTDIMLERDTALNSVKDDVADLSLQIAA 144

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           +I++++++ +++ S+  + I  + S ++ 
Sbjct: 145 KILNKELSPEMHESLINQYIEGLGSSNET 173


>gi|306829404|ref|ZP_07462594.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315613054|ref|ZP_07887965.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|322374420|ref|ZP_08048934.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
 gi|304428490|gb|EFM31580.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315315164|gb|EFU63205.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|321279920|gb|EFX56959.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
          Length = 164

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IIS+ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|254461067|ref|ZP_05074483.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2083]
 gi|206677656|gb|EDZ42143.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium HTCC2083]
          Length = 186

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 87/157 (55%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +  ++F+ +++Y +IP++L   LD  A+ IRD++ EA+ LRE+++ +L  Y+ 
Sbjct: 29  NTDFVVLLGFLLFIGVLLYFKIPALLGGLLDKRAEGIRDELDEAKALREEAQTLLASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ AA+  A + A++  ++++   A  L   + ++   +  A + +   
Sbjct: 89  KQKEVQEQADRIVEAARKDAVLAADQAKEDLKASIARRLAAAQDQLASAEAGAVKEVRDT 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++    ++I+++M     +++ +  IS + S  
Sbjct: 149 AVTVAIAAANDVIAKQMTAKNGAALIDDAISEVSSKL 185


>gi|194291170|ref|YP_002007077.1| F0F1 ATP synthase subunit b [Cupriavidus taiwanensis LMG 19424]
 gi|226741426|sp|B3R7L9|ATPF_CUPTR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193225005|emb|CAQ71016.1| membrane-bound ATP synthase, F0 sector, subunit b [Cupriavidus
           taiwanensis LMG 19424]
          Length = 156

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 72/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + TF   M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATFFAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAAEKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +  ++   E  + +  A+ RA++ A+E  QN +  +A  +   + +       A+  L
Sbjct: 61  VDQAMAEARTEGAQRVADAEKRAQLTADEIKQNAQAEAARIIAQAKAEAEQQATRAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHADLLNQLKAEL 156


>gi|327473285|gb|EGF18705.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK408]
          Length = 164

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+      + LV ++       ++  LD  A KI DDI  A   R+K+E +  + +E  +
Sbjct: 12  FIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEALAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              EE   I+  AK  A+        N  + +        Q+I   K EA   +  ++AD
Sbjct: 72  GSREEAATIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|49484331|ref|YP_041555.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|282904776|ref|ZP_06312650.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906451|ref|ZP_06314302.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909420|ref|ZP_06317235.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282920285|ref|ZP_06328009.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|283958887|ref|ZP_06376332.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|295428694|ref|ZP_06821320.1| ATP synthase F0 [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297589826|ref|ZP_06948466.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus MN8]
 gi|81650653|sp|Q6GEW8|ATPF_STAAR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|49242460|emb|CAG41176.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|282316145|gb|EFB46526.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|282326690|gb|EFB56988.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330401|gb|EFB59919.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282594809|gb|EFB99786.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C160]
 gi|283789605|gb|EFC28428.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|295127364|gb|EFG57004.1| ATP synthase F0 [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297576954|gb|EFH95668.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus MN8]
 gi|315193272|gb|EFU23670.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 173

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++    ++ +K +    
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAG 171


>gi|307709039|ref|ZP_07645499.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
 gi|307620375|gb|EFN99491.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
          Length = 164

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L++++     S + S  +  A+KI  DI  A   R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLIKKFAWSNITSIFEERAEKIASDIDRAEEARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|18146847|dbj|BAB82480.1| F0F1-ATPase subunit b [Colwellia maris]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T +  +   +  VI     +   ++  ++     I D +  + R  +  E    +
Sbjct: 1   MDINMTLVGQLIAFVVFVIFCMKFVWPPIIGAIEERQATIADGLAASDRAAQDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K +    + +   I+ AAK     + EE     +      L     +I   +  A+  L
Sbjct: 61  AKSQLKDAKVQAASIVDAAKKLEAKIVEETAGKAQVEKDRILATGHAEIETERNRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++   +S I +K ++ +
Sbjct: 121 RKEVAILAVAGAEKILERSIDGAAHSDILDKLVAEL 156


>gi|226941918|ref|YP_002796992.1| AtpF [Laribacter hongkongensis HLHK9]
 gi|226716845|gb|ACO75983.1| AtpF [Laribacter hongkongensis HLHK9]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L        LV      +   L + +D  A +I D +  A R ++  E    +
Sbjct: 1   MDINATLLGQAITFAILVWFTMKFVWPPLTNLMDERAKRIADGLAAAERGKQDLEQASKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    +++  E++L A+ RA  + +E  Q  +  S   L D   +I    L AK  L
Sbjct: 61  VDEQIRLAKQQASELVLMAEKRAAQIVDEAKQAAKTESEKILVDARAQIGQEVLRAKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++AD +V    +I+ ++++   ++ +     + +
Sbjct: 121 RGQVADLAVVGAEKILKREIDASKHADLLASIKAEL 156


>gi|15925097|ref|NP_372631.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927681|ref|NP_375214.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283760|ref|NP_646848.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486900|ref|YP_044121.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57652129|ref|YP_186914.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           COL]
 gi|82751708|ref|YP_417449.1| F0F1 ATP synthase subunit B [Staphylococcus aureus RF122]
 gi|87162300|ref|YP_494708.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196011|ref|YP_500824.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|148268558|ref|YP_001247501.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150394622|ref|YP_001317297.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151222223|ref|YP_001333045.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156980422|ref|YP_001442681.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161510314|ref|YP_001575973.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141626|ref|ZP_03566119.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315775|ref|ZP_04838988.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|253731055|ref|ZP_04865220.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733059|ref|ZP_04867224.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006895|ref|ZP_05145496.2| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257426246|ref|ZP_05602661.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428904|ref|ZP_05605298.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431513|ref|ZP_05607886.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257434222|ref|ZP_05610572.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257437135|ref|ZP_05613175.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793865|ref|ZP_05642844.1| ATP synthase F0, B subunit [Staphylococcus aureus A9781]
 gi|258407033|ref|ZP_05680183.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9763]
 gi|258422055|ref|ZP_05684972.1| ATP synthase F0, B subunit [Staphylococcus aureus A9719]
 gi|258422893|ref|ZP_05685793.1| ATP synthase F0, B subunit [Staphylococcus aureus A9635]
 gi|258433576|ref|ZP_05688649.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9299]
 gi|258440471|ref|ZP_05690641.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A8115]
 gi|258445679|ref|ZP_05693857.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6300]
 gi|258450133|ref|ZP_05698228.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6224]
 gi|258453183|ref|ZP_05701174.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A5948]
 gi|258453412|ref|ZP_05701394.1| ATP synthase F0, B subunit [Staphylococcus aureus A5937]
 gi|262049274|ref|ZP_06022149.1| ATP synthase B chain [Staphylococcus aureus D30]
 gi|269203743|ref|YP_003283012.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894751|ref|ZP_06302977.1| ATP synthase F0, B subunit [Staphylococcus aureus A8117]
 gi|282911672|ref|ZP_06319471.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914956|ref|ZP_06322736.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M899]
 gi|282923095|ref|ZP_06330780.1| ATP synthase F0, B subunit [Staphylococcus aureus A9765]
 gi|282925496|ref|ZP_06333150.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282929031|ref|ZP_06336616.1| ATP synthase F0, B subunit [Staphylococcus aureus A10102]
 gi|284025141|ref|ZP_06379539.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           132]
 gi|293509024|ref|ZP_06667811.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510939|ref|ZP_06669638.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|293547541|ref|ZP_06672216.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294850077|ref|ZP_06790814.1| ATP synthase F0 [Staphylococcus aureus A9754]
 gi|295407037|ref|ZP_06816839.1| ATP synthase F0 [Staphylococcus aureus A8819]
 gi|296275414|ref|ZP_06857921.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297210072|ref|ZP_06926465.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297246036|ref|ZP_06929893.1| ATP synthase F0 [Staphylococcus aureus A8796]
 gi|300910435|ref|ZP_07127887.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304379288|ref|ZP_07362027.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|81648901|sp|Q6G7K3|ATPF_STAAS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81694059|sp|Q5HE93|ATPF_STAAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81704255|sp|Q7A0C4|ATPF_STAAW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81705321|sp|Q7A4E7|ATPF_STAAN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81781174|sp|Q99SF1|ATPF_STAAM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122540612|sp|Q2G2F8|ATPF_STAA8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123484936|sp|Q2FF20|ATPF_STAA3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123548233|sp|Q2YUJ7|ATPF_STAAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695871|sp|A7X4U9|ATPF_STAA1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695872|sp|A6U3J2|ATPF_STAA2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695874|sp|A5IUQ2|ATPF_STAA9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695875|sp|A6QIV1|ATPF_STAAE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695876|sp|A8YY74|ATPF_STAAT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13701901|dbj|BAB43193.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus N315]
 gi|14247880|dbj|BAB58269.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu50]
 gi|21205202|dbj|BAB95896.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus MW2]
 gi|49245343|emb|CAG43818.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57286315|gb|AAW38409.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           COL]
 gi|82657239|emb|CAI81680.1| ATP synthase B chain [Staphylococcus aureus RF122]
 gi|87128274|gb|ABD22788.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203569|gb|ABD31379.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741627|gb|ABQ49925.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947074|gb|ABR53010.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           JH1]
 gi|150375023|dbj|BAF68283.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722557|dbj|BAF78974.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu3]
 gi|160369123|gb|ABX30094.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating
           F-type ATPase epsilon subunit subunit B [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|253725182|gb|EES93911.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728967|gb|EES97696.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257270951|gb|EEV03124.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274246|gb|EEV05763.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257277754|gb|EEV08424.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257280861|gb|EEV11006.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283528|gb|EEV13655.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787837|gb|EEV26177.1| ATP synthase F0, B subunit [Staphylococcus aureus A9781]
 gi|257841366|gb|EEV65810.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9763]
 gi|257841955|gb|EEV66387.1| ATP synthase F0, B subunit [Staphylococcus aureus A9719]
 gi|257846917|gb|EEV70931.1| ATP synthase F0, B subunit [Staphylococcus aureus A9635]
 gi|257849307|gb|EEV73286.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9299]
 gi|257852540|gb|EEV76458.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A8115]
 gi|257855518|gb|EEV78455.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6300]
 gi|257856607|gb|EEV79513.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6224]
 gi|257859129|gb|EEV81986.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A5948]
 gi|257864393|gb|EEV87139.1| ATP synthase F0, B subunit [Staphylococcus aureus A5937]
 gi|259162639|gb|EEW47206.1| ATP synthase B chain [Staphylococcus aureus D30]
 gi|262076033|gb|ACY12006.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941706|emb|CBI50113.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282312897|gb|EFB43298.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282321159|gb|EFB51490.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324437|gb|EFB54750.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282589337|gb|EFB94429.1| ATP synthase F0, B subunit [Staphylococcus aureus A10102]
 gi|282593286|gb|EFB98283.1| ATP synthase F0, B subunit [Staphylococcus aureus A9765]
 gi|282762839|gb|EFC02973.1| ATP synthase F0, B subunit [Staphylococcus aureus A8117]
 gi|283471324|emb|CAQ50535.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           ST398]
 gi|285817771|gb|ADC38258.1| ATP synthase B chain [Staphylococcus aureus 04-02981]
 gi|290919661|gb|EFD96734.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291094728|gb|EFE25000.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466224|gb|EFF08751.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|294823025|gb|EFG39457.1| ATP synthase F0 [Staphylococcus aureus A9754]
 gi|294968062|gb|EFG44089.1| ATP synthase F0 [Staphylococcus aureus A8819]
 gi|296885272|gb|EFH24212.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297177035|gb|EFH36290.1| ATP synthase F0 [Staphylococcus aureus A8796]
 gi|298695381|gb|ADI98603.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus ED133]
 gi|300888277|gb|EFK83468.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302333753|gb|ADL23946.1| ATP synthase subunit beta, AtpB_1 [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302751988|gb|ADL66165.1| ATP synthase subunit beta, AtpB_1 [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304342147|gb|EFM08047.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312437475|gb|ADQ76546.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312830459|emb|CBX35301.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315128778|gb|EFT84778.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315196959|gb|EFU27301.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140721|gb|EFW32573.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143697|gb|EFW35474.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323439344|gb|EGA97068.1| F0F1 ATP synthase subunit B [Staphylococcus aureus O11]
 gi|323442447|gb|EGB00076.1| F0F1 ATP synthase subunit B [Staphylococcus aureus O46]
 gi|329314792|gb|AEB89205.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus T0131]
 gi|329723970|gb|EGG60494.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21189]
 gi|329726377|gb|EGG62845.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21172]
 gi|329729274|gb|EGG65682.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21193]
          Length = 173

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++    ++ +K +    
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAG 171


>gi|328544975|ref|YP_004305084.1| ATP synthase B/B' CF(0) superfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326414717|gb|ADZ71780.1| ATP synthase B/B' CF(0) superfamily [Polymorphum gilvum
           SL003B-26A1]
          Length = 159

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 46/158 (29%), Positives = 87/158 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF  F+ L++F V++ ++++P  + + LD  AD IR+++ EAR+LRE+++ +L +Y+
Sbjct: 1   MDATFWAFVGLVLFFVVMFWVKVPGKIGAALDKRADTIRNELDEARKLREEAQALLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+  A+  A+ L  E  + +E + A   +  E KI   +  A   + A
Sbjct: 61  RKRHEAESEAEAIVAEARAEAERLTVETNKALEDMIARRTRAAEDKIAQAETAAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           + AD +V    +I+  K+ D V   I  ++I  +++  
Sbjct: 121 RAADIAVAAAEQILKAKVQDKVADDIMARSIDQVKASL 158


>gi|88860633|ref|ZP_01135270.1| membrane-bound ATP synthase, F0 sector, subunit b
           [Pseudoalteromonas tunicata D2]
 gi|88817228|gb|EAR27046.1| membrane-bound ATP synthase, F0 sector, subunit b
           [Pseudoalteromonas tunicata D2]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L  +   I  V      +   L   ++A   KI D +  + +  +  E    +
Sbjct: 1   MSLNLTLLGELIAFIVFVWFCMKYVWPPLNGAIEARQKKIEDGLAASDKAEKDLELARHK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + + +  +II  AK RA  + +E      +     +     ++   +  AK  L
Sbjct: 61  ATEQLKEAKAQAADIIEQAKKRATQIVDEETTRGHEERENIIAQGRSEVEAERNRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  ++     I+ +++N+  +S I EK ++ +
Sbjct: 121 RKQVSALAILGAERILEREINEAAHSDIVEKLVTEL 156


>gi|288939806|ref|YP_003442046.1| ATP synthase F0 subunit B [Allochromatium vinosum DSM 180]
 gi|288895178|gb|ADC61014.1| ATP synthase F0, B subunit [Allochromatium vinosum DSM 180]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M      V      I   ++  L     KI + +  A R  ++      +
Sbjct: 1   MNINLTLFAQMITFAVFVGFCMKYIWPPIVKALAERKAKIAEGLAAAERGHQEKALGEQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E   + +    EI+  A+ RA  + EE   +        L   + ++      A+  L
Sbjct: 61  ALELMKEAKTNAAEIVGQAQKRATDIVEEAKSDARSEGERLLAAAKAEVERETNRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  ++    +I+ ++++   + SI +     +
Sbjct: 121 REKVATLAIAAAEKILQKEIDVAAHRSIVDDFAKQL 156


>gi|260774966|ref|ZP_05883866.1| ATP synthase B chain [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609056|gb|EEX35215.1| ATP synthase B chain [Vibrio coralliilyticus ATCC BAA-450]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +    E+I  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASEQMKEAKRTATEVIEQANKRKAQILDEAREEAQAERQKILSQAEAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + ++ D +  I +   + +
Sbjct: 121 RKQVATLAVAGAEKIIERSIDKDAHKDILDNITAKL 156


>gi|268593518|ref|ZP_06127739.1| ATP synthase F0, B subunit [Providencia rettgeri DSM 1131]
 gi|291310941|gb|EFE51394.1| ATP synthase F0, B subunit [Providencia rettgeri DSM 1131]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++  E     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +   + +E     E   A  +   + +I   +  A+  L
Sbjct: 61  ATDRLKKAKAEAQVIIEQANKQRVQMIDEAKAEAEAERAKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|50954450|ref|YP_061738.1| F0F1 ATP synthase subunit B [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|81692686|sp|Q6AG62|ATPF_LEIXX RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|50950932|gb|AAT88633.1| ATP synthase, B chain [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 190

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 67/157 (42%), Gaps = 2/157 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +  ++ L     L +P  +   LD  A+ I  +I +A   + K+E +L +Y  + ++  
Sbjct: 28  LICFVVILFFFWKLVLPR-VKKLLDERAEAIEGNIAKADEAQHKAEALLEEYTAQLAEAR 86

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            +  +I   A+   + +  E        +A      + +I   +  A   L  ++   ++
Sbjct: 87  ADAAKIREQARTDGQKIVAEAKDTATAEAARVTASAQAQIEAERQTALVSLRGEVGSLAI 146

Query: 130 EIVREIISQKMNDDVN-SSIFEKTISSIQSCHQMDKN 165
           +I   ++ + + +D    +I ++ ++ +++  +   N
Sbjct: 147 DIASGVVGEVLTEDKKAQAIVDRFLADLEASEKATSN 183


>gi|146313758|ref|YP_001178832.1| F0F1 ATP synthase subunit B [Enterobacter sp. 638]
 gi|226741447|sp|A4WGF1|ATPF_ENT38 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145320634|gb|ABP62781.1| ATP synthase F0 subcomplex B subunit [Enterobacter sp. 638]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D +  A R ++  +     
Sbjct: 1   MNMNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|322835098|ref|YP_004215125.1| ATP synthase F0 B subunit [Rahnella sp. Y9602]
 gi|321170299|gb|ADW75998.1| ATP synthase F0, B subunit [Rahnella sp. Y9602]
          Length = 156

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I + +  A R +++ +     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEISEGLSSAERAKKELDLAQAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIDQANKRKAQIVDEAKAEAEQERNKIVSQAKAEIDAERQRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++   ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVGILAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|307701975|ref|ZP_07638983.1| ATP synthase F0, B subunit [Streptococcus mitis NCTC 12261]
 gi|35436127|gb|AAO45680.1| AtpB [Streptococcus mitis]
 gi|307616620|gb|EFN95809.1| ATP synthase F0, B subunit [Streptococcus mitis NCTC 12261]
          Length = 164

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLLVLVKKYAWSNLTSIFEQRAEKIAADIDGAEQARQKAEVLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E + II  AK  A+        + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IISQ ++   +  + ++ I  +   
Sbjct: 132 LTISLAGKIISQNLDGHAHKELIDQYIDQLGEA 164


>gi|324993290|gb|EGC25210.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK405]
          Length = 164

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 68/153 (44%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDSAEAARKKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        +  + +        Q+I   K E    +  ++AD
Sbjct: 72  GSRAEAVAIVETAKETAEKNKAGILADAVEEAGRLKAKANQEIAQNKAETMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|171462849|ref|YP_001796962.1| ATP synthase F0, B subunit [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|226694350|sp|B1XSD0|ATPF_POLNS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|171192387|gb|ACB43348.1| ATP synthase F0, B subunit [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M +   L  VV   +   L+  LD  + KI D +  A R +E       +
Sbjct: 1   MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ +K  +E  + +  A+ RA++ AEE   N +  +A  +   +Q        A+ +L
Sbjct: 61  AEQELNKARQEGVQRVAEAEKRAQMSAEEIRANAQAEAARVISQAQQDAAQQVTRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  +V+   +I+ ++++   +  + ++  + +
Sbjct: 121 RAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL 156


>gi|326797432|ref|YP_004315252.1| ATP synthase subunit b [Marinomonas mediterranea MMB-1]
 gi|326548196|gb|ADZ93416.1| ATP synthase subunit b [Marinomonas mediterranea MMB-1]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   +++ L+  + KI D +  A R     E    +
Sbjct: 1   MNINLTLIGQAISFAIFVWFCMKYVWPPIIAALEERSKKIADGLEAANRASRDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + +E+  EII  A  RA  + +E  +          +  + +I    + AK  L
Sbjct: 61  ATQTLRESKEQAAEIIEQANKRANQIVDEAKEQAIAEGQRLREAAQAEIEQDVMRAKEAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++  ++    +I+   +++  +S I E+    +
Sbjct: 121 RAQVSALALTGAEKILGASVDEKAHSEIVEQLAKEL 156


>gi|83649677|ref|YP_438112.1| F0F1 ATP synthase subunit B [Hahella chejuensis KCTC 2396]
 gi|123529926|sp|Q2S6N7|ATPF_HAHCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|83637720|gb|ABC33687.1| F0F1-type ATP synthase, subunit b [Hahella chejuensis KCTC 2396]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   ++  L     KI D +  A   ++  E    +
Sbjct: 1   MNINLTMIGQAIAFFIFVVFCMKYVWPPVIQALREREKKIADGLQAAEHAQKDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +++  EII  A  RA  + EE            +   + +I   K  AK  L
Sbjct: 61  VAKQLREAKQQAAEIIEQANKRANQMLEEAKDQARTEGERLITAAKAEIDQEKNRAKESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  ++    +I+   ++   +S++ +K  + +
Sbjct: 121 RAEVAALALAGAEKILETSVDAGAHSNMLDKLAAEL 156


>gi|37681439|ref|NP_936048.1| F0F1 ATP synthase subunit B [Vibrio vulnificus YJ016]
 gi|326423791|ref|NP_759978.2| ATP synthase F0 subunit B [Vibrio vulnificus CMCP6]
 gi|38503000|sp|Q8DDH2|ATPF_VIBVU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81756321|sp|Q7MGH6|ATPF_VIBVY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|37200191|dbj|BAC96019.1| F0F1-type ATP synthase, subunit b [Vibrio vulnificus YJ016]
 gi|319999157|gb|AAO09505.2| ATP synthase F0, B subunit [Vibrio vulnificus CMCP6]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLLGQAISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  + +    EII  A  R   + +E  ++ +      L   E ++   +  A+  L
Sbjct: 61  ASSQLKEAKRTATEIIEQANKRKAQILDEAREDAQTERQKILAQAEAQLEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D +  I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERSIDKDAHKDILDNITAKL 156


>gi|283771275|ref|ZP_06344164.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           H19]
 gi|283459480|gb|EFC06573.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           H19]
          Length = 173

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLKKFAWGPLKDIMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++    ++ +K +    
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAG 171


>gi|270291024|ref|ZP_06197247.1| ATP synthase F0, B subunit [Pediococcus acidilactici 7_4]
 gi|304385300|ref|ZP_07367645.1| ATP synthase F0 sector subunit B [Pediococcus acidilactici DSM
           20284]
 gi|270280420|gb|EFA26255.1| ATP synthase F0, B subunit [Pediococcus acidilactici 7_4]
 gi|304328507|gb|EFL95728.1| ATP synthase F0 sector subunit B [Pediococcus acidilactici DSM
           20284]
          Length = 173

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 63/149 (42%)

Query: 12  SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEE 71
            L + L+ ++       + + L   AD+I +DI  A + +++++ +  Q KE       E
Sbjct: 25  ILFVVLMALIAKFAWGPVNAMLKERADRISNDIESAEQAKKEAQKLAEQRKEALDNSHAE 84

Query: 72  TREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI 131
              II  AK+      E    N +  +       +Q I   + +A +     IA  S+EI
Sbjct: 85  ATTIINNAKNSGAKERELIVGNAQAEAKSLKDKAKQDIEQERADALKSAQDDIASLSIEI 144

Query: 132 VREIISQKMNDDVNSSIFEKTISSIQSCH 160
             ++I ++++++    + +  I  +    
Sbjct: 145 ASKVIKKELDENSQKELIDSYIEGLGESK 173


>gi|294638355|ref|ZP_06716608.1| ATP synthase F0, B subunit [Edwardsiella tarda ATCC 23685]
 gi|291088608|gb|EFE21169.1| ATP synthase F0, B subunit [Edwardsiella tarda ATCC 23685]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  R   + +E     EQ  A  +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQVIIEQANKRKSQIIDEAKAEAEQERAKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|69247779|ref|ZP_00604484.1| ATP synthase F0, subunit B [Enterococcus faecium DO]
 gi|257879710|ref|ZP_05659363.1| ATP synthase F0 [Enterococcus faecium 1,230,933]
 gi|257884017|ref|ZP_05663670.1| ATP synthase F0 [Enterococcus faecium 1,231,501]
 gi|257890374|ref|ZP_05670027.1| ATP synthase F0 [Enterococcus faecium 1,231,410]
 gi|257892982|ref|ZP_05672635.1| ATP synthase F0 [Enterococcus faecium 1,231,408]
 gi|258616680|ref|ZP_05714450.1| ATP synthase F0, B subunit [Enterococcus faecium DO]
 gi|260559631|ref|ZP_05831811.1| ATP synthase F0 [Enterococcus faecium C68]
 gi|293560032|ref|ZP_06676536.1| ATP synthase F0, B subunit [Enterococcus faecium E1162]
 gi|293568728|ref|ZP_06680043.1| ATP synthase F0, B subunit [Enterococcus faecium E1071]
 gi|314939616|ref|ZP_07846843.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a04]
 gi|314941242|ref|ZP_07848138.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133C]
 gi|314949825|ref|ZP_07853135.1| ATP synthase F0, B subunit [Enterococcus faecium TX0082]
 gi|314953383|ref|ZP_07856308.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133A]
 gi|314993460|ref|ZP_07858825.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133B]
 gi|314997317|ref|ZP_07862282.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a01]
 gi|68194708|gb|EAN09190.1| ATP synthase F0, subunit B [Enterococcus faecium DO]
 gi|257813938|gb|EEV42696.1| ATP synthase F0 [Enterococcus faecium 1,230,933]
 gi|257819855|gb|EEV47003.1| ATP synthase F0 [Enterococcus faecium 1,231,501]
 gi|257826734|gb|EEV53360.1| ATP synthase F0 [Enterococcus faecium 1,231,410]
 gi|257829361|gb|EEV55968.1| ATP synthase F0 [Enterococcus faecium 1,231,408]
 gi|260074299|gb|EEW62621.1| ATP synthase F0 [Enterococcus faecium C68]
 gi|291588688|gb|EFF20521.1| ATP synthase F0, B subunit [Enterococcus faecium E1071]
 gi|291605899|gb|EFF35329.1| ATP synthase F0, B subunit [Enterococcus faecium E1162]
 gi|313588608|gb|EFR67453.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a01]
 gi|313592125|gb|EFR70970.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133B]
 gi|313594576|gb|EFR73421.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133A]
 gi|313599966|gb|EFR78809.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133C]
 gi|313641156|gb|EFS05736.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a04]
 gi|313643898|gb|EFS08478.1| ATP synthase F0, B subunit [Enterococcus faecium TX0082]
          Length = 174

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 68/149 (45%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L+ ++       +   L    DKI +D+  A + R  S  +  + +++      +  
Sbjct: 25  FLILLALLKHFAWGPISDILKKREDKIANDLDSAEQSRINSAKMEQEREQQLLASRSDAA 84

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK   ++  +   ++ ++ +A      +  I   +  A   +   +A+ S++I  
Sbjct: 85  DIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKDDVAELSLQIAE 144

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           +I++++++ +++ S+  + I  + S ++ 
Sbjct: 145 KILNKELSPEMHESLINQYIEGLGSSNET 173


>gi|242371598|ref|ZP_04817172.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis M23864:W1]
 gi|242350665|gb|EES42266.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis M23864:W1]
          Length = 171

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T LV ++  + L+ ++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TMLVTIATFVVLLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKVNAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANVRANGMIETAQSEINSQKERALADINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++    ++ EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKALVEKYLKEAG 169


>gi|226947197|ref|YP_002802270.1| F0 sector of membrane-bound ATP synthase subunit B [Azotobacter
           vinelandii DJ]
 gi|226722124|gb|ACO81295.1| F0 sector of membrane-bound ATP synthase, subunit B [Azotobacter
           vinelandii DJ]
          Length = 152

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 54/151 (35%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T           V      +   L   +     KI + +  A R ++  +    +     
Sbjct: 2   TLFGQTIAFAIFVWFCMKYVWPPLTQAMQERQKKIAEGLDAAGRAQQDLKLAQEKVSNTL 61

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  E+  +II  A  +A  + E+  Q  +      +   + +I      A+  L  ++A
Sbjct: 62  RESREQATQIIEQANKQANAIIEDAKQQAQSEGERLIAGAKAEIEQEVNRAREELRKQVA 121

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++    +I+  K++   ++ + EK  S +
Sbjct: 122 ALAILGAEKILESKVDTKAHNKLVEKLASQL 152


>gi|223043922|ref|ZP_03613963.1| ATP synthase F0, B subunit [Staphylococcus capitis SK14]
 gi|222442637|gb|EEE48741.1| ATP synthase F0, B subunit [Staphylococcus capitis SK14]
          Length = 171

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 68/152 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   + L+ ++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TTIVTLVTFVILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E + I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQRILDDAKVQARKQHEEIIHEANVRANGMIETAQSEINSEKERALADINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKDLVEKYLKEAG 169


>gi|325269438|ref|ZP_08136055.1| ATP synthase F0 sector subunit B [Prevotella multiformis DSM 16608]
 gi|324988359|gb|EGC20325.1| ATP synthase F0 sector subunit B [Prevotella multiformis DSM 16608]
          Length = 170

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 67/154 (43%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  ++   I+     PSI+   ++   + I + + +A     +  NI  Q +E   
Sbjct: 12  FWMTLVFLVVFFILWRWGFPSII-KMVNERKEYIDESLAKAEEANLRLANIQKQGEELLM 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      +  +  +     SA  L + + +I   K  A R + +++A+
Sbjct: 71  EAREKQAQILREAADTRDAIVGQAQEKAHGESARILAEAKAEIENQKQAAIRDIRSQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
            SV+I  +I+ +++      + + +  +  + S 
Sbjct: 131 LSVQIAEKILHKELAGSAEQTRLIDSLLDEVASS 164


>gi|37524076|ref|NP_927420.1| F0F1 ATP synthase subunit B [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81707841|sp|Q7NA90|ATPF_PHOLL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|36783499|emb|CAE12339.1| ATP synthase B chain [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +   + ++     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQMKKAKVEAQVIIEQANKQKAQILDDAKAEAEQERNRIVTQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|270292839|ref|ZP_06199050.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
 gi|270278818|gb|EFA24664.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
          Length = 164

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 73/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRNEAKTIIENAKGTAEKSKADILADAKLEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IIS+ ++   +  + ++ I  +   
Sbjct: 132 LTISLAAKIISKNLDSHAHKELIDQYIDQLGEA 164


>gi|269957236|ref|YP_003327025.1| ATP synthase F0 subunit B [Xylanimonas cellulosilytica DSM 15894]
 gi|269305917|gb|ACZ31467.1| ATP synthase F0, B subunit [Xylanimonas cellulosilytica DSM 15894]
          Length = 194

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 65/155 (41%), Gaps = 2/155 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               + L+I  V      +P +L   LD   + I   + +A + +E +E  L + +E  +
Sbjct: 29  LWSAVVLVIIAVAFYKFVLPPML-KVLDERTEAIEGGMAQAAQAKEAAEQALERQQELLT 87

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +  ++   A+   K +  E     ++ +A   +   ++I   +  A   L   + D
Sbjct: 88  AARSDAAKVRDEAREEGKAIVAEHRSKAQEEAARITETAHRQIEAERQAAAVSLRTDVGD 147

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCH 160
            + ++  +I+ +++ +    + + ++ +  +++  
Sbjct: 148 LATQLASKIVGEELADSAARARVVDRFLDELETTQ 182


>gi|271502661|ref|YP_003335687.1| ATP synthase F0 subunit B [Dickeya dadantii Ech586]
 gi|270346216|gb|ACZ78981.1| ATP synthase F0, B subunit [Dickeya dadantii Ech586]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++        
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +  ++ +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKQRALILDEAKVEAEAERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|253987523|ref|YP_003038879.1| F0F1 ATP synthase subunit B [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253778973|emb|CAQ82133.1| ATP synthase B chain [Photorhabdus asymbiotica]
          Length = 156

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + E + II  A  +   + ++     E      +   + +I   +  A+  L
Sbjct: 61  ATDQMKRAKAEAQVIIEQANKQKAQILDDAKAEAELERNRIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|220919572|ref|YP_002494876.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957426|gb|ACL67810.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 179

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 70/155 (45%), Gaps = 1/155 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ L ++        ++  L      IR+ I  A++ R ++E +L   KE  
Sbjct: 24  TLWTAITFLVMLAVLAKF-AWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +K + E  E+    +   ++L +E      + +   + +  ++I    ++AK  L A++ 
Sbjct: 83  AKAQREAAELARRNQQEVEVLRQELTAKARKEADDLVAEARRQIAEELVKAKAELKAQVV 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           D +++    ++   +++    ++ E+ I+ + +  
Sbjct: 143 DLAIDAASRLVKANLDEKAQRALVEEYIAQLPANR 177


>gi|325855018|ref|ZP_08171734.1| ATP synthase F0, B subunit [Prevotella denticola CRIS 18C-A]
 gi|327313281|ref|YP_004328718.1| ATP synthase F0 subunit B [Prevotella denticola F0289]
 gi|325483996|gb|EGC86936.1| ATP synthase F0, B subunit [Prevotella denticola CRIS 18C-A]
 gi|326944310|gb|AEA20195.1| ATP synthase F0, B subunit [Prevotella denticola F0289]
          Length = 170

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 69/154 (44%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  ++   I+     PSI+   ++   + I + + +A    ++  NI  Q +E   
Sbjct: 12  FWMTLVFLVVFFILWRWGFPSII-KMVNERKEYIDESLAKAEEANQRLANIQKQGEELLM 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      +  +  +   + SA  + + + +I   K  A R + +++A+
Sbjct: 71  EAREKQAQILREASDTRDAIVGQAQEKAHEESARIIAEAKAEIENQKQAAIRDIRSQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
            SV+I  +I+ +++      + + +  +  + S 
Sbjct: 131 LSVQIAEKILHKELAGSAEQTRLIDSLLDEVAST 164


>gi|312882257|ref|ZP_07742003.1| F0F1 ATP synthase subunit B [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370101|gb|EFP97607.1| F0F1 ATP synthase subunit B [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 156

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L         V      +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MDMNATLLGQAISFALFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E +I   +  A+  L
Sbjct: 61  ASDQLKEAKRTATEIIDQANKRKAQIIDEAREEAQTERQNILTQAEAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156


>gi|254471717|ref|ZP_05085118.1| ATP synthase protein, subunit B [Pseudovibrio sp. JE062]
 gi|211958919|gb|EEA94118.1| ATP synthase protein, subunit B [Pseudovibrio sp. JE062]
          Length = 161

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/160 (26%), Positives = 84/160 (52%), Gaps = 1/160 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            FD +    + LI+F V++ YL++P  + + LD  AD I+ ++  AR+LRE+++ ++ +Y
Sbjct: 1   MFDASLWALVGLILFFVLLWYLKVPGKIGAMLDQQADNIKQELEGARKLREEAQALMAEY 60

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E  +I+  AK  A  LA+E    +E++ A   K  E KI   +  A   + 
Sbjct: 61  QRKRKEAEAEAEQIVADAKVEADRLADEAKAALEEMIARRTKAAEAKIAQAEANAIAEVR 120

Query: 122 AKIADFSVEIVREIISQK-MNDDVNSSIFEKTISSIQSCH 160
           ++ AD +V+    I++      +V   + +++I  +    
Sbjct: 121 SRAADVAVQAAETIVASSAAKAEVQDKVLKQSIKQVSDSL 160


>gi|124265386|ref|YP_001019390.1| F0F1 ATP synthase subunit B [Methylibium petroleiphilum PM1]
 gi|226741509|sp|A2SC66|ATPF_METPP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|124258161|gb|ABM93155.1| ATP synthase F0, B subunit [Methylibium petroleiphilum PM1]
          Length = 156

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T    + +   L       +   +   LD  A KI D +  A R + +  +   +
Sbjct: 1   MSLNATLFAQLVVFFILAWFTMKFVWPPITKALDERASKIADGLAAADRAKTELASANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+ + V +E    +  A+ RA  + E+  +   +  +  +   + +     ++A+  L
Sbjct: 61  VEEQLASVRDENARRLADAEKRALAIVEDAKKRATEEGSKIVAAAKSEAEQQLVQARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILKREVNAGVHADLLSRLKTEL 156


>gi|294673896|ref|YP_003574512.1| ATP synthase F0 subunit B [Prevotella ruminicola 23]
 gi|294473943|gb|ADE83332.1| ATP synthase F0, B subunit [Prevotella ruminicola 23]
          Length = 171

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 61/155 (39%), Gaps = 2/155 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++  +   ++     P  ++  ++     I D + +A   +E+  NI  + +    
Sbjct: 18  FWMLLAFAVVFFVLAKYGFP-AIVGMVEERNRYIEDSLKKAHEAQERLANIEKEGESILQ 76

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +  +I+  A      + E+  +      A  L+D    I   K  A   +  ++A 
Sbjct: 77  EARAKQAQILKEAAETRDAIVEQAQEKARAEGARLLEDARVAIDQEKKAAIADIRQQVAA 136

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCH 160
            SV I  +++ Q + +D     + ++ +  + +  
Sbjct: 137 LSVGIAEKVLKQSLKDDKAQMDLIDRMLDDVSTDK 171


>gi|91785737|ref|YP_560943.1| F0F1 ATP synthase subunit B [Burkholderia xenovorans LB400]
 gi|296157539|ref|ZP_06840374.1| ATP synthase F0, B subunit [Burkholderia sp. Ch1-1]
 gi|123358354|sp|Q13SP8|ATPF_BURXL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91689691|gb|ABE32891.1| ATP synthase F0 subcomplex B subunit [Burkholderia xenovorans
           LB400]
 gi|295892311|gb|EFG72094.1| ATP synthase F0, B subunit [Burkholderia sp. Ch1-1]
          Length = 156

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKAELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ +  A+ RA  +A+E     +  +A  +   +       ++A+  L
Sbjct: 61  VDQELAQARNDGQQRVADAEKRAVAVADEIKAQAQAEAARIIAQAKADAEQQVVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQAAHADLLNQLKAEL 156


>gi|90413750|ref|ZP_01221738.1| ATP synthase subunit B [Photobacterium profundum 3TCK]
 gi|90325219|gb|EAS41716.1| ATP synthase subunit B [Photobacterium profundum 3TCK]
          Length = 156

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V+     +   L+  ++    KI D +  A R  +        
Sbjct: 1   MNMNATLLGQAIAFFLFVVFCMKYVWPPLMEAIEERQTKIADGLAAADRAAKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++    +    E+I  A  R   + +E     +      L   + +I   +  A+  L
Sbjct: 61  ASDQLKDAKRTASELIEQANKRKAQIIDEAKMEAQAERKNILAQGQAEIEAERNRARDDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + ++ DV++ +  K  + +
Sbjct: 121 RKQVATLAVIGAEKIIERTIDKDVHADLLNKVTAEL 156


>gi|291543820|emb|CBL16929.1| ATP synthase, F0 subunit b [Ruminococcus sp. 18P13]
          Length = 165

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 61/146 (41%)

Query: 15  IFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETRE 74
           + L +V+   +   + + L+A   ++     +A      +  +  +Y       + E+ +
Sbjct: 20  LILFLVIKHFLFGRVHAVLEARQQEVAKTYQDAEDASRHASELEEEYTGLMQNAKTESEQ 79

Query: 75  IILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVRE 134
           +I  A   A+  +EE      + S   L+    +I   K  A+  L  +I+D +VEI ++
Sbjct: 80  LIRNATRTAQSRSEEILAQARKDSGDMLEHAAAQIEQDKKRARNQLRGEISDLAVEIAQK 139

Query: 135 IISQKMNDDVNSSIFEKTISSIQSCH 160
           ++ + +N   +  +    I S+    
Sbjct: 140 VVERDLNQSDHDRLISDFIDSVGDSQ 165


>gi|255020237|ref|ZP_05292306.1| ATP synthase B chain [Acidithiobacillus caldus ATCC 51756]
 gi|254970379|gb|EET27872.1| ATP synthase B chain [Acidithiobacillus caldus ATCC 51756]
          Length = 159

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 69/154 (44%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T ++ +     LV+++Y  +   L   +D    KI D +  A R +E+      + +
Sbjct: 6   INGTLIIQLITFAILVVLLYKYLYGPLRKIMDERRAKISDGLAAAERGKEELALAQKRAE 65

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +     +++  EII +A+ RA  + EE      + +   +     +I      A+ +L  
Sbjct: 66  QILRDAKDKAAEIIASAERRAVEMREEAQVKAREEADRIIAGARAEIEVETNRAREVLRG 125

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++ +  V+  R I+ ++++ + +  I ++ +  +
Sbjct: 126 QVVELVVDGTRRILHREIDSNAHRDILDRVVGEL 159


>gi|157144372|ref|YP_001451691.1| F0F1 ATP synthase subunit B [Citrobacter koseri ATCC BAA-895]
 gi|237729047|ref|ZP_04559528.1| predicted protein [Citrobacter sp. 30_2]
 gi|226741340|sp|A8ACP2|ATPF_CITK8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157081577|gb|ABV11255.1| hypothetical protein CKO_00076 [Citrobacter koseri ATCC BAA-895]
 gi|226909669|gb|EEH95587.1| predicted protein [Citrobacter sp. 30_2]
          Length = 156

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|153007847|ref|YP_001369062.1| F0F1 ATP synthase subunit B' [Ochrobactrum anthropi ATCC 49188]
 gi|226694372|sp|A6WW79|ATPF1_OCHA4 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|151559735|gb|ABS13233.1| H+transporting two-sector ATPase B/B' subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 205

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 70/146 (47%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFMSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELT 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+      E      LK+ E++I  +K +A   +     +
Sbjct: 118 QARTKAASIAEAAREKGKGEADAERATAEAALERKLKEAEERIAAIKAKAMNDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            + EIV +++  K +    ++  + +
Sbjct: 178 TTAEIVEQLLGTKADKASVTAAVKAS 203


>gi|114567892|ref|YP_755046.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|122317241|sp|Q0AUC9|ATPF_SYNWW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114338827|gb|ABI69675.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 173

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 62/153 (40%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ L  ++Y      + + L+   + I   +  A  ++ + E +  +     ++
Sbjct: 21  WSAVNFLVLLA-LMYKFAYGPINNMLEQRTNAIEGSLKHAEEVKLEVEQMRKETASNLAE 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E +EI+  A   A+    E     ++ S L       +I     +AK  L       
Sbjct: 80  SRKEAQEIVARATKAAEESKNEIIAKAKEESTLIKNKAAAEIQAATEQAKLELKDSAVSL 139

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++    +++S+ +NDD + ++ ++ ++      
Sbjct: 140 AILAAEKVLSRAINDDDHKNLVKQFVNEAGDLL 172


>gi|238921739|ref|YP_002935254.1| F0F1 ATP synthase subunit B [Edwardsiella ictaluri 93-146]
 gi|269140870|ref|YP_003297571.1| F0F1-type ATP synthase, subunit b [Edwardsiella tarda EIB202]
 gi|238871308|gb|ACR71019.1| ATP synthase F0, B subunit, putative [Edwardsiella ictaluri 93-146]
 gi|267986531|gb|ACY86360.1| F0F1-type ATP synthase, subunit b [Edwardsiella tarda EIB202]
 gi|304560628|gb|ADM43292.1| ATP synthase B chain [Edwardsiella tarda FL6-60]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   L++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPLMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  R   + +E     EQ  A  +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQVIIEQANKRKSQIIDEAKAEAEQERAKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|262199225|ref|YP_003270434.1| H+transporting two-sector ATPase B/B' subunit [Haliangium ochraceum
           DSM 14365]
 gi|262082572|gb|ACY18541.1| H+transporting two-sector ATPase B/B' subunit [Haliangium ochraceum
           DSM 14365]
          Length = 264

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
           +  +  + + I+++      +  +     D+I+  + EA RLR+++   L +Y  +  + 
Sbjct: 107 MIFNFALVVAILMWKP-RHAIKKYTAKRHDEIKAALAEAGRLRDEARAKLDEYTAQIDQA 165

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
           E++   ++   +  A    +   +  E  +    +D +Q+I      A+  L  ++ + +
Sbjct: 166 EKDIDTMVSDIRKTADAEKQRILEEAEAQAEAMKRDADQRISAELERARTELEREVVNAA 225

Query: 129 VEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           + +   ++ +  +    + + +  I+ +Q+
Sbjct: 226 IAVATRLLREHTSKSDQTQLVDTFINDVQA 255


>gi|192362284|ref|YP_001984264.1| ATP synthase F0 subunit B [Cellvibrio japonicus Ueda107]
 gi|226741330|sp|B3PIT1|ATPF_CELJU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190688449|gb|ACE86127.1| ATP synthase F0, B subunit [Cellvibrio japonicus Ueda107]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+F+ TF+  M      + + Y  +   +++ +   + +I D +  A R  +  E    +
Sbjct: 1   MNFNATFIGQMVAFAIFIYLTYRYVWPPIVAAMAERSKRIADGLQAADRAEKDLELAQKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+ +  ++E   II  A  RA  + EE     +Q +       + +I      AK  L
Sbjct: 61  VVEQLTSAKKEAAAIIDQANKRAIEIVEEAKLKAQQEAERVKASAQAEIELATSRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +K+   ++    +I+   ++ + ++ +  K  + +
Sbjct: 121 RSKVVVLALAGAEKILESSIDQNAHNELVNKLAAEL 156


>gi|324990544|gb|EGC22480.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK353]
          Length = 164

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 67/153 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F+      + LV ++       ++  LD  A KI DDI  A   R+K+E++  + +E  +
Sbjct: 12  FIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREEALA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A+        +  + +        Q+I   K E    +  ++AD
Sbjct: 72  GSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAETMSSIKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+SQ+++ +  S + ++ I  +   
Sbjct: 132 LTVTLASKILSQELDKEAQSELIDRYIKQLGDA 164


>gi|77464616|ref|YP_354120.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides 2.4.1]
 gi|123590921|sp|Q3IZ15|ATPF_RHOS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77389034|gb|ABA80219.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides 2.4.1]
          Length = 187

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 30  NTNFIVTLAFLLFMGILLYAKVPGRILGMLDKRSVQIRTELEEARALREEARTILASYDR 89

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 90  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 149

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 150 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 184


>gi|261823734|ref|YP_003261840.1| F0F1 ATP synthase subunit B [Pectobacterium wasabiae WPP163]
 gi|261607747|gb|ACX90233.1| ATP synthase F0, B subunit [Pectobacterium wasabiae WPP163]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++        
Sbjct: 1   MNINATILGQAIAFVLFVWFCMKFVWPPMMAAIEKRQKEIADGLASAERAKKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  R   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQVIIEQANKRRAQILDEAKVEAEAERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAVLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|291615576|ref|YP_003518318.1| AtpF [Pantoea ananatis LMG 20103]
 gi|291150606|gb|ADD75190.1| AtpF [Pantoea ananatis LMG 20103]
 gi|327395845|dbj|BAK13267.1| ATP synthase B chain AtpF [Pantoea ananatis AJ13355]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   +++ ++    +I + +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPIMAAIEKRQKEIAEGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +EE + II  A  R   + +E     +      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKEEAQVIIEQANKRRTQILDEAKTEADNERTRIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVALLAMAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|85060388|ref|YP_456090.1| F0F1 ATP synthase subunit B [Sodalis glossinidius str. 'morsitans']
 gi|123518616|sp|Q2NQ90|ATPF_SODGM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|84780908|dbj|BAE75685.1| ATP synthase subunit B [Sodalis glossinidius str. 'morsitans']
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R ++  +    +
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMASIEKRQKEIADGLASAERAKKDLDIAQAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + + E + II  A  R   + +E     E      L   + +I   +  A+  L
Sbjct: 61  ATDHLKQAKVEAQAIIEQANKRKAQVVDEAKAEAEAERNKILAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + ++D  NS I +K ++ +
Sbjct: 121 RKQVAMLALAGAEKIIERSVDDAANSDIVDKIVAEL 156


>gi|59802443|ref|YP_209155.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA 1090]
 gi|194100107|ref|YP_002003247.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae NCCP11945]
 gi|239998095|ref|ZP_04718019.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae 35/02]
 gi|240013276|ref|ZP_04720189.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI18]
 gi|240015724|ref|ZP_04722264.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA6140]
 gi|240079858|ref|ZP_04724401.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA19]
 gi|240112067|ref|ZP_04726557.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae MS11]
 gi|240114813|ref|ZP_04728875.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID18]
 gi|240117015|ref|ZP_04731077.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID1]
 gi|240120348|ref|ZP_04733310.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID24-1]
 gi|240122652|ref|ZP_04735608.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae PID332]
 gi|240124840|ref|ZP_04737726.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|240127355|ref|ZP_04740016.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|254492877|ref|ZP_05106048.1| ATP synthase subunit B [Neisseria gonorrhoeae 1291]
 gi|260441373|ref|ZP_05795189.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI2]
 gi|268593947|ref|ZP_06128114.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae 35/02]
 gi|268596003|ref|ZP_06130170.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA19]
 gi|268598126|ref|ZP_06132293.1| ATP synthase subunit B [Neisseria gonorrhoeae MS11]
 gi|268600469|ref|ZP_06134636.1| ATP synthase subunit B [Neisseria gonorrhoeae PID18]
 gi|268602701|ref|ZP_06136868.1| ATP synthase subunit B [Neisseria gonorrhoeae PID1]
 gi|268681251|ref|ZP_06148113.1| ATP synthase subunit B [Neisseria gonorrhoeae PID332]
 gi|268683421|ref|ZP_06150283.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|268685728|ref|ZP_06152590.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|291044730|ref|ZP_06570439.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI2]
 gi|293397829|ref|ZP_06642035.1| ATP synthase F0, B subunit [Neisseria gonorrhoeae F62]
 gi|75355268|sp|Q5F4Z4|ATPF_NEIG1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694329|sp|B4RJF6|ATPF_NEIG2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|59719338|gb|AAW90743.1| putative ATP synthase B chain [Neisseria gonorrhoeae FA 1090]
 gi|193935397|gb|ACF31221.1| AtpF [Neisseria gonorrhoeae NCCP11945]
 gi|226511917|gb|EEH61262.1| ATP synthase subunit B [Neisseria gonorrhoeae 1291]
 gi|268547336|gb|EEZ42754.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae 35/02]
 gi|268549791|gb|EEZ44810.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae FA19]
 gi|268582257|gb|EEZ46933.1| ATP synthase subunit B [Neisseria gonorrhoeae MS11]
 gi|268584600|gb|EEZ49276.1| ATP synthase subunit B [Neisseria gonorrhoeae PID18]
 gi|268586832|gb|EEZ51508.1| ATP synthase subunit B [Neisseria gonorrhoeae PID1]
 gi|268621535|gb|EEZ53935.1| ATP synthase subunit B [Neisseria gonorrhoeae PID332]
 gi|268623705|gb|EEZ56105.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-92-679]
 gi|268626012|gb|EEZ58412.1| ATP synthase subunit B [Neisseria gonorrhoeae SK-93-1035]
 gi|291011624|gb|EFE03620.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae DGI2]
 gi|291611775|gb|EFF40844.1| ATP synthase F0, B subunit [Neisseria gonorrhoeae F62]
 gi|317165539|gb|ADV09080.1| F0F1 ATP synthase subunit B [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+  L
Sbjct: 61  VAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQAKADVEQELFRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  +++   ++ + +     +
Sbjct: 121 RDQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL 156


>gi|293393685|ref|ZP_06637994.1| ATP synthase F0 sector subunit B [Serratia odorifera DSM 4582]
 gi|291423807|gb|EFE97027.1| ATP synthase F0 sector subunit B [Serratia odorifera DSM 4582]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++    + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|149183574|ref|ZP_01861996.1| ATP synthase (subunit b) [Bacillus sp. SG-1]
 gi|148848715|gb|EDL62943.1| ATP synthase (subunit b) [Bacillus sp. SG-1]
          Length = 170

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 61/151 (40%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            + + I L+ ++       L+  +    D I  +I  A   R ++ N+L + ++   +  
Sbjct: 20  QLVMFIVLLALLKKFAWGPLMGIMKEREDHIASEINAAEESRTEANNLLEEQRQLLKEAR 79

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E + +I  +K + +   EE             +  +++I   K +A   L  +++  SV
Sbjct: 80  QEAQTMIENSKKQGEQQREEIIATARAEGERLKEAAKREIETQKEQAVTALREQVSSLSV 139

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            I  ++I ++++ +    +    I       
Sbjct: 140 LIASKVIEKELSAEDQQKLINDYIQEAGEER 170


>gi|283787575|ref|YP_003367440.1| ATP synthase subunit B [Citrobacter rodentium ICC168]
 gi|283836160|ref|ZP_06355901.1| hypothetical protein CIT292_10585 [Citrobacter youngae ATCC 29220]
 gi|282951029|emb|CBG90707.1| ATP synthase subunit B [Citrobacter rodentium ICC168]
 gi|291068353|gb|EFE06462.1| ATP synthase F0, B subunit [Citrobacter youngae ATCC 29220]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|322389183|ref|ZP_08062744.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
 gi|321144088|gb|EFX39505.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
          Length = 164

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ ++     + +   L+A A KI DDI  A   R+K+E +  + +E+ +
Sbjct: 12  FILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREEELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  AK  A+    +      Q +    +  +Q+I + K EA   +   +AD
Sbjct: 72  GSRKEAASIVENAKETAEKNKSQILSEATQEAVRLKEKAQQEIAHNKEEALNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +++SQ+++ +    + ++ +  +   
Sbjct: 132 LTVNLAGKLLSQQLDAEGQRQLIDRYLDELGEA 164


>gi|320539765|ref|ZP_08039426.1| F0 sector of membrane-bound ATP synthase, subunit b [Serratia
           symbiotica str. Tucson]
 gi|320030168|gb|EFW12186.1| F0 sector of membrane-bound ATP synthase, subunit b [Serratia
           symbiotica str. Tucson]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +     + E + +I  A  R   + +E     EQ     +   + +I      A+  L
Sbjct: 61  AADHLKTAKAEAQALIEQANKRKAQIMDEAKAEAEQERNKIVAQAQTEIEAECKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIACAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|294789019|ref|ZP_06754259.1| ATP synthase F0, B subunit [Simonsiella muelleri ATCC 29453]
 gi|294483121|gb|EFG30808.1| ATP synthase F0, B subunit [Simonsiella muelleri ATCC 29453]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +V + + I LV      +   +   LD  A+KI + +  A R +   E    +
Sbjct: 1   MNLNATLIVQVFVFIILVGFTVKYVWPPIAKALDERANKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  S+   +  E++  A+ RA  + EE        +A      +  +      A+ +L
Sbjct: 61  VAELLSEGRTQVTELVANAEKRAAQIVEEAKTQAANEAARITAQAKADVETEINRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  ++++  ++ +       +
Sbjct: 121 REQVAVLAVKGAESILRCEIDEKQHAKLLSTLKQEL 156


>gi|258544331|ref|ZP_05704565.1| ATP synthase F0, B subunit [Cardiobacterium hominis ATCC 15826]
 gi|258520411|gb|EEV89270.1| ATP synthase F0, B subunit [Cardiobacterium hominis ATCC 15826]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +   + L    +  I  +     +A   KI + +  A + +    +   +
Sbjct: 1   MNLNLTLIGQIGTFLVLWWFTHKYIWPLFSKVAEARRQKIAEGLSMADKAKHSIADAQEE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                ++ + +  EI+  A+ +A+ L  +     +      +  +       K +A+  L
Sbjct: 61  SARLIAQAKTQATEIVGRAQKQAEQLVVDARSEAKTAGEREIAAVRDNFEQEKRKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++IAD  V+   ++I +++  D +  +  +    +
Sbjct: 121 RSQIADLVVQGAEKVIGREVKADDHKRLLNELSEKL 156


>gi|56421897|ref|YP_149215.1| F0F1 ATP synthase subunit B [Geobacillus kaustophilus HTA426]
 gi|81346273|sp|Q5KUI9|ATPF_GEOKA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56381739|dbj|BAD77647.1| F0F1-type ATP synthaseB chain [Geobacillus kaustophilus HTA426]
          Length = 177

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 72/154 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +  + + I L+ ++       L++ +    + I ++I +A + R+++E +L + +E  
Sbjct: 20  TIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELM 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E + +I  A+  A+   E+   +    +    +  +++I   K +A   L  ++A
Sbjct: 80  KQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEVAKKEIEREKEQAMAALREQVA 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             SV I  ++I +++ +     + E  I  +Q  
Sbjct: 140 SLSVLIASKVIEKELTEQDQRKLIEAYIKDVQEA 173


>gi|27468622|ref|NP_765259.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis ATCC 12228]
 gi|57867660|ref|YP_189278.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis RP62A]
 gi|293366071|ref|ZP_06612759.1| ATP synthase F0 sector subunit B [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81673862|sp|Q5HMB5|ATPF_STAEQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81842667|sp|Q8CNJ3|ATPF_STAES RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|27316169|gb|AAO05303.1|AE016749_249 ATP synthase B chain [Staphylococcus epidermidis ATCC 12228]
 gi|57638318|gb|AAW55106.1| ATP synthase F0, B subunit [Staphylococcus epidermidis RP62A]
 gi|291319794|gb|EFE60152.1| ATP synthase F0 sector subunit B [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329734124|gb|EGG70442.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU045]
          Length = 171

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF+  ++ +I + I++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 19  TFVTLVTFVILI-ILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKELVEKYLKEAG 169


>gi|212712649|ref|ZP_03320777.1| hypothetical protein PROVALCAL_03744 [Providencia alcalifaciens DSM
           30120]
 gi|261346703|ref|ZP_05974347.1| ATP synthase F0, B subunit [Providencia rustigianii DSM 4541]
 gi|212684865|gb|EEB44393.1| hypothetical protein PROVALCAL_03744 [Providencia alcalifaciens DSM
           30120]
 gi|282565103|gb|EFB70638.1| ATP synthase F0, B subunit [Providencia rustigianii DSM 4541]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  E     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +   + +E     E   A  +   + +I   +  A+  L
Sbjct: 61  ATDRLKKAKAEAQVIIEQANKQRTQMIDEAKAEAEAERAKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|325107759|ref|YP_004268827.1| ATP synthase subunit b [Planctomyces brasiliensis DSM 5305]
 gi|324968027|gb|ADY58805.1| ATP synthase subunit b [Planctomyces brasiliensis DSM 5305]
          Length = 233

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/136 (16%), Positives = 63/136 (46%)

Query: 23  LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR 82
                 +   LD     IR +I +A   R +SE +L +   +   V++E REI+  A+  
Sbjct: 96  KFAWGPVTEGLDQREANIRRNIEDAEASRVRSEELLAERSAQLDAVQDEVREILAEARRD 155

Query: 83  AKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMND 142
           A+    E   + ++ +    +    +++  + +A   L++ +++        ++ + +ND
Sbjct: 156 AEHTKSEILADAQKEAEATKRRAIDEVNRARDQALNDLFSTMSNQVATATEHVLGRAIND 215

Query: 143 DVNSSIFEKTISSIQS 158
           +  + + +++++ + +
Sbjct: 216 EDRTRLIDQSLAELSA 231


>gi|296105470|ref|YP_003615616.1| F0F2 ATP synthase subunit B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059929|gb|ADF64667.1| F0F2 ATP synthase subunit B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D +  A R ++  +     
Sbjct: 1   MNMNATILGQAIAFIIFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVTQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|167628986|ref|YP_001679485.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1]
 gi|226741468|sp|B0TI54|ATPF_HELMI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167591726|gb|ABZ83474.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1]
          Length = 169

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 65/158 (41%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H +ETFL  +   + LV ++       +L  LD    K+ + I  A    E++  +  + 
Sbjct: 10  HLNETFLAMLISFLILVFILQQVAFKPILKALDERRQKVEESISRAENDLEEANRMRAEN 69

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
             + +K  +E  ++I  A    +  A+E     +  +    +     I   K +A   L 
Sbjct: 70  AAELAKARQEAHDLIARATKVGEEKAQEIVAAAQAEANRLKEKAVADIQREKEKALEELR 129

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           + + + S+    ++I + +++     + ++ I+ +   
Sbjct: 130 SHVVNLSILAAEKVIRKNLDEPTQRQLVDEVINEVGKL 167


>gi|311281699|ref|YP_003943930.1| ATP synthase F0, B subunit [Enterobacter cloacae SCF1]
 gi|308750894|gb|ADO50646.1| ATP synthase F0, B subunit [Enterobacter cloacae SCF1]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   L++ ++    +I D +  A R ++  +     
Sbjct: 1   MNMNATILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ  +  +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERSKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|304382809|ref|ZP_07365292.1| ATP synthase F0 sector subunit B [Prevotella marshii DSM 16973]
 gi|304335994|gb|EFM02241.1| ATP synthase F0 sector subunit B [Prevotella marshii DSM 16973]
          Length = 170

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 69/156 (44%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  II L ++     P +++  ++     I D + +A    EK  NI  + +    
Sbjct: 12  FWMAIVFIIVLAVLWKWGFP-VIIKMVNDRKAYIDDSLRKAHEANEKLTNIQKESESILQ 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+   I+  A    + + +      +  S+  L + + +I   K  A R +  ++A+
Sbjct: 71  EAREKQATILKEAAETREAIVQATQAKAQAESSRLLAEAKAEIEGEKQNAIRDIRLQVAE 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQ 161
            SV+I  +++ QK++ +     + ++ +  I   H+
Sbjct: 131 LSVQIAEKVLRQKLDTERSQMDMIDRLLDEISVEHK 166


>gi|251782138|ref|YP_002996440.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390767|dbj|BAH81226.1| ATP synthase B chain [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|323126992|gb|ADX24289.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 164

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 61/153 (39%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAESQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRSEASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + +  +  +   
Sbjct: 132 LTVLLAEKIMGANLDKAAQSQLIDSYLDDLGEA 164


>gi|227552049|ref|ZP_03982098.1| H(+)-transporting ATPase F(0) B subunit [Enterococcus faecium
           TX1330]
 gi|257882703|ref|ZP_05662356.1| ATP synthase F0 [Enterococcus faecium 1,231,502]
 gi|257886789|ref|ZP_05666442.1| ATP synthase F0 [Enterococcus faecium 1,141,733]
 gi|257895357|ref|ZP_05675010.1| ATP synthase F0 [Enterococcus faecium Com12]
 gi|257897969|ref|ZP_05677622.1| ATP synthase F0 [Enterococcus faecium Com15]
 gi|261208696|ref|ZP_05923133.1| ATP synthase F0 [Enterococcus faecium TC 6]
 gi|289566047|ref|ZP_06446484.1| ATP synthase F0, B subunit [Enterococcus faecium D344SRF]
 gi|293378228|ref|ZP_06624397.1| ATP synthase F0, B subunit [Enterococcus faecium PC4.1]
 gi|293556420|ref|ZP_06675001.1| ATP synthase F0, B subunit [Enterococcus faecium E1039]
 gi|293572429|ref|ZP_06683409.1| ATP synthase F0, B subunit [Enterococcus faecium E980]
 gi|294617577|ref|ZP_06697207.1| ATP synthase F0, B subunit [Enterococcus faecium E1679]
 gi|294623200|ref|ZP_06702078.1| ATP synthase F0, B subunit [Enterococcus faecium U0317]
 gi|227178802|gb|EEI59774.1| H(+)-transporting ATPase F(0) B subunit [Enterococcus faecium
           TX1330]
 gi|257818361|gb|EEV45689.1| ATP synthase F0 [Enterococcus faecium 1,231,502]
 gi|257822843|gb|EEV49775.1| ATP synthase F0 [Enterococcus faecium 1,141,733]
 gi|257831922|gb|EEV58343.1| ATP synthase F0 [Enterococcus faecium Com12]
 gi|257835881|gb|EEV60955.1| ATP synthase F0 [Enterococcus faecium Com15]
 gi|260077198|gb|EEW64918.1| ATP synthase F0 [Enterococcus faecium TC 6]
 gi|289162154|gb|EFD10017.1| ATP synthase F0, B subunit [Enterococcus faecium D344SRF]
 gi|291596183|gb|EFF27446.1| ATP synthase F0, B subunit [Enterococcus faecium E1679]
 gi|291597395|gb|EFF28568.1| ATP synthase F0, B subunit [Enterococcus faecium U0317]
 gi|291601487|gb|EFF31758.1| ATP synthase F0, B subunit [Enterococcus faecium E1039]
 gi|291607491|gb|EFF36833.1| ATP synthase F0, B subunit [Enterococcus faecium E980]
 gi|292643092|gb|EFF61233.1| ATP synthase F0, B subunit [Enterococcus faecium PC4.1]
          Length = 174

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 68/149 (45%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L+ ++       +   L    DKI +D+  A + R  S  +  + +++      +  
Sbjct: 25  FLILLALLKHFAWGPISDILKKREDKIANDLDSAEQSRINSAKMEQEREQQLLASRSDAA 84

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK   ++  +   ++ ++ +A      +  I   +  A   +   +A+ S++I  
Sbjct: 85  DIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKDDVAELSLQIAE 144

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           +I++++++ +++ S+  + I  + S ++ 
Sbjct: 145 KILNKELSPEMHESLINQYIEGLGSSNET 173


>gi|222035449|emb|CAP78194.1| ATP synthase B chain [Escherichia coli LF82]
 gi|312948302|gb|ADR29129.1| F0F1 ATP synthase subunit B [Escherichia coli O83:H1 str. NRG 857C]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|319902310|ref|YP_004162038.1| ATP synthase F0 subcomplex B subunit [Bacteroides helcogenes P
           36-108]
 gi|319417341|gb|ADV44452.1| ATP synthase F0 subcomplex B subunit [Bacteroides helcogenes P
           36-108]
          Length = 168

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 65/151 (43%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++ + ++   + I   +  AR    +   +  +     +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITNMVEGRKNYIDQSLEVAREANAQLARLKEEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  +  + ++   L ++ ++I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMHERDKIIVEARKQADIVAQKELDEVRKQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSI 156
            SV+I  +++ + +++      + ++ +  +
Sbjct: 131 LSVDIAEKVLRKNLDEKHEQMDMIDRMLDEV 161


>gi|292490164|ref|YP_003533059.1| ATP synthase subunit B protein [Erwinia amylovora CFBP1430]
 gi|292901166|ref|YP_003540535.1| ATP synthase subunit B protein [Erwinia amylovora ATCC 49946]
 gi|291201014|emb|CBJ48153.1| ATP synthase subunit B protein [Erwinia amylovora ATCC 49946]
 gi|291555606|emb|CBA24228.1| ATP synthase subunit B protein [Erwinia amylovora CFBP1430]
 gi|312174357|emb|CBX82610.1| ATP synthase subunit B protein [Erwinia amylovora ATCC BAA-2158]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    ++ D +  A R R+  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERARKDLDLAQAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +++ + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDRLKKAKDDAQVIIEQANKRRAQILDEAKAEAEQERNKIVTQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|209548121|ref|YP_002280038.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226694453|sp|B5ZS19|ATPF_RHILW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209533877|gb|ACI53812.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 163

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 49/159 (30%), Positives = 93/159 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRTALSEQKIKQAEVEAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +   D ++     ++ ++ +  V S +F   +  +++  
Sbjct: 124 SAAVDLAIAAAETVLGKQADAKVQSELFGNAVGQVKTRL 162


>gi|78064761|ref|YP_367530.1| F0F1 ATP synthase subunit B [Burkholderia sp. 383]
 gi|123569635|sp|Q39KY0|ATPF_BURS3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77965506|gb|ABB06886.1| ATP synthase F0 subcomplex B subunit [Burkholderia sp. 383]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + +    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKSNAQAEAARIIAQAKAEAEQQIVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVATLAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|115350149|ref|YP_771988.1| F0F1 ATP synthase subunit B [Burkholderia ambifaria AMMD]
 gi|170699470|ref|ZP_02890513.1| ATP synthase F0, B subunit [Burkholderia ambifaria IOP40-10]
 gi|172059168|ref|YP_001806820.1| F0F1 ATP synthase subunit B [Burkholderia ambifaria MC40-6]
 gi|122324411|sp|Q0BJL9|ATPF_BURCM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741314|sp|B1YQL0|ATPF_BURA4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|115280137|gb|ABI85654.1| ATP synthase F0 subcomplex B subunit [Burkholderia ambifaria AMMD]
 gi|170135619|gb|EDT03904.1| ATP synthase F0, B subunit [Burkholderia ambifaria IOP40-10]
 gi|171991685|gb|ACB62604.1| ATP synthase F0, B subunit [Burkholderia ambifaria MC40-6]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + +    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVASLAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|269216179|ref|ZP_06160033.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
 gi|269130438|gb|EEZ61516.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
          Length = 215

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 73/156 (46%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   + ++ +I  VI+       +    L+  A  IR+D+  A   R++SE +L +YK
Sbjct: 57  MNEFIPMLVAFVILWVILAKFG-WPVFDRMLEKRATTIREDLKSAEAARQESEKLLAEYK 115

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ +  + E   I+  AK   + +  +  +     +A  ++  +  I   + +A   L  
Sbjct: 116 QQLADAKAEASSIVAEAKKTGEAVKADIQKKAADEAAGMIEKAQAAIEAERKQAVSDLQK 175

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +AD SV +  ++I   ++DD + +I ++ +    S
Sbjct: 176 SVADISVSVASKLIGTDLSDDEHRAIIKRYVEEAGS 211


>gi|53724012|ref|YP_104458.1| F0F1 ATP synthase subunit B [Burkholderia mallei ATCC 23344]
 gi|76810287|ref|YP_331599.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 1710b]
 gi|83720034|ref|YP_443804.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis E264]
 gi|121598244|ref|YP_994638.1| F0F1 ATP synthase subunit B [Burkholderia mallei SAVP1]
 gi|124385618|ref|YP_001027571.1| F0F1 ATP synthase subunit B [Burkholderia mallei NCTC 10229]
 gi|126440159|ref|YP_001060965.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 668]
 gi|126449447|ref|YP_001082531.1| F0F1 ATP synthase subunit B [Burkholderia mallei NCTC 10247]
 gi|126454664|ref|YP_001068265.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 1106a]
 gi|134281630|ref|ZP_01768338.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 305]
 gi|167001254|ref|ZP_02267053.1| ATP synthase F0, B subunit [Burkholderia mallei PRL-20]
 gi|167582838|ref|ZP_02375712.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis TXDOH]
 gi|167620978|ref|ZP_02389609.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis Bt4]
 gi|167721826|ref|ZP_02405062.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei DM98]
 gi|167740798|ref|ZP_02413572.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 14]
 gi|167818013|ref|ZP_02449693.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 91]
 gi|167826376|ref|ZP_02457847.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 9]
 gi|167847895|ref|ZP_02473403.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei B7210]
 gi|167896452|ref|ZP_02483854.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 7894]
 gi|167904854|ref|ZP_02492059.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei NCTC 13177]
 gi|167913132|ref|ZP_02500223.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei 112]
 gi|167921069|ref|ZP_02508160.1| F0F1 ATP synthase subunit B [Burkholderia pseudomallei BCC215]
 gi|217424102|ref|ZP_03455602.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 576]
 gi|226193153|ref|ZP_03788763.1| ATP synthase F0, B subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237814349|ref|YP_002898800.1| ATP synthase F0, B subunit [Burkholderia pseudomallei MSHR346]
 gi|238561564|ref|ZP_00441836.2| ATP synthase F0, B subunit [Burkholderia mallei GB8 horse 4]
 gi|242314404|ref|ZP_04813420.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1106b]
 gi|254174695|ref|ZP_04881356.1| ATP synthase F0, B subunit [Burkholderia mallei ATCC 10399]
 gi|254184027|ref|ZP_04890618.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1655]
 gi|254186492|ref|ZP_04893009.1| ATP synthase F0, B subunit [Burkholderia pseudomallei Pasteur
           52237]
 gi|254194792|ref|ZP_04901223.1| ATP synthase F0, B subunit [Burkholderia pseudomallei S13]
 gi|254201533|ref|ZP_04907897.1| ATP synthase F0, B subunit [Burkholderia mallei FMH]
 gi|254206871|ref|ZP_04913222.1| ATP synthase F0, B subunit [Burkholderia mallei JHU]
 gi|254261120|ref|ZP_04952174.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1710a]
 gi|254298699|ref|ZP_04966150.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 406e]
 gi|254357423|ref|ZP_04973697.1| ATP synthase F0, B subunit [Burkholderia mallei 2002721280]
 gi|81603981|sp|Q62FR9|ATPF_BURMA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123536047|sp|Q2STE5|ATPF_BURTA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123600836|sp|Q3JXV4|ATPF_BURP1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741319|sp|A2S6K2|ATPF_BURM9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741320|sp|A3P0Z4|ATPF_BURP0 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741348|sp|A1V8T5|ATPF_BURMS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741349|sp|A3NF44|ATPF_BURP6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741356|sp|A3MQJ5|ATPF_BURM7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741363|sp|Q63PH6|ATPF_BURPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|52427435|gb|AAU48028.1| ATP synthase F0, B subunit [Burkholderia mallei ATCC 23344]
 gi|76579740|gb|ABA49215.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1710b]
 gi|83653859|gb|ABC37922.1| ATP synthase F0, B subunit [Burkholderia thailandensis E264]
 gi|121227054|gb|ABM49572.1| ATP synthase F0, B subunit [Burkholderia mallei SAVP1]
 gi|124293638|gb|ABN02907.1| ATP synthase F0, B subunit [Burkholderia mallei NCTC 10229]
 gi|126219652|gb|ABN83158.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 668]
 gi|126228306|gb|ABN91846.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1106a]
 gi|126242317|gb|ABO05410.1| ATP synthase F0, B subunit [Burkholderia mallei NCTC 10247]
 gi|134247297|gb|EBA47383.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 305]
 gi|147747427|gb|EDK54503.1| ATP synthase F0, B subunit [Burkholderia mallei FMH]
 gi|147752413|gb|EDK59479.1| ATP synthase F0, B subunit [Burkholderia mallei JHU]
 gi|148026487|gb|EDK84572.1| ATP synthase F0, B subunit [Burkholderia mallei 2002721280]
 gi|157808474|gb|EDO85644.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 406e]
 gi|157934177|gb|EDO89847.1| ATP synthase F0, B subunit [Burkholderia pseudomallei Pasteur
           52237]
 gi|160695740|gb|EDP85710.1| ATP synthase F0, B subunit [Burkholderia mallei ATCC 10399]
 gi|169651542|gb|EDS84235.1| ATP synthase F0, B subunit [Burkholderia pseudomallei S13]
 gi|184214559|gb|EDU11602.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1655]
 gi|217393165|gb|EEC33187.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 576]
 gi|225934753|gb|EEH30730.1| ATP synthase F0, B subunit [Burkholderia pseudomallei Pakistan 9]
 gi|237506776|gb|ACQ99094.1| ATP synthase F0, B subunit [Burkholderia pseudomallei MSHR346]
 gi|238524336|gb|EEP87769.1| ATP synthase F0, B subunit [Burkholderia mallei GB8 horse 4]
 gi|242137643|gb|EES24045.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1106b]
 gi|243062879|gb|EES45065.1| ATP synthase F0, B subunit [Burkholderia mallei PRL-20]
 gi|254219809|gb|EET09193.1| ATP synthase F0, B subunit [Burkholderia pseudomallei 1710a]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 72/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA  +A+E   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRALAVADEIKTNAQAEAARIIAQAKAEAEQQIVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQTAHAELLNQLKAEL 156


>gi|331266493|ref|YP_004326123.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
 gi|326683165|emb|CBZ00783.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
          Length = 164

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 74/153 (48%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     I L+++V     S L S  +  A+KI  DI  A + R+K+E +  + +++ +
Sbjct: 12  FILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKREDELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + II  AK  A+    +   + +  +    +   Q+I   K EA + +  ++AD
Sbjct: 72  GSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGEVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++ +  +IIS+ ++   +  + ++ I  ++  
Sbjct: 132 LTISLAGKIISKNLDSHAHKELIDQYIDQLEEA 164


>gi|170767001|ref|ZP_02901454.1| ATP synthase F0, B subunit [Escherichia albertii TW07627]
 gi|170124439|gb|EDS93370.1| ATP synthase F0, B subunit [Escherichia albertii TW07627]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|86160753|ref|YP_467538.1| ATP synthase F0 subunit B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497396|sp|Q2IHP6|ATPF_ANADE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|85777264|gb|ABC84101.1| ATP synthase F0 subcomplex B subunit [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 179

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 69/155 (44%), Gaps = 1/155 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    ++ ++ L ++        ++  L      IR+ I  A++ R ++E +L   KE  
Sbjct: 24  TLWTAITFLVMLAVLAKF-AWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKESL 82

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           SK + E  E+    +   + L +E      + +   + +  ++I    ++AK  L A++ 
Sbjct: 83  SKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELVKAKAELKAQVV 142

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           D +++    ++   +++    ++ E+ I+ + +  
Sbjct: 143 DLAIDAASRLVKANLDEKSQRALVEEYIAQLPANR 177


>gi|258406336|ref|YP_003199078.1| ATP synthase F0, B subunit [Desulfohalobium retbaense DSM 5692]
 gi|257798563|gb|ACV69500.1| ATP synthase F0, B subunit [Desulfohalobium retbaense DSM 5692]
          Length = 192

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/150 (14%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +IF+ I +Y      +  F      +I  ++ +    +  +E  L + ++  +
Sbjct: 41  FWRTVNFVIFVAI-IYKLAGKRIREFFTGRRHRIATELKDLETRKADTEKRLAEVEQSIA 99

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            ++++  +I+   K + + L E       + +       E+       +A + + A+IA+
Sbjct: 100 DLDKKREDILAEYKQQGEALKESIVAKAHERAEQIQAQAEKTAQQELRQAVKDVRAEIAE 159

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
                  + I+ K+N + +  + +  ++ +
Sbjct: 160 AVASAAEKSIADKLNKEDHKKLVQDYLTKV 189


>gi|206575827|ref|YP_002241283.1| ATP synthase F0, B subunit [Klebsiella pneumoniae 342]
 gi|288937922|ref|YP_003441981.1| ATP synthase F0 subunit beta [Klebsiella variicola At-22]
 gi|290511662|ref|ZP_06551030.1| ATP synthase F0, B subunit [Klebsiella sp. 1_1_55]
 gi|226741489|sp|B5XZM0|ATPF_KLEP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|206564885|gb|ACI06661.1| ATP synthase F0, B subunit [Klebsiella pneumoniae 342]
 gi|288892631|gb|ADC60949.1| ATP synthase F0, B subunit [Klebsiella variicola At-22]
 gi|289775452|gb|EFD83452.1| ATP synthase F0, B subunit [Klebsiella sp. 1_1_55]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   L++ ++    +I D +  A R ++  +     
Sbjct: 1   MNMNATILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|170694316|ref|ZP_02885470.1| ATP synthase F0, B subunit [Burkholderia graminis C4D1M]
 gi|187925867|ref|YP_001897509.1| F0F1 ATP synthase subunit B [Burkholderia phytofirmans PsJN]
 gi|323527845|ref|YP_004229998.1| ATP synthase F0 subunit B [Burkholderia sp. CCGE1001]
 gi|226741322|sp|B2T7K4|ATPF_BURPP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|170140739|gb|EDT08913.1| ATP synthase F0, B subunit [Burkholderia graminis C4D1M]
 gi|187717061|gb|ACD18285.1| ATP synthase F0, B subunit [Burkholderia phytofirmans PsJN]
 gi|323384847|gb|ADX56938.1| ATP synthase F0, B subunit [Burkholderia sp. CCGE1001]
          Length = 156

 Score = 82.2 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKAELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA  +A+E     +  +A  +   +       ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAVAVADEIKAQAQAEAARIIAQAKADAEQQVVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQAAHADLLNQLKAEL 156


>gi|15804336|ref|NP_290375.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 EDL933]
 gi|15833932|ref|NP_312705.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. Sakai]
 gi|16131604|ref|NP_418192.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. MG1655]
 gi|24115039|ref|NP_709549.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a str. 301]
 gi|26250482|ref|NP_756522.1| F0F1 ATP synthase subunit B [Escherichia coli CFT073]
 gi|30064959|ref|NP_839130.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a str. 2457T]
 gi|74314238|ref|YP_312657.1| F0F1 ATP synthase subunit B [Shigella sonnei Ss046]
 gi|82546103|ref|YP_410050.1| F0F1 ATP synthase subunit B [Shigella boydii Sb227]
 gi|82779072|ref|YP_405421.1| F0F1 ATP synthase subunit B [Shigella dysenteriae Sd197]
 gi|89110271|ref|AP_004051.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. W3110]
 gi|91213263|ref|YP_543249.1| F0F1 ATP synthase subunit B [Escherichia coli UTI89]
 gi|110644077|ref|YP_671807.1| F0F1 ATP synthase subunit B [Escherichia coli 536]
 gi|110807560|ref|YP_691080.1| F0F1 ATP synthase subunit B [Shigella flexneri 5 str. 8401]
 gi|157156607|ref|YP_001465227.1| F0F1 ATP synthase subunit B [Escherichia coli E24377A]
 gi|157163218|ref|YP_001460536.1| F0F1 ATP synthase subunit B [Escherichia coli HS]
 gi|168748534|ref|ZP_02773556.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113]
 gi|168753638|ref|ZP_02778645.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401]
 gi|168759936|ref|ZP_02784943.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501]
 gi|168766236|ref|ZP_02791243.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486]
 gi|168772215|ref|ZP_02797222.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196]
 gi|168779971|ref|ZP_02804978.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076]
 gi|168786579|ref|ZP_02811586.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869]
 gi|168798784|ref|ZP_02823791.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508]
 gi|170022227|ref|YP_001727181.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC 8739]
 gi|170083237|ref|YP_001732557.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170680530|ref|YP_001746066.1| F0F1 ATP synthase subunit B [Escherichia coli SMS-3-5]
 gi|187730481|ref|YP_001882427.1| F0F1 ATP synthase subunit B [Shigella boydii CDC 3083-94]
 gi|188495894|ref|ZP_03003164.1| ATP synthase F0, B subunit [Escherichia coli 53638]
 gi|191165830|ref|ZP_03027668.1| ATP synthase F0, B subunit [Escherichia coli B7A]
 gi|191170575|ref|ZP_03032128.1| ATP synthase F0, B subunit [Escherichia coli F11]
 gi|193063838|ref|ZP_03044925.1| ATP synthase F0, B subunit [Escherichia coli E22]
 gi|193069162|ref|ZP_03050119.1| ATP synthase F0, B subunit [Escherichia coli E110019]
 gi|194428101|ref|ZP_03060645.1| ATP synthase F0, B subunit [Escherichia coli B171]
 gi|194431089|ref|ZP_03063382.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012]
 gi|194435957|ref|ZP_03068060.1| ATP synthase F0, B subunit [Escherichia coli 101-1]
 gi|195936363|ref|ZP_03081745.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. EC4024]
 gi|208808170|ref|ZP_03250507.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4206]
 gi|208812218|ref|ZP_03253547.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4045]
 gi|208821029|ref|ZP_03261349.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4042]
 gi|209396106|ref|YP_002273264.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4115]
 gi|209921217|ref|YP_002295301.1| F0F1 ATP synthase subunit B [Escherichia coli SE11]
 gi|215489074|ref|YP_002331505.1| F0F1 ATP synthase subunit B [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324928|ref|ZP_03441012.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. TW14588]
 gi|218551270|ref|YP_002385062.1| F0F1 ATP synthase subunit B [Escherichia fergusonii ATCC 35469]
 gi|218556307|ref|YP_002389221.1| F0F1 ATP synthase subunit B [Escherichia coli IAI1]
 gi|218560811|ref|YP_002393724.1| F0F1 ATP synthase subunit B [Escherichia coli S88]
 gi|218692024|ref|YP_002400236.1| F0F1 ATP synthase subunit B [Escherichia coli ED1a]
 gi|218697462|ref|YP_002405129.1| F0F1 ATP synthase subunit B [Escherichia coli 55989]
 gi|218702586|ref|YP_002410215.1| F0F1 ATP synthase subunit B [Escherichia coli IAI39]
 gi|218707382|ref|YP_002414901.1| F0F1 ATP synthase subunit B [Escherichia coli UMN026]
 gi|227883958|ref|ZP_04001763.1| H(+)-transporting two-sector ATPase [Escherichia coli 83972]
 gi|237703537|ref|ZP_04534018.1| membrane-bound ATP synthase [Escherichia sp. 3_2_53FAA]
 gi|238902827|ref|YP_002928623.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli BW2952]
 gi|253775629|ref|YP_003038460.1| F0F1 ATP synthase subunit B [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038955|ref|ZP_04873007.1| predicted protein [Escherichia sp. 1_1_43]
 gi|254163688|ref|YP_003046796.1| F0F1 ATP synthase subunit B [Escherichia coli B str. REL606]
 gi|254795742|ref|YP_003080579.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. TW14359]
 gi|256021242|ref|ZP_05435107.1| F0F1 ATP synthase subunit B [Shigella sp. D9]
 gi|256025533|ref|ZP_05439398.1| F0F1 ATP synthase subunit B [Escherichia sp. 4_1_40B]
 gi|260846479|ref|YP_003224257.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O103:H2 str. 12009]
 gi|260857849|ref|YP_003231740.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O26:H11 str. 11368]
 gi|260870470|ref|YP_003236872.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O111:H- str. 11128]
 gi|261225893|ref|ZP_05940174.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261258938|ref|ZP_05951471.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291285160|ref|YP_003501978.1| ATP synthase subunit B [Escherichia coli O55:H7 str. CB9615]
 gi|293407373|ref|ZP_06651295.1| F0F1 ATP synthase subunit B [Escherichia coli FVEC1412]
 gi|293413186|ref|ZP_06655852.1| ATP synthase F0 [Escherichia coli B354]
 gi|293417209|ref|ZP_06659836.1| ATP synthase F0 [Escherichia coli B185]
 gi|293464062|ref|ZP_06664476.1| ATP synthase F0 [Escherichia coli B088]
 gi|297518324|ref|ZP_06936710.1| F0F1 ATP synthase subunit B [Escherichia coli OP50]
 gi|298383115|ref|ZP_06992710.1| ATP synthase subunit B [Escherichia coli FVEC1302]
 gi|300815009|ref|ZP_07095234.1| ATP synthase F0, B subunit [Escherichia coli MS 107-1]
 gi|300824554|ref|ZP_07104664.1| ATP synthase F0, B subunit [Escherichia coli MS 119-7]
 gi|300896065|ref|ZP_07114624.1| ATP synthase F0, B subunit [Escherichia coli MS 198-1]
 gi|300902982|ref|ZP_07120925.1| ATP synthase F0, B subunit [Escherichia coli MS 84-1]
 gi|300916395|ref|ZP_07133135.1| ATP synthase F0, B subunit [Escherichia coli MS 115-1]
 gi|300925566|ref|ZP_07141439.1| ATP synthase F0, B subunit [Escherichia coli MS 182-1]
 gi|300932371|ref|ZP_07147636.1| ATP synthase F0, B subunit [Escherichia coli MS 187-1]
 gi|300940922|ref|ZP_07155448.1| ATP synthase F0, B subunit [Escherichia coli MS 21-1]
 gi|300950653|ref|ZP_07164547.1| ATP synthase F0, B subunit [Escherichia coli MS 116-1]
 gi|300958744|ref|ZP_07170861.1| ATP synthase F0, B subunit [Escherichia coli MS 175-1]
 gi|300983832|ref|ZP_07176774.1| ATP synthase F0, B subunit [Escherichia coli MS 200-1]
 gi|300984350|ref|ZP_07176956.1| ATP synthase F0, B subunit [Escherichia coli MS 45-1]
 gi|301019832|ref|ZP_07183973.1| ATP synthase F0, B subunit [Escherichia coli MS 196-1]
 gi|301020860|ref|ZP_07184921.1| ATP synthase F0, B subunit [Escherichia coli MS 69-1]
 gi|301047559|ref|ZP_07194631.1| ATP synthase F0, B subunit [Escherichia coli MS 185-1]
 gi|301305615|ref|ZP_07211705.1| ATP synthase F0, B subunit [Escherichia coli MS 124-1]
 gi|301324963|ref|ZP_07218518.1| ATP synthase F0, B subunit [Escherichia coli MS 78-1]
 gi|301644412|ref|ZP_07244411.1| ATP synthase F0, B subunit [Escherichia coli MS 146-1]
 gi|306815912|ref|ZP_07450050.1| F0F1 ATP synthase subunit B [Escherichia coli NC101]
 gi|307140436|ref|ZP_07499792.1| F0F1 ATP synthase subunit B [Escherichia coli H736]
 gi|307313192|ref|ZP_07592817.1| ATP synthase F0, B subunit [Escherichia coli W]
 gi|309784447|ref|ZP_07679086.1| ATP synthase F0, B subunit [Shigella dysenteriae 1617]
 gi|309795707|ref|ZP_07690122.1| ATP synthase F0, B subunit [Escherichia coli MS 145-7]
 gi|312967854|ref|ZP_07782066.1| ATP synthase F0, B subunit [Escherichia coli 2362-75]
 gi|312971972|ref|ZP_07786146.1| ATP synthase F0, B subunit [Escherichia coli 1827-70]
 gi|331644463|ref|ZP_08345592.1| ATP synthase F0, B subunit [Escherichia coli H736]
 gi|331649562|ref|ZP_08350648.1| ATP synthase F0, B subunit [Escherichia coli M605]
 gi|331655398|ref|ZP_08356397.1| ATP synthase F0, B subunit [Escherichia coli M718]
 gi|331660080|ref|ZP_08361018.1| ATP synthase F0, B subunit [Escherichia coli TA206]
 gi|331665390|ref|ZP_08366291.1| ATP synthase F0, B subunit [Escherichia coli TA143]
 gi|331670586|ref|ZP_08371425.1| ATP synthase F0, B subunit [Escherichia coli TA271]
 gi|331679840|ref|ZP_08380510.1| ATP synthase F0, B subunit [Escherichia coli H591]
 gi|331685463|ref|ZP_08386049.1| ATP synthase F0, B subunit [Escherichia coli H299]
 gi|332282469|ref|ZP_08394882.1| membrane-bound ATP synthase [Shigella sp. D9]
 gi|81175151|sp|P0ABA2|ATPF_ECO57 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81175152|sp|P0ABA1|ATPF_ECOL6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81175153|sp|P0ABA0|ATPF_ECOLI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81175154|sp|P0ABA3|ATPF_SHIFL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122421811|sp|Q1R4J6|ATPF_ECOUT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123342305|sp|Q0SYU0|ATPF_SHIF8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123343410|sp|Q0TAX3|ATPF_ECOL5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123558238|sp|Q31UN6|ATPF_SHIBS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123561164|sp|Q329S5|ATPF_SHIDS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123615763|sp|Q3YVP0|ATPF_SHISS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694920|sp|B2TUN9|ATPF_SHIB3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741439|sp|A7ZTU8|ATPF_ECO24 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741440|sp|B5YXE0|ATPF_ECO5E RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741441|sp|B1X9W4|ATPF_ECODH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741442|sp|A8A6J9|ATPF_ECOHS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741443|sp|B1IX02|ATPF_ECOLC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741444|sp|B6I3X3|ATPF_ECOSE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741445|sp|B1LL63|ATPF_ECOSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741450|sp|B7LK81|ATPF_ESCF3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|12518593|gb|AAG58939.1|AE005605_7 membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
           O157:H7 str. EDL933]
 gi|26110912|gb|AAN83096.1|AE016769_211 ATP synthase B chain [Escherichia coli CFT073]
 gi|146321|gb|AAA83871.1| integral membrane proton channel F0 subunit B [Escherichia coli]
 gi|148135|gb|AAA24733.1| ATP synthase b subunit [Escherichia coli]
 gi|290585|gb|AAA62088.1| ATP synthase F0 subunit b [Escherichia coli]
 gi|581045|emb|CAA23516.1| unnamed protein product [Escherichia coli]
 gi|581046|emb|CAA23523.1| atpF [Escherichia coli]
 gi|581249|emb|CAA25778.1| unnamed protein product [Escherichia coli]
 gi|1790174|gb|AAC76759.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13364153|dbj|BAB38101.1| membrane-bound ATP synthase subunit b AtpF [Escherichia coli
           O157:H7 str. Sakai]
 gi|24054298|gb|AAN45256.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           flexneri 2a str. 301]
 gi|30043220|gb|AAP18941.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           flexneri 2a str. 2457T]
 gi|73857715|gb|AAZ90422.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella sonnei
           Ss046]
 gi|81243220|gb|ABB63930.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           dysenteriae Sd197]
 gi|81247514|gb|ABB68222.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella boydii
           Sb227]
 gi|85676302|dbj|BAE77552.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K12 substr. W3110]
 gi|91074837|gb|ABE09718.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli
           UTI89]
 gi|110345669|gb|ABG71906.1| ATP synthase B chain [Escherichia coli 536]
 gi|110617108|gb|ABF05775.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           flexneri 5 str. 8401]
 gi|157068898|gb|ABV08153.1| ATP synthase F0, B subunit [Escherichia coli HS]
 gi|157078637|gb|ABV18345.1| ATP synthase F0, B subunit [Escherichia coli E24377A]
 gi|169757155|gb|ACA79854.1| ATP synthase F0, B subunit [Escherichia coli ATCC 8739]
 gi|169891072|gb|ACB04779.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170518248|gb|ACB16426.1| ATP synthase F0, B subunit [Escherichia coli SMS-3-5]
 gi|187427473|gb|ACD06747.1| ATP synthase F0, B subunit [Shigella boydii CDC 3083-94]
 gi|187771617|gb|EDU35461.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196]
 gi|188016977|gb|EDU55099.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113]
 gi|188491093|gb|EDU66196.1| ATP synthase F0, B subunit [Escherichia coli 53638]
 gi|189002279|gb|EDU71265.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076]
 gi|189358998|gb|EDU77417.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401]
 gi|189364601|gb|EDU83020.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486]
 gi|189369852|gb|EDU88268.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501]
 gi|189373288|gb|EDU91704.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869]
 gi|189378758|gb|EDU97174.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508]
 gi|190904154|gb|EDV63865.1| ATP synthase F0, B subunit [Escherichia coli B7A]
 gi|190909383|gb|EDV68969.1| ATP synthase F0, B subunit [Escherichia coli F11]
 gi|192930553|gb|EDV83160.1| ATP synthase F0, B subunit [Escherichia coli E22]
 gi|192957486|gb|EDV87932.1| ATP synthase F0, B subunit [Escherichia coli E110019]
 gi|194413859|gb|EDX30137.1| ATP synthase F0, B subunit [Escherichia coli B171]
 gi|194420544|gb|EDX36620.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012]
 gi|194425500|gb|EDX41484.1| ATP synthase F0, B subunit [Escherichia coli 101-1]
 gi|208727971|gb|EDZ77572.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4206]
 gi|208733495|gb|EDZ82182.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4045]
 gi|208741152|gb|EDZ88834.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4042]
 gi|209157506|gb|ACI34939.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4115]
 gi|209753848|gb|ACI75231.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753850|gb|ACI75232.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753852|gb|ACI75233.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753854|gb|ACI75234.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753856|gb|ACI75235.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209914476|dbj|BAG79550.1| ATP synthase subunit B [Escherichia coli SE11]
 gi|215267146|emb|CAS11594.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217321149|gb|EEC29573.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. TW14588]
 gi|218354194|emb|CAV00825.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli 55989]
 gi|218358812|emb|CAQ91469.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           fergusonii ATCC 35469]
 gi|218363076|emb|CAR00714.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli IAI1]
 gi|218367580|emb|CAR05364.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli S88]
 gi|218372572|emb|CAR20446.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli IAI39]
 gi|218429588|emb|CAR10410.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli ED1a]
 gi|218434479|emb|CAR15406.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli UMN026]
 gi|226838920|gb|EEH70947.1| predicted protein [Escherichia sp. 1_1_43]
 gi|226902801|gb|EEH89060.1| membrane-bound ATP synthase [Escherichia sp. 3_2_53FAA]
 gi|227839236|gb|EEJ49702.1| H(+)-transporting two-sector ATPase [Escherichia coli 83972]
 gi|238861065|gb|ACR63063.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli BW2952]
 gi|242379274|emb|CAQ34081.1| ATP synthase, F0 complex, b subunit, subunit of b subunit complex,
           ATP synthase, F0 complex and ATP synthase [Escherichia
           coli BL21(DE3)]
 gi|253326673|gb|ACT31275.1| ATP synthase F0, B subunit [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975589|gb|ACT41260.1| F0F1 ATP synthase subunit B [Escherichia coli B str. REL606]
 gi|253979745|gb|ACT45415.1| F0F1 ATP synthase subunit B [Escherichia coli BL21(DE3)]
 gi|254595142|gb|ACT74503.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli O157:H7 str. TW14359]
 gi|257756498|dbj|BAI28000.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O26:H11 str. 11368]
 gi|257761626|dbj|BAI33123.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O103:H2 str. 12009]
 gi|257766826|dbj|BAI38321.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O111:H- str. 11128]
 gi|260451407|gb|ACX41829.1| ATP synthase F0, B subunit [Escherichia coli DH1]
 gi|281180794|dbj|BAI57124.1| ATP synthase subunit B [Escherichia coli SE15]
 gi|281603134|gb|ADA76118.1| ATP synthase B chain [Shigella flexneri 2002017]
 gi|284923850|emb|CBG36949.1| ATP synthase subunit B [Escherichia coli 042]
 gi|290765033|gb|ADD58994.1| ATP synthase B chain [Escherichia coli O55:H7 str. CB9615]
 gi|291321694|gb|EFE61130.1| ATP synthase F0 [Escherichia coli B088]
 gi|291425664|gb|EFE98700.1| F0F1 ATP synthase subunit B [Escherichia coli FVEC1412]
 gi|291431240|gb|EFF04233.1| ATP synthase F0 [Escherichia coli B185]
 gi|291468319|gb|EFF10814.1| ATP synthase F0 [Escherichia coli B354]
 gi|294490671|gb|ADE89427.1| ATP synthase F0, B subunit [Escherichia coli IHE3034]
 gi|298276951|gb|EFI18469.1| ATP synthase subunit B [Escherichia coli FVEC1302]
 gi|299882060|gb|EFI90271.1| ATP synthase F0, B subunit [Escherichia coli MS 196-1]
 gi|300300545|gb|EFJ56930.1| ATP synthase F0, B subunit [Escherichia coli MS 185-1]
 gi|300306861|gb|EFJ61381.1| ATP synthase F0, B subunit [Escherichia coli MS 200-1]
 gi|300314625|gb|EFJ64409.1| ATP synthase F0, B subunit [Escherichia coli MS 175-1]
 gi|300360051|gb|EFJ75921.1| ATP synthase F0, B subunit [Escherichia coli MS 198-1]
 gi|300398430|gb|EFJ81968.1| ATP synthase F0, B subunit [Escherichia coli MS 69-1]
 gi|300404977|gb|EFJ88515.1| ATP synthase F0, B subunit [Escherichia coli MS 84-1]
 gi|300408386|gb|EFJ91924.1| ATP synthase F0, B subunit [Escherichia coli MS 45-1]
 gi|300416299|gb|EFJ99609.1| ATP synthase F0, B subunit [Escherichia coli MS 115-1]
 gi|300418340|gb|EFK01651.1| ATP synthase F0, B subunit [Escherichia coli MS 182-1]
 gi|300450023|gb|EFK13643.1| ATP synthase F0, B subunit [Escherichia coli MS 116-1]
 gi|300454352|gb|EFK17845.1| ATP synthase F0, B subunit [Escherichia coli MS 21-1]
 gi|300459876|gb|EFK23369.1| ATP synthase F0, B subunit [Escherichia coli MS 187-1]
 gi|300522955|gb|EFK44024.1| ATP synthase F0, B subunit [Escherichia coli MS 119-7]
 gi|300531901|gb|EFK52963.1| ATP synthase F0, B subunit [Escherichia coli MS 107-1]
 gi|300839123|gb|EFK66883.1| ATP synthase F0, B subunit [Escherichia coli MS 124-1]
 gi|300848134|gb|EFK75894.1| ATP synthase F0, B subunit [Escherichia coli MS 78-1]
 gi|301077251|gb|EFK92057.1| ATP synthase F0, B subunit [Escherichia coli MS 146-1]
 gi|305850308|gb|EFM50765.1| F0F1 ATP synthase subunit B [Escherichia coli NC101]
 gi|306906875|gb|EFN37384.1| ATP synthase F0, B subunit [Escherichia coli W]
 gi|307555875|gb|ADN48650.1| membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
           ABU 83972]
 gi|307628810|gb|ADN73114.1| F0F1 ATP synthase subunit B [Escherichia coli UM146]
 gi|308120586|gb|EFO57848.1| ATP synthase F0, B subunit [Escherichia coli MS 145-7]
 gi|308927954|gb|EFP73422.1| ATP synthase F0, B subunit [Shigella dysenteriae 1617]
 gi|309704184|emb|CBJ03531.1| ATP synthase subunit B [Escherichia coli ETEC H10407]
 gi|310334349|gb|EFQ00554.1| ATP synthase F0, B subunit [Escherichia coli 1827-70]
 gi|312287415|gb|EFR15323.1| ATP synthase F0, B subunit [Escherichia coli 2362-75]
 gi|313647648|gb|EFS12096.1| ATP synthase F0, B subunit [Shigella flexneri 2a str. 2457T]
 gi|315063046|gb|ADT77373.1| F0 sector of membrane-bound ATP synthase, subunit B [Escherichia
           coli W]
 gi|315138321|dbj|BAJ45480.1| ATP synthase subunit B [Escherichia coli DH1]
 gi|315254571|gb|EFU34539.1| ATP synthase F0, B subunit [Escherichia coli MS 85-1]
 gi|315285547|gb|EFU44989.1| ATP synthase F0, B subunit [Escherichia coli MS 110-3]
 gi|315292822|gb|EFU52174.1| ATP synthase F0, B subunit [Escherichia coli MS 153-1]
 gi|315296880|gb|EFU56169.1| ATP synthase F0, B subunit [Escherichia coli MS 16-3]
 gi|320174627|gb|EFW49763.1| ATP synthase B chain [Shigella dysenteriae CDC 74-1112]
 gi|320180082|gb|EFW55024.1| ATP synthase B chain [Shigella boydii ATCC 9905]
 gi|320186281|gb|EFW61017.1| ATP synthase B chain [Shigella flexneri CDC 796-83]
 gi|320191160|gb|EFW65810.1| ATP synthase B chain [Escherichia coli O157:H7 str. EC1212]
 gi|320193719|gb|EFW68352.1| ATP synthase B chain [Escherichia coli WV_060327]
 gi|320201231|gb|EFW75812.1| ATP synthase B chain [Escherichia coli EC4100B]
 gi|320639464|gb|EFX09079.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. G5101]
 gi|320644904|gb|EFX13940.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H- str. 493-89]
 gi|320650170|gb|EFX18666.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H- str. H 2687]
 gi|320655519|gb|EFX23454.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320661142|gb|EFX28578.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320666271|gb|EFX33277.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. LSU-61]
 gi|323155417|gb|EFZ41600.1| ATP synthase F0, B subunit [Escherichia coli EPECa14]
 gi|323161012|gb|EFZ46931.1| ATP synthase F0, B subunit [Escherichia coli E128010]
 gi|323167010|gb|EFZ52749.1| ATP synthase F0, B subunit [Shigella sonnei 53G]
 gi|323173361|gb|EFZ58990.1| ATP synthase F0, B subunit [Escherichia coli LT-68]
 gi|323177756|gb|EFZ63340.1| ATP synthase F0, B subunit [Escherichia coli 1180]
 gi|323189531|gb|EFZ74811.1| ATP synthase F0, B subunit [Escherichia coli RN587/1]
 gi|323380892|gb|ADX53160.1| ATP synthase F0, B subunit [Escherichia coli KO11]
 gi|323934913|gb|EGB31291.1| ATP synthase F0 [Escherichia coli E1520]
 gi|323939201|gb|EGB35414.1| ATP synthase F0 [Escherichia coli E482]
 gi|323944212|gb|EGB40292.1| ATP synthase F0 [Escherichia coli H120]
 gi|323949979|gb|EGB45863.1| ATP synthase F0 [Escherichia coli H252]
 gi|323954969|gb|EGB50747.1| ATP synthase F0 [Escherichia coli H263]
 gi|323959802|gb|EGB55452.1| ATP synthase F0 [Escherichia coli H489]
 gi|323965804|gb|EGB61255.1| ATP synthase F0 [Escherichia coli M863]
 gi|323971215|gb|EGB66461.1| ATP synthase F0 [Escherichia coli TA007]
 gi|323975196|gb|EGB70300.1| ATP synthase F0 [Escherichia coli TW10509]
 gi|324008004|gb|EGB77223.1| ATP synthase F0, B subunit [Escherichia coli MS 57-2]
 gi|324012758|gb|EGB81977.1| ATP synthase F0, B subunit [Escherichia coli MS 60-1]
 gi|324018466|gb|EGB87685.1| ATP synthase F0, B subunit [Escherichia coli MS 117-3]
 gi|324111635|gb|EGC05616.1| ATP synthase F0 [Escherichia fergusonii B253]
 gi|324115908|gb|EGC09834.1| ATP synthase F0 [Escherichia coli E1167]
 gi|325499542|gb|EGC97401.1| F0F1 ATP synthase subunit B [Escherichia fergusonii ECD227]
 gi|326340516|gb|EGD64315.1| ATP synthase B chain [Escherichia coli O157:H7 str. 1044]
 gi|326341582|gb|EGD65371.1| ATP synthase B chain [Escherichia coli O157:H7 str. 1125]
 gi|327250888|gb|EGE62590.1| ATP synthase F0, B subunit [Escherichia coli STEC_7v]
 gi|330908049|gb|EGH36568.1| ATP synthase B chain [Escherichia coli AA86]
 gi|331036757|gb|EGI08983.1| ATP synthase F0, B subunit [Escherichia coli H736]
 gi|331042060|gb|EGI14204.1| ATP synthase F0, B subunit [Escherichia coli M605]
 gi|331047413|gb|EGI19491.1| ATP synthase F0, B subunit [Escherichia coli M718]
 gi|331053295|gb|EGI25328.1| ATP synthase F0, B subunit [Escherichia coli TA206]
 gi|331057900|gb|EGI29886.1| ATP synthase F0, B subunit [Escherichia coli TA143]
 gi|331062648|gb|EGI34568.1| ATP synthase F0, B subunit [Escherichia coli TA271]
 gi|331073012|gb|EGI44337.1| ATP synthase F0, B subunit [Escherichia coli H591]
 gi|331077834|gb|EGI49046.1| ATP synthase F0, B subunit [Escherichia coli H299]
 gi|332084598|gb|EGI89792.1| ATP synthase F0, B subunit [Shigella boydii 5216-82]
 gi|332084747|gb|EGI89933.1| ATP synthase F0, B subunit [Shigella dysenteriae 155-74]
 gi|332089391|gb|EGI94495.1| ATP synthase F0, B subunit [Shigella boydii 3594-74]
 gi|332104821|gb|EGJ08167.1| membrane-bound ATP synthase [Shigella sp. D9]
 gi|332345726|gb|AEE59060.1| ATP synthase F0, B subunit AtpF [Escherichia coli UMNK88]
 gi|332750745|gb|EGJ81153.1| ATP synthase F0, B subunit [Shigella flexneri 4343-70]
 gi|332750901|gb|EGJ81307.1| ATP synthase F0, B subunit [Shigella flexneri K-671]
 gi|332751760|gb|EGJ82158.1| ATP synthase F0, B subunit [Shigella flexneri 2747-71]
 gi|332764007|gb|EGJ94244.1| ATP synthase F0, B subunit [Shigella flexneri 2930-71]
 gi|332997053|gb|EGK16669.1| ATP synthase F0, B subunit [Shigella flexneri K-218]
 gi|332998040|gb|EGK17645.1| ATP synthase F0, B subunit [Shigella flexneri K-272]
 gi|333013469|gb|EGK32840.1| ATP synthase F0, B subunit [Shigella flexneri K-304]
 gi|333013710|gb|EGK33075.1| ATP synthase F0, B subunit [Shigella flexneri K-227]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|81428739|ref|YP_395739.1| H(+)-transporting two-sector ATPase (ATP synthase), B subunit
           [Lactobacillus sakei subsp. sakei 23K]
 gi|123564149|sp|Q38WK1|ATPF_LACSS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78610381|emb|CAI55431.1| H(+)-transporting two-sector ATPase (ATP synthase), B subunit
           [Lactobacillus sakei subsp. sakei 23K]
          Length = 173

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 64/157 (40%), Gaps = 1/157 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           +  V +  II + +V        +   +   ++KI +D+  A + RE +  +  Q   + 
Sbjct: 17  SLFVLVVFIILVALVGKF-AFGPVSKMMQERSNKITNDLDSAAQSREDAAKLAAQRATEL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + E  EI+  AK   +   E      ++      ++ ++ I   +L+A       +A
Sbjct: 76  KSSKSEAVEIVNTAKQNGEKQREGMVTLAQEEVQTLKQNAKKDIEQSRLDALNSARDDVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
             S+EI  ++I ++++     S+    I  +   ++ 
Sbjct: 136 QLSIEIASKLIKKELSVTDQKSLINSYIEGLDKQNET 172


>gi|324997448|ref|ZP_08118560.1| ATP synthase F0 subunit B [Pseudonocardia sp. P1]
          Length = 181

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 67/150 (44%), Gaps = 2/150 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  I L ++    +P    +  +   D I   +  A+  +E+++ +  +Y+++ + + 
Sbjct: 24  IVAFAILLFVLWKFAVPR-FETLYEERTDAIEGGLKRAQETQEQADRLKKEYEDQLAGLR 82

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+   + +  E  +  EQ +A      E+++   +  A+R L  ++   SV
Sbjct: 83  AEAARIRDDARAEGQQIKAELREEAEQEAARIRTRGEEQVSAARDAAQRALRNEVGGLSV 142

Query: 130 EIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           ++   ++ +++ +D   SS  +  +  +  
Sbjct: 143 QLAERLLREQLTDDSRRSSTIDSFLGELDQ 172


>gi|261378155|ref|ZP_05982728.1| ATP synthase F0, B subunit [Neisseria cinerea ATCC 14685]
 gi|296313932|ref|ZP_06863873.1| ATP synthase F0, B subunit [Neisseria polysaccharea ATCC 43768]
 gi|269145618|gb|EEZ72036.1| ATP synthase F0, B subunit [Neisseria cinerea ATCC 14685]
 gi|296839470|gb|EFH23408.1| ATP synthase F0, B subunit [Neisseria polysaccharea ATCC 43768]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+ +L
Sbjct: 61  VAELMAEGRHQVTEMVANAEKRAAKIVEEAKEQASHEAARIAAQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVASLAVKGAESILRKEVDASKHADLLSALKQEL 156


>gi|223041780|ref|ZP_03611971.1| FOF1 ATP synthase subunit B [Actinobacillus minor 202]
 gi|240950015|ref|ZP_04754323.1| F0F1 ATP synthase subunit B [Actinobacillus minor NM305]
 gi|223017406|gb|EEF15826.1| FOF1 ATP synthase subunit B [Actinobacillus minor 202]
 gi|240295493|gb|EER46236.1| F0F1 ATP synthase subunit B [Actinobacillus minor NM305]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   L++ ++     I D +  A + +++  +  + 
Sbjct: 1   MNLNATLIGQLIAFALFVWFCMKFVWPPLINAIETRQANIADALASAEKAKQEQADTKVL 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++  K  EE + II  A  R   + E      E      ++    ++   +   +  L
Sbjct: 61  VEQELVKAREEAQHIIDLATKRRNEILESVQAEAEAERLRIIEQGYAEVESERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +V    +I+ + ++   N+ I +K ++ +
Sbjct: 121 RQKVAALAVAGAEKIVGRSVDAAANNDIIDKLVAEL 156


>gi|83951212|ref|ZP_00959945.1| ATP synthase F0, B subunit [Roseovarius nubinhibens ISM]
 gi|83839111|gb|EAP78407.1| ATP synthase F0, B subunit [Roseovarius nubinhibens ISM]
          Length = 185

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 85/154 (55%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V +S ++F+ ++V L++P  +   LD  A  I+ D+ EAR LRE+++ +L  Y+ 
Sbjct: 28  NTNFVVLISFLLFVGLIVALKVPGKIGEMLDKRAAGIKSDLDEARALREEAQTLLASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+++   I+  AK  A   A++  ++++   A  L+  E++I   +  A + +  +
Sbjct: 88  KQKEVQDQAARIVEHAKAEAAAAADKAKEDLKGTIARRLQAAEEQIASAEAGAVKEVRDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
               ++   R++I+++M     + + ++ I+ + 
Sbjct: 148 AVAVAIAAARDVIAKQMTAADGNKLIDEAIAEVG 181


>gi|325297380|ref|YP_004257297.1| ATP synthase subunit b [Bacteroides salanitronis DSM 18170]
 gi|324316933|gb|ADY34824.1| ATP synthase subunit b [Bacteroides salanitronis DSM 18170]
          Length = 167

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 71/157 (45%), Gaps = 3/157 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++  +  V++     P +++  ++     I + +  AR   E+  N+ ++ ++  +
Sbjct: 12  FWMIITFGVVFVLLAKYGFP-VIIKAVEDRKAYIDNSLKAARDANEQLANVKLEGEKILA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      + ++            + +++++I   K  A R +  ++A 
Sbjct: 71  QAREEQNRILSEAAVTRDRIVKDAQDRAITEGQRLMAEVKKQIETEKESAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISS-IQSCHQ 161
            SVEI  +I+  K+ +    +++ ++ +   ++S  +
Sbjct: 131 LSVEIAGKIMRSKLADTKEQNALIDRMLDEMLESSKK 167


>gi|171315830|ref|ZP_02905061.1| ATP synthase F0, B subunit [Burkholderia ambifaria MEX-5]
 gi|171099019|gb|EDT43804.1| ATP synthase F0, B subunit [Burkholderia ambifaria MEX-5]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + +    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   + +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKASAQAEAARIVAQAKAEAEQQIVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|71280048|ref|YP_266826.1| ATP synthase F0, B subunit [Colwellia psychrerythraea 34H]
 gi|123634318|sp|Q48AW4|ATPF_COLP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71145788|gb|AAZ26261.1| ATP synthase F0, B subunit [Colwellia psychrerythraea 34H]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T +  +   +  VI     +   ++  ++     I D +  + R  +  E    +
Sbjct: 1   MDINMTLVGQLIAFVVFVIFCMKYVWPPIIGAIEDRQATIADGLAASDRAAKDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  + + +   I+ AAK     + +E     +      L     +I   +  AK  L
Sbjct: 61  ATAQLKEAKVQAASIVDAAKKHEAKIVDEAAGKAQVEKERILASGHAEIETERNRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I +K ++ +
Sbjct: 121 RKEVAVLAIAGAEKILERSIDAAAHSDILDKLVAEL 156


>gi|257785100|ref|YP_003180317.1| ATP synthase F0, B subunit [Atopobium parvulum DSM 20469]
 gi|257473607|gb|ACV51726.1| ATP synthase F0, B subunit [Atopobium parvulum DSM 20469]
          Length = 203

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 64/154 (41%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +   + +  VV   +   +L  LD   +KI+ D+  A + RE++          
Sbjct: 46  AEFVPALIAFLIIFAVVAKFVWPSVLRMLDKRQEKIQGDLDAAAKSREEANKDREIAAAG 105

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               +++  EI+ AAK   +       +  +  +   +   +  +   +  A   L   +
Sbjct: 106 IDAAKQQANEIVSAAKREGEEERARIIEQAKAEAVEIITKGKGVVESERRHAMAELSDSV 165

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            D +V+I  +II  +++ +   ++ EK ++ + +
Sbjct: 166 VDLAVDIAGKIIGNELSVEQQRALAEKYLAEVGT 199


>gi|307731463|ref|YP_003908687.1| ATP synthase F0 subunit B [Burkholderia sp. CCGE1003]
 gi|307585998|gb|ADN59396.1| ATP synthase F0, B subunit [Burkholderia sp. CCGE1003]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKAELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ +K   + ++ I  A+ RA  +A+E     +  +A  +   +       ++A+  L
Sbjct: 61  VDQELAKARNDGQQRIADAEKRAVAVADEIKAQAQAEAARIIAQAKADAEQQVVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQAAHADLLNQLKAEL 156


>gi|119471631|ref|ZP_01614016.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonadales
           bacterium TW-7]
 gi|119445410|gb|EAW26697.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonadales
           bacterium TW-7]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V+     +   L   ++A   KI D +  + R  +  E    +
Sbjct: 1   MNLNATLIGELIAFTVFVLFCMKFVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQQK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  +II  AK RA ++ +E     ++     +     +I   +      L
Sbjct: 61  AAEQLKDAKAQAADIIDQAKKRAVLIVDEETVRGQEEREKIIAQGHSEIESERNRVTEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V     I+ +++N   +S I EK ++ +
Sbjct: 121 RKQVATLAVVGAERILEREINQAAHSDIVEKLVAEL 156


>gi|322411473|gb|EFY02381.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 164

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 61/153 (39%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAESQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRSEASKIISDAKEIGQLQGDKLVAAATAETKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + +  +  +   
Sbjct: 132 LTVLLAEKIMGANLDKAAQSQLIDSYLDDLGEA 164


>gi|127514774|ref|YP_001095971.1| F0F1 ATP synthase subunit B [Shewanella loihica PV-4]
 gi|226694480|sp|A3QJR4|ATPF_SHELP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|126640069|gb|ABO25712.1| ATP synthase F0, B subunit [Shewanella loihica PV-4]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      I  V      +   L++ ++    +I D + +A R  +  E    +
Sbjct: 1   MNINVTLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E     +   A  +   + +I   +   K  L
Sbjct: 61  ATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + +++  +S I  K ++ I
Sbjct: 121 RKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEI 156


>gi|134294234|ref|YP_001117969.1| F0F1 ATP synthase subunit B [Burkholderia vietnamiensis G4]
 gi|226741323|sp|A4JA31|ATPF_BURVG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|134137391|gb|ABO53134.1| ATP synthase F0 subcomplex B subunit [Burkholderia vietnamiensis
           G4]
          Length = 156

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + +    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|221640528|ref|YP_002526790.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides KD131]
 gi|221161309|gb|ACM02289.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides KD131]
          Length = 184

 Score = 82.2 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILLYAKVPGRILGMLDKRSVQIRTELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 147 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 181


>gi|304398013|ref|ZP_07379888.1| ATP synthase F0, B subunit [Pantoea sp. aB]
 gi|308188715|ref|YP_003932846.1| ATP synthase subunit B protein [Pantoea vagans C9-1]
 gi|304354299|gb|EFM18671.1| ATP synthase F0, B subunit [Pantoea sp. aB]
 gi|308059225|gb|ADO11397.1| ATP synthase subunit B protein [Pantoea vagans C9-1]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I + +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEIAEGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +E+ + II  A  R   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKEDAQVIIEQANKRRAQILDEAKTEAENERNRIVTQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVALLAMAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|50123432|ref|YP_052599.1| F0F1 ATP synthase subunit B [Pectobacterium atrosepticum SCRI1043]
 gi|227113927|ref|ZP_03827583.1| F0F1 ATP synthase subunit B [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|253690613|ref|YP_003019803.1| ATP synthase F0, B subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|81643446|sp|Q6CYJ1|ATPF_ERWCT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|49613958|emb|CAG77411.1| ATP synthase B chain [Pectobacterium atrosepticum SCRI1043]
 gi|251757191|gb|ACT15267.1| ATP synthase F0, B subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++        
Sbjct: 1   MNINATILGQAIAFVLFVWFCMKYVWPPMMAAIEKRQKEIADGLASAERAKKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  R   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQVIIEQANKRRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAVLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|93007155|ref|YP_581592.1| F0F1 ATP synthase subunit B [Psychrobacter cryohalolentis K5]
 gi|122414743|sp|Q1Q895|ATPF_PSYCK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|92394833|gb|ABE76108.1| ATP synthase F0, B subunit [Psychrobacter cryohalolentis K5]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   L+  ++    KI + +  A + +         
Sbjct: 1   MNINSTLIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++    + +   +I  A   A  L E+     +       +  +  I     +A+  L
Sbjct: 61  VQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQASIDQEINQARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A+ +V    +I+  K++   ++S+ ++  + +
Sbjct: 121 RAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL 156


>gi|148145|gb|AAA24741.1| proton-translocating ATPase b subunit (uncF; gtg start codon)
           [Escherichia coli]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ANDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|288925058|ref|ZP_06418994.1| ATP synthase F0, B subunit [Prevotella buccae D17]
 gi|288338248|gb|EFC76598.1| ATP synthase F0, B subunit [Prevotella buccae D17]
          Length = 169

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 73/158 (46%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++   ++     P+I+ + ++     I + + +A    E+ ENI  + +    
Sbjct: 13  FWMLLAFLVVFGVLAKFGFPAII-NMVEERKKYIDESLRKAHEASERLENIKQEGESMLK 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E   +   + SA  L D +++I   K  A R +  ++A+
Sbjct: 72  EAREKQAQIMKEAAGTRDAIVENAQEKAREESARLLSDAKRQIESEKQNAIRDIRMQVAE 131

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV+I  +I+ +K+ +DD    + ++ +  +      D
Sbjct: 132 LSVQIAEKILREKLSSDDKQMDMVDRLLDEVSVKKNKD 169


>gi|83594573|ref|YP_428325.1| H+-transporting two-sector ATPase, subunit B/B' [Rhodospirillum
           rubrum ATCC 11170]
 gi|114626|sp|P15013|ATPF_RHORU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|123525687|sp|Q2RPA7|ATPF_RHORT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46374|emb|CAA31249.1| ATPase F-0-subunit b (AA 1 - 182) [Rhodospirillum rubrum]
 gi|152602|gb|AAA26458.1| ATP synthase F-0 sector, b subunit [Rhodospirillum rubrum]
 gi|83577487|gb|ABC24038.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 182

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D  F V ++ ++ +   VY++  + +L  LD     ++  + EAR+LR+ ++ +L +Y+ 
Sbjct: 26  DPAFWVSIAFLMVVGF-VYIKAKNKILGALDGRGAAVKAKLDEARKLRDDAQALLAEYQR 84

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           +     +E  EII  AK  A  L  +   ++E       +    +I   + +A   +  +
Sbjct: 85  RQRDAMKEADEIIRHAKDEAARLRAKAEADLEASIRRREQQAVDRIAQAEAQALAQVRNE 144

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             D +V   R +++  +     + + +  I+ +
Sbjct: 145 AVDVAVSAARSLMAGSLAKADQNRLIDAAIADL 177


>gi|332995983|gb|EGK15610.1| ATP synthase F0, B subunit [Shigella flexneri VA-6]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   L++ ++    +I D +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A      + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKLRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|261420767|ref|YP_003254449.1| F0F1 ATP synthase subunit B [Geobacillus sp. Y412MC61]
 gi|297531562|ref|YP_003672837.1| ATP synthase F0 subunit beta [Geobacillus sp. C56-T3]
 gi|319768437|ref|YP_004133938.1| ATP synthase F0 subunit B [Geobacillus sp. Y412MC52]
 gi|261377224|gb|ACX79967.1| ATP synthase F0, B subunit [Geobacillus sp. Y412MC61]
 gi|297254814|gb|ADI28260.1| ATP synthase F0, B subunit [Geobacillus sp. C56-T3]
 gi|317113303|gb|ADU95795.1| ATP synthase F0, B subunit [Geobacillus sp. Y412MC52]
          Length = 178

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 72/153 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +  + + I L+ ++       L++ +    + I ++I +A + R+++E +L + +E  
Sbjct: 21  TIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIGQAEKRRQEAEKLLEEQRELM 80

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +  +E + +I  A+  A+   E+   +    +    +  +++I   K +A   L  ++A
Sbjct: 81  KQSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEAAKKEIEREKEQAMAALREQVA 140

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             SV I  ++I +++ +     + E  I  +Q 
Sbjct: 141 SLSVLIASKVIEKELTEQDQRKLIEAYIKDVQE 173


>gi|85712591|ref|ZP_01043638.1| F0F1-type ATP synthase, subunit b [Idiomarina baltica OS145]
 gi|85693582|gb|EAQ31533.1| F0F1-type ATP synthase, subunit b [Idiomarina baltica OS145]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T +         V      +   ++  ++    KI D +    R ++  E     
Sbjct: 1   MDINATIIGQTIAFAVFVWFCMKFVWPPIIKAIEERQKKIADGLSAGERAQKDLEKAQED 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +++  EII  AK R   + E+  Q   +     +    +++   +  A+  L
Sbjct: 61  IAEQLKEAKQQAAEIIEQAKKRGAKIVEDETQRGHEEREKIVASGHEEVEAERHRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V   ++II ++++++ +  I EK ++ +
Sbjct: 121 RKQVAVLAVTGAQKIIEREIDENAHRDIVEKLVAEL 156


>gi|197132342|gb|ACH47689.1| ATP synthase CF0 subunit I [Geranium carolinianum]
          Length = 184

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 58/151 (38%), Gaps = 1/151 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++L + L ++++     +L   LD    +I + I  +  LR ++   L +   +  KV+ 
Sbjct: 32  INLSVVLGVLIFFG-KGVLNDLLDNRKQRILNSIRNSEELRGRAVEQLEKAHARLRKVKT 90

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  +  +     A+        +  +          + I + +  A   +  ++   +++
Sbjct: 91  EVDQFRVNEYSEAERKRSNLITSTYKELERSENLKNESIRFEQQRAINQVRQRVFQQALQ 150

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              EI++  +N +++       I    S  +
Sbjct: 151 GALEILNSCLNKELHLRTISANIGLFGSMKE 181


>gi|319407570|emb|CBI81220.1| ATP synthase subunit b 2 [Bartonella sp. 1-1C]
          Length = 164

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 95/159 (59%), Gaps = 1/159 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++VY  +P+ ++  LD  A  I+D++ EA RLRE+++ +L +Y+ KH
Sbjct: 4   TFWAFIGLVLFLALLVYFEVPNAIIRKLDTRAKHIKDELDEALRLREEAQKVLAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            ++E+ET+EII  AK + + +  E     E+    + +  EQKI   +  A R+L +   
Sbjct: 64  LEIEKETQEIIADAKDKVEAMLSETRIKTEEYIKNHSRLAEQKIAQAEENAIRMLSSTAV 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDK 164
           D ++  V  ++++++N +  +S+ ++ +   +S  +++ 
Sbjct: 124 DLAISAVNRLLTKELNAEQANSLIKEPLIK-ESLKKIET 161


>gi|307133307|ref|YP_003885323.1| F0 sector of membrane-bound ATP synthase, subunit b [Dickeya
           dadantii 3937]
 gi|306530836|gb|ADN00767.1| F0 sector of membrane-bound ATP synthase, subunit b [Dickeya
           dadantii 3937]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++        
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQASKQRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|294012247|ref|YP_003545707.1| F0F1-type ATP synthase subunit b [Sphingobium japonicum UT26S]
 gi|292675577|dbj|BAI97095.1| F0F1-type ATP synthase subunit b [Sphingobium japonicum UT26S]
          Length = 208

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 71/155 (45%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I++  ++P ++   LD    +I+  + EA +LR ++E +  +Y+
Sbjct: 51  MDATAWVSLAMAVFILILLVKKVPGLIGGALDGRIAQIKAQLEEASKLRAEAEALKAEYE 110

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            + +    E   +  +A+H A  L E+   N   + +   K  E KI   +  A   + A
Sbjct: 111 ARLAAAAGEAETMRKSAEHEAATLLEDAKANAAALVSRRQKMAEDKIGAAERAAIADIRA 170

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K    +      +I+Q  +   +  + +  I  + 
Sbjct: 171 KAVRAATGAAASLIAQGHDAKADKLLVDDAIKGLG 205


>gi|304313405|ref|YP_003813003.1| F0-ATP synthase, b subunit [gamma proteobacterium HdN1]
 gi|301799138|emb|CBL47381.1| F0-ATP synthase, b subunit [gamma proteobacterium HdN1]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M      +      I   +++ +     KI + + EA R  +  E     
Sbjct: 1   MNINLTLFGQMIAFALFIWFCMKFIWPPVINAMQERQRKIAEGLQEADRASKDLELAQKS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + + +  ++I  A  RA  L EE   N            +  I      AK  L
Sbjct: 61  ATDTLREAKVQAAQLIEQANKRANQLIEEAKDNARAEGERIKVAAQADIEQEVQRAKEAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  S+    +I+   +N + +S + E+  + +
Sbjct: 121 RAQLASLSLLGAEKILQTSINQEAHSKMLEQLAAEL 156


>gi|315608097|ref|ZP_07883090.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
 gi|315250566|gb|EFU30562.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
          Length = 172

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 73/158 (46%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++   ++     P+I+ + ++     I + + +A    E+ ENI  + +    
Sbjct: 16  FWMLLAFLVVFGVLAKFGFPAII-NMVEERKKYIDESLRKAHEASERLENIKQEGESMLK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E   +   + SA  L D +++I   K  A R +  ++A+
Sbjct: 75  EAREKQAQIMKEAAGTRDAIVENAQEKAREESARLLSDAKRQIESEKQNAIRDIRMQVAE 134

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV+I  +I+ +K+ +DD    + ++ +  +      D
Sbjct: 135 LSVQIAEKILREKLSSDDKQMDMVDRLLDEVSVKKNKD 172


>gi|296876804|ref|ZP_06900852.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|312867266|ref|ZP_07727476.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
 gi|296432306|gb|EFH18105.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|311097395|gb|EFQ55629.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
          Length = 164

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 72/153 (47%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++     + L+ ++     + +   L+A A KI DDI  A   R+K+E +  + +E+ +
Sbjct: 12  FILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREEELA 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  AK  A+    +      Q +    +  +Q+I + K EA   +   +AD
Sbjct: 72  GSRKEAASIVENAKETAEKNKSQILSEATQEAVRLKEKAQQEIAHNKEEALNSIKGDVAD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +++SQ+++ +    + ++ +  +   
Sbjct: 132 LTVNLASKLLSQQLDAEGQRQLIDRYLDELGEA 164


>gi|251791744|ref|YP_003006465.1| F0F1 ATP synthase subunit B [Dickeya zeae Ech1591]
 gi|247540365|gb|ACT08986.1| ATP synthase F0, B subunit [Dickeya zeae Ech1591]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +   +++ ++    +I D +  A R ++        
Sbjct: 1   MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  +   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKQRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|225075910|ref|ZP_03719109.1| hypothetical protein NEIFLAOT_00934 [Neisseria flavescens
           NRL30031/H210]
 gi|224952766|gb|EEG33975.1| hypothetical protein NEIFLAOT_00934 [Neisseria flavescens
           NRL30031/H210]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+ +L
Sbjct: 61  VAELMAEGRNQVTEMVANAEKRAAKIVEEAKEQASHEAARIAAQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVATLAVKGAESILRKEVDASKHADLLSTLKQEL 156


>gi|296268881|ref|YP_003651513.1| ATP synthase F0 subunit B [Thermobispora bispora DSM 43833]
 gi|296091668|gb|ADG87620.1| ATP synthase F0, B subunit [Thermobispora bispora DSM 43833]
          Length = 181

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 65/148 (43%), Gaps = 2/148 (1%)

Query: 12  SLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEE 71
           + ++  ++V  +  P  +   L    + I   I  A+ L+ +++  L QY+ + ++   E
Sbjct: 29  AFLVVFLVVGKILTPR-IQKTLAERTEAIEGGIKRAQELQAEAQRTLEQYRAQLAEARHE 87

Query: 72  TREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEI 131
              +   A+ +   +  E  Q  E  +   ++  + +I   + +A   L  +I   SVE+
Sbjct: 88  AARLREEAREQGARIKAELRQEAEAEARRIIEAAQAQIEAERRQALIQLRGEIGRLSVEL 147

Query: 132 VREIISQKM-NDDVNSSIFEKTISSIQS 158
              I+ + + ++     I ++ +  +++
Sbjct: 148 ASRIVGESLEDEARQRRIIDRFLEELEA 175


>gi|302521944|ref|ZP_07274286.1| ATP synthase F0, B subunit [Streptomyces sp. SPB78]
 gi|318075501|ref|ZP_07982833.1| F0F1 ATP synthase subunit B [Streptomyces sp. SA3_actF]
 gi|333024396|ref|ZP_08452460.1| putative F0F1 ATP synthase subunit B [Streptomyces sp. Tu6071]
 gi|302430839|gb|EFL02655.1| ATP synthase F0, B subunit [Streptomyces sp. SPB78]
 gi|332744248|gb|EGJ74689.1| putative F0F1 ATP synthase subunit B [Streptomyces sp. Tu6071]
          Length = 181

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 64/156 (41%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I   ++ +  +P+ +   LD   + I   + +A   R +++++L QYK + ++
Sbjct: 25  IGALAFVIVFGLLAWKLLPN-INKVLDERREAIEGGMEKAEAARTEADSVLEQYKAQLAE 83

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 84  ARHEAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHTQIEADRKAAATTLRQDVGRL 143

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + E+  +++ + + +    S   ++ +  + +  + 
Sbjct: 144 ATELAGKLVGESLEDHARQSRTIDRFLDELDAKAEA 179


>gi|126463456|ref|YP_001044570.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides ATCC 17029]
 gi|332559509|ref|ZP_08413831.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
 gi|226694455|sp|A3PN82|ATPF_RHOS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|126105120|gb|ABN77798.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332277221|gb|EGJ22536.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
          Length = 184

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 40/155 (25%), Positives = 84/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I++Y ++P  +L  LD  + +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILLYAKVPGRVLGMLDKRSVQIRTELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   ++    A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLRASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    +++S++M     S+  +++I  +++
Sbjct: 147 AVSVAVAAAADLLSRQMTPAAASASIDESIKEVEA 181


>gi|311033326|ref|ZP_07711416.1| F0F1 ATP synthase subunit B [Bacillus sp. m3-13]
          Length = 172

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 65/152 (42%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               ++ +I L  +        L+  +    D I ++I  A +   +++ ++ + K    
Sbjct: 20  LFQLITFLILLYFL-RKFAWDKLVGMMKQREDHIANEITAAEQSNVEAKALVEEQKSLLK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E + ++ +AK  A+    +  +  ++ SA   +   ++I   K +A   L  ++A 
Sbjct: 79  EARTEAQALVESAKKVAEDQKADIVRAAQEESARLKEAARKEIIQEKEQAVVALREQVAS 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I  ++I +++N+     + +  +  +  
Sbjct: 139 LSVLIASKVIEKELNEKDQQKLIDDYVKQVGE 170


>gi|300689828|ref|YP_003750823.1| ATP synthase, F0 sector, subunit B [Ralstonia solanacearum PSI07]
 gi|299076888|emb|CBJ49501.1| ATP synthase, F0 sector, subunit B [Ralstonia solanacearum PSI07]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 74/156 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  ++   E  + I  A+ RA++ A+E  QN +  +A  +   + +     + A+  L
Sbjct: 61  VEQALTEARNEGAQRIADAEKRAQMSADEIKQNAQAEAARIIAQAKAEAEQQTVRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V+S +  +  + +
Sbjct: 121 RDQVATLAVKGAEQILKREVNAQVHSDLLNQLKAEL 156


>gi|188535587|ref|YP_001909384.1| F0F1 ATP synthase subunit B [Erwinia tasmaniensis Et1/99]
 gi|226741449|sp|B2VCA8|ATPF_ERWT9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|188030629|emb|CAO98525.1| ATP synthase, F0 complex, b subunit [Erwinia tasmaniensis Et1/99]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    ++ D +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +++ + II  A  R   + ++     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|22128007|ref|NP_671430.1| F0F1 ATP synthase subunit B [Yersinia pestis KIM 10]
 gi|45443755|ref|NP_995294.1| F0F1 ATP synthase subunit B [Yersinia pestis biovar Microtus str.
           91001]
 gi|51598255|ref|YP_072446.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis IP 32953]
 gi|108810160|ref|YP_654076.1| F0F1 ATP synthase subunit B [Yersinia pestis Antiqua]
 gi|108814142|ref|YP_649909.1| F0F1 ATP synthase subunit B [Yersinia pestis Nepal516]
 gi|145601148|ref|YP_001165224.1| F0F1 ATP synthase subunit B [Yersinia pestis Pestoides F]
 gi|150260941|ref|ZP_01917669.1| ATP synthase subunit B protein [Yersinia pestis CA88-4125]
 gi|153949255|ref|YP_001403122.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis IP 31758]
 gi|162419287|ref|YP_001608476.1| F0F1 ATP synthase subunit B [Yersinia pestis Angola]
 gi|165926217|ref|ZP_02222049.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939951|ref|ZP_02228488.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009539|ref|ZP_02230437.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213226|ref|ZP_02239261.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401599|ref|ZP_02307093.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422830|ref|ZP_02314583.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425492|ref|ZP_02317245.1| ATP synthase F0, B subunit [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170026426|ref|YP_001722931.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis YPIII]
 gi|186897464|ref|YP_001874576.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis PB1/+]
 gi|218931101|ref|YP_002348976.1| F0F1 ATP synthase subunit B [Yersinia pestis CO92]
 gi|229839835|ref|ZP_04459994.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229841919|ref|ZP_04462075.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229896796|ref|ZP_04511959.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Pestoides A]
 gi|229904685|ref|ZP_04519796.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Nepal516]
 gi|270488395|ref|ZP_06205469.1| ATP synthase F0, B subunit [Yersinia pestis KIM D27]
 gi|294505648|ref|YP_003569710.1| ATP synthase subunit B [Yersinia pestis Z176003]
 gi|81638069|sp|Q663Q4|ATPF_YERPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122382403|sp|Q1C091|ATPF_YERPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122383972|sp|Q1CCH1|ATPF_YERPN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123776434|sp|Q7CFM4|ATPF_YERPE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698362|sp|A7FPE4|ATPF_YERP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698363|sp|B2K843|ATPF_YERPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698364|sp|A9R5U3|ATPF_YERPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698365|sp|A4TSI9|ATPF_YERPP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698366|sp|B1JRM8|ATPF_YERPY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21961155|gb|AAM87681.1|AE014015_6 membrane-bound ATP synthase, F0 sector, subunit b [Yersinia pestis
           KIM 10]
 gi|45438625|gb|AAS64171.1| ATP synthase subunit B protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51591537|emb|CAH23209.1| ATP synthase subunit B protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777790|gb|ABG20309.1| ATP synthase subunit B protein [Yersinia pestis Nepal516]
 gi|108782073|gb|ABG16131.1| ATP synthase subunit B protein [Yersinia pestis Antiqua]
 gi|115349712|emb|CAL22693.1| ATP synthase subunit B protein [Yersinia pestis CO92]
 gi|145212844|gb|ABP42251.1| ATP synthase subunit B protein [Yersinia pestis Pestoides F]
 gi|149290349|gb|EDM40426.1| ATP synthase subunit B protein [Yersinia pestis CA88-4125]
 gi|152960750|gb|ABS48211.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis IP 31758]
 gi|162352102|gb|ABX86050.1| ATP synthase F0, B subunit [Yersinia pestis Angola]
 gi|165912077|gb|EDR30717.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922077|gb|EDR39254.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991461|gb|EDR43762.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205524|gb|EDR50004.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958222|gb|EDR55243.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048981|gb|EDR60389.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055506|gb|EDR65299.1| ATP synthase F0, B subunit [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752960|gb|ACA70478.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis YPIII]
 gi|186700490|gb|ACC91119.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis PB1/+]
 gi|229678803|gb|EEO74908.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Nepal516]
 gi|229691258|gb|EEO83311.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696201|gb|EEO86248.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229700234|gb|EEO88270.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Pestoides A]
 gi|262363813|gb|ACY60534.1| ATP synthase subunit B [Yersinia pestis D106004]
 gi|262367749|gb|ACY64306.1| ATP synthase subunit B [Yersinia pestis D182038]
 gi|270336899|gb|EFA47676.1| ATP synthase F0, B subunit [Yersinia pestis KIM D27]
 gi|294356107|gb|ADE66448.1| ATP synthase subunit B [Yersinia pestis Z176003]
 gi|320017460|gb|ADW01032.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  VI     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|329955016|ref|ZP_08295997.1| ATP synthase F0, B subunit [Bacteroides clarus YIT 12056]
 gi|328526306|gb|EGF53321.1| ATP synthase F0, B subunit [Bacteroides clarus YIT 12056]
          Length = 166

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 67/151 (44%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  VI+     P I+   ++     I   +  AR+   +   +  + +   +
Sbjct: 12  FWMLLSFGVVFVILAKYGFP-IITKMVEGRRTYIDQSLEVARQANAQLAKLKEESEALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  ++ E ++   L D++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRIMREAMHERDKIIVEARKHAEAVAQKELDDVKQQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSI 156
            SV+I  +II + +++      + ++ +  +
Sbjct: 131 LSVDIAEKIIRRNLDEKQDQMEMIDRMLDEM 161


>gi|238793098|ref|ZP_04636726.1| ATP synthase B chain [Yersinia intermedia ATCC 29909]
 gi|238727471|gb|EEQ18997.1| ATP synthase B chain [Yersinia intermedia ATCC 29909]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     I   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQASKRKAQILDEAKTEAEQERNKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|331695529|ref|YP_004331768.1| ATP synthase subunit b [Pseudonocardia dioxanivorans CB1190]
 gi|326950218|gb|AEA23915.1| ATP synthase subunit b [Pseudonocardia dioxanivorans CB1190]
          Length = 184

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 23/148 (15%), Positives = 56/148 (37%), Gaps = 1/148 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +  ++ L       +P  L   +    + +R  + E  R          +Y    ++  
Sbjct: 27  IVIFLLVLFFFYRFVVP-PLTKAMRERDEMVRKQVEERDRAVRTLREAEERYAASLAEAR 85

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+  A+ + E      ++  A   +  E ++   + E  R L A+I   S 
Sbjct: 86  GEATAIRDEARADAQQIRETMRAETDREVARLREQGEAELAAQRAETARSLRAEIGGLSS 145

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQ 157
           ++   ++ + ++D  + S  E  ++ ++
Sbjct: 146 DLASRVLGRPIDDGRHRSTVESFLADLE 173


>gi|327540202|gb|EGF26792.1| ATPase, F0 complex, subunit B/B [Rhodopirellula baltica WH47]
          Length = 242

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 68/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +  L I+    +   +L  L A  +KIR+D+  A +   +++ +L  Y+ K  +
Sbjct: 91  WNLIIFLCVLAILSKF-VWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLDE 149

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              + + ++  A+  A+   ++     +  +A   +     I   K  A   +  + +  
Sbjct: 150 AASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSKL 209

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++++ R ++ ++++ D ++ +  +++  + S
Sbjct: 210 AMQVARSVVGRELSADDHADLIRQSMERLPS 240


>gi|323345606|ref|ZP_08085829.1| ATP synthase F0 sector subunit B [Prevotella oralis ATCC 33269]
 gi|323093720|gb|EFZ36298.1| ATP synthase F0 sector subunit B [Prevotella oralis ATCC 33269]
          Length = 172

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 69/158 (43%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F++ ++   ++     P+I+   ++     I D + +A    E+ +NI  +      
Sbjct: 16  FWMFLAFLVVFGVLATFGFPAII-KMVEGRKQYIDDSLRKAHEASERLDNIKQEGDAILQ 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  ++I  A      + E+      + SA  + D + +I   K  A R +  ++A+
Sbjct: 75  EAREKQAQVINEAAVTRDAIVEKAQAKAHEESARIISDAKAQIENDKQNAVRDIRTQVAE 134

Query: 127 FSVEIVREIISQKMNDDV-NSSIFEKTISSIQSCHQMD 163
            S++I   I+ +K++ +     + ++ +  +      D
Sbjct: 135 LSIQIAENILREKLSSNDMQMEMIDRLLDEVSKGKNKD 172


>gi|186477777|ref|YP_001859247.1| F0F1 ATP synthase subunit B [Burkholderia phymatum STM815]
 gi|226741321|sp|B2JJK3|ATPF_BURP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|184194236|gb|ACC72201.1| ATP synthase F0, B subunit [Burkholderia phymatum STM815]
          Length = 156

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGKLELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ S+   E ++ I  A+ RA  +A+E     +  +A  +   +       ++A+  L
Sbjct: 61  VDQELSQARNEGQQRIADAEKRAVAVADEIKAQAQAEAARIIAQAKADADQQIVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQAAHADLLNQLKAEL 156


>gi|314934176|ref|ZP_07841537.1| ATP synthase F0, B subunit [Staphylococcus caprae C87]
 gi|313653081|gb|EFS16842.1| ATP synthase F0, B subunit [Staphylococcus caprae C87]
          Length = 171

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 68/152 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V ++  + L+ ++       L   +D     I   I +A + +  ++ +  + ++  
Sbjct: 18  TTIVTLATFVILLALLKKFAWGPLKEVMDKRERDINKYIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E + I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQRILDDAKIQARKQHEEIIHEANVRANGMIETAQSEINSEKERALADINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKDLVEKYLKEAG 169


>gi|56808119|ref|ZP_00365907.1| COG0711: F0F1-type ATP synthase, subunit b [Streptococcus pyogenes
           M49 591]
 gi|71903221|ref|YP_280024.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS6180]
 gi|94988262|ref|YP_596363.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS9429]
 gi|94992136|ref|YP_600235.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS2096]
 gi|94994057|ref|YP_602155.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10750]
 gi|123640162|sp|Q48UD7|ATPF_STRPM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696173|sp|Q1JCL7|ATPF_STRPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696174|sp|Q1JMJ3|ATPF_STRPC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696176|sp|Q1J7G3|ATPF_STRPF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71802316|gb|AAX71669.1| ATP synthase B chain [Streptococcus pyogenes MGAS6180]
 gi|94541770|gb|ABF31819.1| ATP synthase B chain [Streptococcus pyogenes MGAS9429]
 gi|94545644|gb|ABF35691.1| ATP synthase B chain [Streptococcus pyogenes MGAS2096]
 gi|94547565|gb|ABF37611.1| ATP synthase B chain [Streptococcus pyogenes MGAS10750]
          Length = 164

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 61/153 (39%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + +  +  +   
Sbjct: 132 LTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|260460366|ref|ZP_05808618.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259034011|gb|EEW35270.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 163

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 47/156 (30%), Positives = 88/156 (56%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    ++L+IFL I VY+++P ++   LDA A +I  ++ EAR+LRE+++ +L QY+ K
Sbjct: 7   ATLWATIALVIFLAIAVYIKVPGLIAKALDARAMRISSELDEARKLREEAQQLLGQYQRK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E  +I+ AAK  A +LA E  +  E          EQKI   + +A   + A  
Sbjct: 67  RKEAEQEAADIVAAAKREADLLAAEAHKKTEDYVTRRTALAEQKIGQAERDAISEVRASA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            D +VE  R +++ K++    + +F+ +++ +++  
Sbjct: 127 VDIAVEAARALLAAKVDVKAGADLFKASLADVKAKL 162


>gi|19745843|ref|NP_606979.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS8232]
 gi|50913940|ref|YP_059912.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10394]
 gi|94990141|ref|YP_598241.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10270]
 gi|139474054|ref|YP_001128770.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes str. Manfredo]
 gi|306827637|ref|ZP_07460917.1| ATP synthase F0 sector subunit B [Streptococcus pyogenes ATCC
           10782]
 gi|81372210|sp|Q5XCY4|ATPF_STRP6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81763190|sp|Q8P1K8|ATPF_STRP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696175|sp|Q1JHN9|ATPF_STRPD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696177|sp|A2RFC6|ATPF_STRPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|19747991|gb|AAL97478.1| putative proton-translocating ATPase, subunit b [Streptococcus
           pyogenes MGAS8232]
 gi|50903014|gb|AAT86729.1| ATP synthase B chain [Streptococcus pyogenes MGAS10394]
 gi|94543649|gb|ABF33697.1| ATP synthase B chain [Streptococcus pyogenes MGAS10270]
 gi|134272301|emb|CAM30555.1| ATP synthase B chain [Streptococcus pyogenes str. Manfredo]
 gi|304430200|gb|EFM33229.1| ATP synthase F0 sector subunit B [Streptococcus pyogenes ATCC
           10782]
          Length = 164

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 61/153 (39%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLETKSQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + +  +  +   
Sbjct: 132 LTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|49473962|ref|YP_032004.1| F0F1 ATP synthase subunit B [Bartonella quintana str. Toulouse]
 gi|81696061|sp|Q6G0H0|ATPF2_BARQU RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|49239465|emb|CAF25816.1| ATP synthase B chain [Bartonella quintana str. Toulouse]
          Length = 164

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/148 (30%), Positives = 90/148 (60%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++ Y ++P +++  LDA A +I+D++ EA RLRE+++ +L +Y+ KH
Sbjct: 4   TFWAFVGLVLFLALLAYFKVPEMIVHRLDARAKRIKDELDEALRLREEAQEVLAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ E++ +EII AAK   + +  E     E+      K  EQKI   + +A R++ +   
Sbjct: 64  AEAEKDAQEIIAAAKREVEAVVSEARTKAEEYVKNRNKLAEQKIAQAEADAIRVVSSSAV 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTI 153
           D +V   R +I Q+++ +  + + ++++
Sbjct: 124 DLAVSAARVLIEQELDSNKANELIKESL 151


>gi|88855322|ref|ZP_01129986.1| ATP synthase subunit B [marine actinobacterium PHSC20C1]
 gi|88815229|gb|EAR25087.1| ATP synthase subunit B [marine actinobacterium PHSC20C1]
          Length = 185

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 65/156 (41%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I L       +P  L   LDA AD I   I +A   + ++   L QYK + ++
Sbjct: 27  WSAVCFAIILFFFWKKFLP-ALTKTLDARADAIEGGIKKAEIAQAEAAAALEQYKTQLAE 85

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+     +  E  +     +A    + +  I   +  A   L  ++   
Sbjct: 86  GRAEAAKIREQARLEGTAIVNELKEQATIEAARITVNAQATIEAERQAALVSLRTEVGSM 145

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           ++++   +I Q + +D  +S++ ++ ++ +++  + 
Sbjct: 146 AIDLASGVIGQSLSDDKKSSALVDQFLADLEASEKA 181


>gi|218194451|gb|EEC76878.1| hypothetical protein OsI_15082 [Oryza sativa Indica Group]
          Length = 548

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 63/147 (42%), Gaps = 1/147 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +  +I + +     +   +   LD  A KI + +  A R + +   +  + + + ++  
Sbjct: 252 AIVFLILV-LFTMKFVWPPIAKALDERAQKIAEGLAAADRAKSELVAVNQRVETELAQTR 310

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            ET   +  A+ RA+ + EE      +     +     +     ++A+  L  ++A  +V
Sbjct: 311 NETASRLADAERRAQAIIEEAKARAAEEGNKIVAAARAEAEQQSIQAREALREQVAALAV 370

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSI 156
           +   +I+ +++N  V++ +  +  + +
Sbjct: 371 KGAEQILRKEVNAGVHADLLNRLKTEL 397


>gi|167838428|ref|ZP_02465287.1| F0F1 ATP synthase subunit B [Burkholderia thailandensis MSMB43]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 71/156 (45%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + +      +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERSKKIADGLSAAEKGQAELAAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   +       ++A+  L
Sbjct: 61  VDQELAQARSDGQQRIAEAEKRAQAVAEEIKANAQAEAARIIAQAKADADQQIVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVASLAVKGAEQILKREVDHTAHAELLNQLKAEL 156


>gi|296128922|ref|YP_003636172.1| ATP synthase F0, B subunit [Cellulomonas flavigena DSM 20109]
 gi|296020737|gb|ADG73973.1| ATP synthase F0, B subunit [Cellulomonas flavigena DSM 20109]
          Length = 193

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 63/154 (40%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               + L+  + I  Y  +     + LD    KI   I +A   + ++   L +Y++  +
Sbjct: 32  LWSAIVLVG-IAIPFYKFVLPKFQAVLDERTAKIEGGIAKAESAQAEAAAQLAEYQQLLA 90

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I   A+  A  +  E     ++ +A   +  +++I   + +A   L   +  
Sbjct: 91  DARSEAARIREDARTEAGQIVAEARTRAQEEAARIAETAQRQIDAERQQAAVSLRTDVGT 150

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
            + ++  +I+ + + ++   S + ++ +  +++ 
Sbjct: 151 LATQLASKIVGESLEDEARRSRVVDRFLDELEAS 184


>gi|156597956|gb|ABU85245.1| ATP synthase CF0 subunit I [Cycas micronesica]
          Length = 183

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/152 (13%), Positives = 66/152 (43%), Gaps = 1/152 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L + L +++Y     +L + LD    KI   I ++  L + + + L + + +  +VE
Sbjct: 31  LINLSVVLGVLIYFG-KGVLSNLLDDRKQKILSTIRDSEELYKGATDQLEKARARLREVE 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
               EI +    + +   E+      +          + +++ +  A   +  +I+  ++
Sbjct: 90  MRADEIQVNGYSQIEREKEDLINAAHENLERLEDSKNETVNFEQQRAIDQVRQQISRQAL 149

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
                 ++ ++N++++    +  IS +++  +
Sbjct: 150 RRALGTLNSRLNNELHLRTIDHNISMLRAMKK 181


>gi|290473120|ref|YP_003465981.1| membrane-bound ATP synthase, F0 sector subunit b [Xenorhabdus
           bovienii SS-2004]
 gi|289172414|emb|CBJ79181.1| membrane-bound ATP synthase, F0 sector, subunit b [Xenorhabdus
           bovienii SS-2004]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLASAERAKKNLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  +   + ++     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQAIIEQANKQKAQIIDDAKTEAELERNKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|261379449|ref|ZP_05984022.1| ATP synthase F0, B subunit [Neisseria subflava NJ9703]
 gi|261400616|ref|ZP_05986741.1| ATP synthase F0, B subunit [Neisseria lactamica ATCC 23970]
 gi|269209702|gb|EEZ76157.1| ATP synthase F0, B subunit [Neisseria lactamica ATCC 23970]
 gi|284797903|gb|EFC53250.1| ATP synthase F0, B subunit [Neisseria subflava NJ9703]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+ +L
Sbjct: 61  VAELMAEGRNQVTEMVANAEKRAAKIVEEAKEQASHEAARIAAQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVASLAVKGAESILRKEVDASKHADLLSALKQEL 156


>gi|256832997|ref|YP_003161724.1| ATP synthase F0, B subunit [Jonesia denitrificans DSM 20603]
 gi|256686528|gb|ACV09421.1| ATP synthase F0, B subunit [Jonesia denitrificans DSM 20603]
          Length = 193

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 65/147 (44%), Gaps = 1/147 (0%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ +    Y  I     + LD    KI   I +A R +E+++ +L ++++  ++   E  
Sbjct: 38  LLIIGAYFYKVILPKFNAVLDERTAKIEGGIHQAERAQEEADKLLAEHRQLLTEARAEAG 97

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            +  AA+  A  +  E        +   L++ +++I   +  A   L   +   + ++  
Sbjct: 98  AVREAARTEAAQIKAEAQAQANADAERILENAKRQIDAERQAAAVSLRNDVGALATDLAS 157

Query: 134 EIISQKMND-DVNSSIFEKTISSIQSC 159
           +I+ + ++D    S + E+ +  ++S 
Sbjct: 158 KIVGEALDDVARQSRVVERFLDDLESS 184


>gi|282917456|ref|ZP_06325209.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           D139]
 gi|282318658|gb|EFB49015.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           D139]
          Length = 173

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+K 
Sbjct: 20  TVIVQVLTFIVLLALLEKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE ++I+  AK +A+   E+        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++    ++ +K +    
Sbjct: 140 ELSVLIASKVLRKEISEQDQKALVDKYLKEAG 171


>gi|150005514|ref|YP_001300258.1| ATP synthase B subunit [Bacteroides vulgatus ATCC 8482]
 gi|212695021|ref|ZP_03303149.1| hypothetical protein BACDOR_04559 [Bacteroides dorei DSM 17855]
 gi|237710543|ref|ZP_04541024.1| ATP synthase B subunit [Bacteroides sp. 9_1_42FAA]
 gi|237727039|ref|ZP_04557520.1| ATP synthase B subunit [Bacteroides sp. D4]
 gi|254884063|ref|ZP_05256773.1| ATP synthase B subunit [Bacteroides sp. 4_3_47FAA]
 gi|265750319|ref|ZP_06086382.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_33FAA]
 gi|294778716|ref|ZP_06744135.1| ATP synthase F0, B subunit [Bacteroides vulgatus PC510]
 gi|319640737|ref|ZP_07995450.1| ATP synthase subunit B [Bacteroides sp. 3_1_40A]
 gi|226741355|sp|A6L4M2|ATPF_BACV8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149933938|gb|ABR40636.1| ATP synthase B subunit [Bacteroides vulgatus ATCC 8482]
 gi|212662337|gb|EEB22911.1| hypothetical protein BACDOR_04559 [Bacteroides dorei DSM 17855]
 gi|229433895|gb|EEO43972.1| ATP synthase B subunit [Bacteroides dorei 5_1_36/D4]
 gi|229455265|gb|EEO60986.1| ATP synthase B subunit [Bacteroides sp. 9_1_42FAA]
 gi|254836856|gb|EET17165.1| ATP synthase B subunit [Bacteroides sp. 4_3_47FAA]
 gi|263237215|gb|EEZ22665.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_33FAA]
 gi|294447372|gb|EFG15953.1| ATP synthase F0, B subunit [Bacteroides vulgatus PC510]
 gi|317387549|gb|EFV68415.1| ATP synthase subunit B [Bacteroides sp. 3_1_40A]
          Length = 166

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 62/156 (39%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   I  VI+     P ++   +D     I   +  AR   E+  NI    +   +
Sbjct: 12  FWMVIVFGIVFVILAKYGFP-VITRMVDERKQYIDKSLLAAREANEQLANIKADSEMILA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K  EE   I+  A    + + +E     +      L + +++I   K  A   +  ++A 
Sbjct: 71  KAHEEQARILNEAVATRERILKEAKTQAQVEGQKLLDEAKKQIQAEKDSAISDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDDVNS-SIFEKTISSIQSCHQ 161
            SV+I  +++ + ++D+     + ++ +  +     
Sbjct: 131 LSVDIAEKVLRKNLDDEKEQMEMIDRLLDELTVSKD 166


>gi|239637400|ref|ZP_04678382.1| ATP synthase F0, B subunit [Staphylococcus warneri L37603]
 gi|239597000|gb|EEQ79515.1| ATP synthase F0, B subunit [Staphylococcus warneri L37603]
 gi|330684786|gb|EGG96479.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU121]
          Length = 173

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 68/152 (44%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   I L+ ++       L   +D     I  DI +A + +  ++ +  + K+  
Sbjct: 20  TVIVQIVTFIILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKLNAQKLEEENKQTL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E + I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 80  KETQDEVQRILEDAKVQARKQHEEIIHEANVRANGMIETAQSEINSQKERAIADINNQVS 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 140 ELSVLIASKVLRKEISEQDQKELVEKYLKEAG 171


>gi|295836490|ref|ZP_06823423.1| ATP synthase F0, beta subunit [Streptomyces sp. SPB74]
 gi|197699017|gb|EDY45950.1| ATP synthase F0, beta subunit [Streptomyces sp. SPB74]
          Length = 180

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 64/156 (41%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I   ++ +  +P+ +   LD   + I   + +A   R +++++L QYK + ++
Sbjct: 24  IGALAFVIVFGLLAWKLLPN-INKVLDERREAIEGGMEKAEAARTEADSVLEQYKAQLAE 82

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 83  ARHEAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIEADRKAAATTLRQDVGRL 142

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + E+  +++ + + +    S   ++ +  + +  + 
Sbjct: 143 ATELAGKLVGESLEDHARQSRTIDRFLDELDAKAEA 178


>gi|71066582|ref|YP_265309.1| F0F1 ATP synthase subunit B [Psychrobacter arcticus 273-4]
 gi|123647733|sp|Q4FQ33|ATPF_PSYA2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71039567|gb|AAZ19875.1| ATP synthase Fo, B subunit [Psychrobacter arcticus 273-4]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   L+  ++    KI + +  A + +         
Sbjct: 1   MNINSTLIGQAIAFAIFVMFCMKFVWPPLIGAINDRQRKIAEGLNAAEKAKADLATAERD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++    + +   +I  A   A  L E+     +       +  +  I     +A+  L
Sbjct: 61  VQQELDLAKTKAAALIEQANKSANQLVEDAKSQAQVEGERIRQQAQAAIDQEINQARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A+ +V    +I+  K++   ++S+ ++  + +
Sbjct: 121 RAQVAELAVLGAEKILQDKVDVQKHASMLDQLAAKL 156


>gi|156936116|ref|YP_001440032.1| F0F1 ATP synthase subunit B [Cronobacter sakazakii ATCC BAA-894]
 gi|260595798|ref|YP_003208369.1| F0F1 ATP synthase subunit B [Cronobacter turicensis z3032]
 gi|226741448|sp|A7MMX3|ATPF_ENTS8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|156534370|gb|ABU79196.1| hypothetical protein ESA_04010 [Cronobacter sakazakii ATCC BAA-894]
 gi|260214975|emb|CBA26606.1| ATP synthase subunit b [Cronobacter turicensis z3032]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  E     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLELAQSN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRAQILDEAKAEAEQERNKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I  K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVNKLVAEL 156


>gi|309379547|emb|CBX21913.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +   Q +A      +  +      A+ +L
Sbjct: 61  VAELMAEGRNQVTEMVANAEKRAAKIVEEAKEQASQEAARIAAQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVASLAVKGAESILRKEVDASKHADLLSTLKQEL 156


>gi|269219860|ref|ZP_06163714.1| ATP synthase F0, B subunit [Actinomyces sp. oral taxon 848 str.
           F0332]
 gi|269210765|gb|EEZ77105.1| ATP synthase F0, B subunit [Actinomyces sp. oral taxon 848 str.
           F0332]
          Length = 182

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 65/152 (42%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +S +I + + ++       +  LD    KI + + +A R RE++        ++ ++
Sbjct: 19  WGTVSFVI-VALAIFKFAWPTFMRLLDERTQKIDEGLNQAERAREETARERAALADEVNE 77

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+  A  + E+  +N    +       +++I      A+  L   +   
Sbjct: 78  ARREAAQIRETAQSNAAAIVEDAKKNASVEAKRVADAAQRQIDADAKLARTQLRRDVGSL 137

Query: 128 SVEIVREIISQK-MNDDVNSSIFEKTISSIQS 158
           + E+   I+ ++ ++  V+S++ +  +  +++
Sbjct: 138 AAELAGRIVGEQALDPKVSSAVVDSFLDELEA 169


>gi|221069424|ref|ZP_03545529.1| ATP synthase F0, B subunit [Comamonas testosteroni KF-1]
 gi|220714447|gb|EED69815.1| ATP synthase F0, B subunit [Comamonas testosteroni KF-1]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V + + + L +     +   +   LD  A KI D +  A + + +   +  +
Sbjct: 1   MSINATLFVQLGVFLVLALFTMKFVWPPIAKALDERAQKIADGLAAADKAKTELTAVNKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ ++   ET   +  A+ RA+ + EE      +     +     +     + A+  L
Sbjct: 61  VEQELAQTRNETASRLADAERRAQAIIEEAKARATEEGNKIVAAARAEADQQAIAAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  +++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILKKEVNAGIHADLLNRLKTEL 156


>gi|259910320|ref|YP_002650676.1| F0F1 ATP synthase subunit B [Erwinia pyrifoliae Ep1/96]
 gi|224965942|emb|CAX57475.1| ATP synthase, F0 complex, b subunit [Erwinia pyrifoliae Ep1/96]
 gi|283480443|emb|CAY76359.1| ATP synthase subunit B protein [Erwinia pyrifoliae DSM 12163]
 gi|310765900|gb|ADP10850.1| F0F1 ATP synthase subunit B [Erwinia sp. Ejp617]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    ++ D +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +++ + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDRLKKAKDDAQVIIEQANKRRAQILDEAKAEAEQERNKIVTQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|117618536|ref|YP_858683.1| F0F1 ATP synthase subunit B [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|226694386|sp|A0KQY2|ATPF_AERHH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117559943|gb|ABK36891.1| ATP synthase F0, B subunit [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V+     +   L++ ++A    I D +  A R ++  +     
Sbjct: 1   MNINATLLGQAIAFFIFVVFCMKYVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + + +  EII  A  R   + +E            L     +I   +  AK  L
Sbjct: 61  ATDQLKEAKLQAAEIIEQANKRKAQIIDEAAAGAHSEREKILAQGRAEIEAERHRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I++++++   NS I +K ++ +
Sbjct: 121 RKQVAALAIAGAEKILARQIDQAANSDIVDKLVAEL 156


>gi|49475212|ref|YP_033253.1| F0F1 ATP synthase subunit B [Bartonella henselae str. Houston-1]
 gi|81696226|sp|Q6G5K9|ATPF2_BARHE RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|49238017|emb|CAF27223.1| ATP synthase B chain [Bartonella henselae str. Houston-1]
          Length = 164

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/148 (30%), Positives = 88/148 (59%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++VY  +P ++L  LD  A +I+D++ EA RLRE+++ +L +Y+ KH
Sbjct: 4   TFWAFVGLVLFLALLVYFEVPEMVLRHLDTRAKRIKDELDEALRLREEAQEVLAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ E++ +EII AAK   + +  E     E+      K  EQKI   + +A R++ +   
Sbjct: 64  AEAEKDAQEIIAAAKREVEAVISEARIKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAI 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTI 153
           D +V   R +I ++++    + + ++++
Sbjct: 124 DLAVSAARVLIEKELDSHKANELIKESL 151


>gi|303232524|ref|ZP_07319210.1| ATP synthase F0, B subunit [Atopobium vaginae PB189-T1-4]
 gi|302481311|gb|EFL44385.1| ATP synthase F0, B subunit [Atopobium vaginae PB189-T1-4]
          Length = 204

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 68/161 (42%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +   + +  V+       ++S ++    KI+ D+  A +L+ ++     Q ++ 
Sbjct: 44  AEFVPALVAFLVIWFVMAKFAWPQIVSMMEKRELKIKGDLDSAEKLKTQAAQDKKQAEDL 103

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            ++ + +  +I+  A+  A+        + +  +A  ++     I   + +A   L   +
Sbjct: 104 VAQAQVKAADIVARARREAEEERAHIVSDAQAHAAGLMEKSRDAIANERHKATVELSGFV 163

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKN 165
            D SVEI  +II   M  +    + E+ +  + + H  D+ 
Sbjct: 164 VDLSVEIASKIIGSGMTIEDQRKLAERCLEEVGAQHDEDQA 204


>gi|292493908|ref|YP_003529347.1| ATP synthase F0 subunit beta [Nitrosococcus halophilus Nc4]
 gi|291582503|gb|ADE16960.1| ATP synthase F0, B subunit [Nitrosococcus halophilus Nc4]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+   T +  M     L+  V   +   L   ++    ++ D +  A R + + E    +
Sbjct: 1   MNVTATLIGQMVAFGILIWFVNRYLWGPLTRLMEERKKRVADGLAAAERGKHEQELAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            KE   + +E+  EII  A+ RA  + EE  ++              +I      A+  L
Sbjct: 61  AKETLHEAKEKAAEIISQAQKRANEIVEEAKESAHAEGERLKAAANAEIQQEMNRAREDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++   +V    +I+ ++++++ N ++ ++ +  I
Sbjct: 121 RGQVVSIAVAGASKILKRELDEEANQALVKELVGQI 156


>gi|300719166|ref|YP_003743969.1| ATP synthase, F0 complex, b subunit [Erwinia billingiae Eb661]
 gi|299065002|emb|CAX62122.1| ATP synthase, F0 complex, b subunit [Erwinia billingiae Eb661]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V+     +   L++ ++    ++ + +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVLFCMKYVWPPLMAAIEKRQKEVAEGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +EE + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKEEAQVIIEQANKRRSQILDEVKAEAEQERNKIVTQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|300721118|ref|YP_003710386.1| membrane-bound ATP synthase, F0 sector subunit b [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627603|emb|CBJ88122.1| membrane-bound ATP synthase, F0 sector, subunit b [Xenorhabdus
           nematophila ATCC 19061]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNINATILGQAFAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLASAERAKKNLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + + + II  A  +   + ++     E      L     +I   +  A+  L
Sbjct: 61  ATDQLKKAKADAQVIIEQANKQKAQIIDDAKAEAELERNKILVQANAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|107024495|ref|YP_622822.1| F0F1 ATP synthase subunit B [Burkholderia cenocepacia AU 1054]
 gi|116688126|ref|YP_833749.1| F0F1 ATP synthase subunit B [Burkholderia cenocepacia HI2424]
 gi|170731473|ref|YP_001763420.1| F0F1 ATP synthase subunit B [Burkholderia cenocepacia MC0-3]
 gi|206558436|ref|YP_002229196.1| F0F1 ATP synthase subunit B [Burkholderia cenocepacia J2315]
 gi|254246694|ref|ZP_04940015.1| F0F1-type ATP synthase, subunit b [Burkholderia cenocepacia PC184]
 gi|123371043|sp|Q1BRA6|ATPF_BURCA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741315|sp|B1JSV3|ATPF_BURCC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741316|sp|A0K2X9|ATPF_BURCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741317|sp|B4EEY5|ATPF_BURCJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|105894684|gb|ABF77849.1| ATP synthase F0 subcomplex B subunit [Burkholderia cenocepacia AU
           1054]
 gi|116646215|gb|ABK06856.1| ATP synthase F0 subcomplex B subunit [Burkholderia cenocepacia
           HI2424]
 gi|124871470|gb|EAY63186.1| F0F1-type ATP synthase, subunit b [Burkholderia cenocepacia PC184]
 gi|169814715|gb|ACA89298.1| ATP synthase F0, B subunit [Burkholderia cenocepacia MC0-3]
 gi|198034473|emb|CAR50338.1| ATP synthase B chain [Burkholderia cenocepacia J2315]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + +    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELDAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|318060710|ref|ZP_07979433.1| F0F1 ATP synthase subunit B [Streptomyces sp. SA3_actG]
          Length = 176

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 64/156 (41%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I   ++ +  +P+ +   LD   + I   + +A   R +++++L QYK + ++
Sbjct: 20  IGALAFVIVFGLLAWKLLPN-INKVLDERREAIEGGMEKAEAARTEADSVLEQYKAQLAE 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 79  ARHEAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHTQIEADRKAAATTLRQDVGRL 138

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + E+  +++ + + +    S   ++ +  + +  + 
Sbjct: 139 ATELAGKLVGESLEDHARQSRTIDRFLDELDAKAEA 174


>gi|295678137|ref|YP_003606661.1| ATP synthase F0, B subunit [Burkholderia sp. CCGE1002]
 gi|295437980|gb|ADG17150.1| ATP synthase F0, B subunit [Burkholderia sp. CCGE1002]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 71/156 (45%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  A KI D +  A + +++ E    +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERAKKIADGLSAAEKGKQELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA  +A+E     +  +A  +   +       ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAVAVADEIKAQAQVEAARIIAQAKADAEQQVVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQAAHADLLNQLKAEL 156


>gi|146276249|ref|YP_001166408.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides ATCC 17025]
 gi|226694456|sp|A4WNY9|ATPF_RHOS5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145554490|gb|ABP69103.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 184

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/155 (26%), Positives = 85/155 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ +IF+ I+VY ++P  +L  LD  A +IR ++ EAR LRE++  IL  Y  
Sbjct: 27  NTNFIVTLAFLIFMGILVYAKVPGRILGMLDRRAVQIRSELEEARALREEARTILASYDR 86

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+ +A+  A+  AE+   +++   A  L   E +I   +  A R +  +
Sbjct: 87  KQKEVQEQAARIVASARDEAQAAAEQAKADLKASIARRLAAAEDQIASAEAGAVRAIREQ 146

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
               +V    ++++++M     S+  +++I  +++
Sbjct: 147 AISVAVAAASDVLARQMTPAATSASIDESIKEVEA 181


>gi|167587932|ref|ZP_02380320.1| F0F1 ATP synthase subunit B [Burkholderia ubonensis Bu]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  A KI D +  A + + + +    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERAKKIADGLAAAEKGKAELDAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVATLAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|241758905|ref|ZP_04757017.1| ATP synthase F0, B subunit [Neisseria flavescens SK114]
 gi|241320726|gb|EER56959.1| ATP synthase F0, B subunit [Neisseria flavescens SK114]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+ +L
Sbjct: 61  VAELMAEGRNQVTEMVANAEKRAAKIVEEAKEQASHEAARIAAQAKADVEQEVNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ ++++   ++ +       +
Sbjct: 121 REQVATLAVKGAESILRKEVDASKHADLLSALKQEL 156


>gi|161523282|ref|YP_001578294.1| F0F1 ATP synthase subunit B [Burkholderia multivorans ATCC 17616]
 gi|189351945|ref|YP_001947573.1| F0F1 ATP synthase subunit B [Burkholderia multivorans ATCC 17616]
 gi|221202182|ref|ZP_03575217.1| ATP synthase F0, B subunit [Burkholderia multivorans CGD2M]
 gi|221208757|ref|ZP_03581756.1| ATP synthase F0, B subunit [Burkholderia multivorans CGD2]
 gi|221214292|ref|ZP_03587264.1| ATP synthase F0, B subunit [Burkholderia multivorans CGD1]
 gi|254250976|ref|ZP_04944294.1| F0F1-type ATP synthase [Burkholderia dolosa AUO158]
 gi|226741318|sp|A9AJG0|ATPF_BURM1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|124893585|gb|EAY67465.1| F0F1-type ATP synthase [Burkholderia dolosa AUO158]
 gi|160340711|gb|ABX13797.1| ATP synthase F0, B subunit [Burkholderia multivorans ATCC 17616]
 gi|189335967|dbj|BAG45037.1| F-type H+-transporting ATPase b chain [Burkholderia multivorans
           ATCC 17616]
 gi|221165947|gb|EED98421.1| ATP synthase F0, B subunit [Burkholderia multivorans CGD1]
 gi|221171389|gb|EEE03837.1| ATP synthase F0, B subunit [Burkholderia multivorans CGD2]
 gi|221177976|gb|EEE10388.1| ATP synthase F0, B subunit [Burkholderia multivorans CGD2M]
 gi|325525637|gb|EGD03411.1| F0F1 ATP synthase subunit B [Burkholderia sp. TJI49]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  + KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLVLAWFTMKFVWPPLINALDERSKKIADGLAAAEKGKAELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA+ +AEE   N +  +A  +   + +     ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAQAVAEEIKANAQAEAARIVAQAKAEAEQQIVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQTAHAQLLNQLKAEL 156


>gi|77361908|ref|YP_341483.1| F0F1 ATP synthase subunit B [Pseudoalteromonas haloplanktis TAC125]
 gi|123589152|sp|Q3IK46|ATPF_PSEHT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|76876819|emb|CAI88041.1| membrane-bound ATP synthase, F0 sector, subunit b
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V+     +   L   ++A   KI D +  + R  +  E    +
Sbjct: 1   MNLNATLIGELIAFTVFVLFCMKFVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  +II  AK RA ++ +E     +Q     +     +I   +      L
Sbjct: 61  AAEQLKDAKVQAADIIDQAKKRAVLIVDEETVRGQQEREKIIAQGHSEIESERNRVTEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V   + I+ +++N   +S I EK ++ +
Sbjct: 121 RKQVATLAVVGAQRILEREINQAAHSDIVEKLVAEL 156


>gi|323339968|ref|ZP_08080235.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
 gi|323092610|gb|EFZ35215.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
          Length = 174

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 65/152 (42%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           FL ++   + L+  V       +   ++  A+KI +DI  A   R+K+E +  Q +E   
Sbjct: 18  FLFYLLTFVVLIAAVKHFAWGPVTEMMEKRANKIANDIDSAEDARKKAEELAAQREEALK 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +II  AK   +        + +        + ++ I   + EA   +   +A+
Sbjct: 78  DSHVEASKIIDRAKQNGEQQKASIVDSAQSEVMTMKDNAKKDIEQQRQEAMSGIKNDVAE 137

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            S+EI  +II +++N +   ++ +  I  +  
Sbjct: 138 LSIEIASKIIQKELNAEDQKALVDSYIEGLGK 169


>gi|261364183|ref|ZP_05977066.1| ATP synthase F0, B subunit [Neisseria mucosa ATCC 25996]
 gi|288567790|gb|EFC89350.1| ATP synthase F0, B subunit [Neisseria mucosa ATCC 25996]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   ++  LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQIIVFFGLVWFTMKFVWPPIVKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +       +         A+ +L
Sbjct: 61  VAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASVEAVRITAQAKADAQQEMNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  +++   ++ +       +
Sbjct: 121 REQVAALAVKGAESILRSEVDTSKHAQLLSALKQEL 156


>gi|54310646|ref|YP_131666.1| F0F1 ATP synthase subunit B [Photobacterium profundum SS9]
 gi|81697253|sp|Q6LLG4|ATPF_PHOPR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46915089|emb|CAG21864.1| Putative AtpF, ATP synthase F0, B subunit [Photobacterium profundum
           SS9]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L       F V      +   L+  ++    KI D +  A R  +        
Sbjct: 1   MNMNATLLGQAIAFFFFVTFCMKYVWPPLMEAIEERQAKIADGLVAADRAAKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +    E+I  A  R   + +E     +      L     +I   +  A+  L
Sbjct: 61  ASEQLKEAKHAASELIEQANKRRAQIVDEAKAEAQAEREKILAQGLAEIESERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ DV++ +  K  + +
Sbjct: 121 RKQVATLAVIGAEKILERSIDKDVHAELLNKVTAEL 156


>gi|319408195|emb|CBI81848.1| ATP synthase, B chain [Bartonella schoenbuchensis R1]
          Length = 164

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 42/150 (28%), Positives = 86/150 (57%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++VY ++P+++   LD    +I D++ EA RLRE+++ IL + + K 
Sbjct: 4   TFWAFIGLVLFLALLVYFKVPTMVARSLDMRTKRITDELDEALRLREEAQEILAECQRKC 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + E+  +EII +AK+   ++  E     E+      K +EQKI   + +A R++     
Sbjct: 64  VEAEKNAQEIIASAKNEVSVIVAEARTKTEEYVKNRKKMVEQKIAQAEADAIRVVSLSAI 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           D ++   R +I+++++   +  + EK+++ 
Sbjct: 124 DLAISSSRTLINKELDFKESKDLIEKSLTK 153


>gi|86356513|ref|YP_468405.1| F0F1 ATP synthase subunit B [Rhizobium etli CFN 42]
 gi|123512871|sp|Q2KBV8|ATPF_RHIEC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86280615|gb|ABC89678.1| ATP synthase protein, subunit B [Rhizobium etli CFN 42]
          Length = 163

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 50/159 (31%), Positives = 93/159 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           HFD TF  F+ LI+FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HFDATFFAFVGLILFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   + +A + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAEMLTAEAKKKTEEFVANRTALSEQKIKQAEADAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +   D ++     ++++K +  V S +F   +  +++  
Sbjct: 124 SAAVDLAIAAAETVLAKKADGKVQSELFGNAVGQVKTRL 162


>gi|83746952|ref|ZP_00943998.1| ATP synthase B chain [Ralstonia solanacearum UW551]
 gi|207744816|ref|YP_002261208.1| atp synthase b chain protein [Ralstonia solanacearum IPO1609]
 gi|83726372|gb|EAP73504.1| ATP synthase B chain [Ralstonia solanacearum UW551]
 gi|206596226|emb|CAQ63153.1| atp synthase b chain protein [Ralstonia solanacearum IPO1609]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 74/156 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  ++   E  + I  A+ RA++ A+E  QN +  +A  +   + +     + A+  L
Sbjct: 61  VEQALTEARNEGAQRIADAEKRAQMSADEIKQNAQAEAARIIAQAKAEAEQQTVRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVATLAVKGAEQILKREVNAQVHTDLLNQLKAEL 156


>gi|238783018|ref|ZP_04627045.1| ATP synthase B chain [Yersinia bercovieri ATCC 43970]
 gi|238716019|gb|EEQ08004.1| ATP synthase B chain [Yersinia bercovieri ATCC 43970]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     I   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKVEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|78486506|ref|YP_392431.1| F0F1 ATP synthase subunit B [Thiomicrospira crunogena XCL-2]
 gi|123554886|sp|Q31DL6|ATPF_THICR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78364792|gb|ABB42757.1| ATP synthase F0, B subunit [Thiomicrospira crunogena XCL-2]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L+ +   + L+  V   +   L   ++    KI D +  A + + + E    +
Sbjct: 1   MSINATLLIQIIAFVLLIWFVNKVLWGPLSKLMEDRQKKIADGLSAAEKGKHELELAEQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            KE   + + + + ++  A+ R   + E+      + +       + ++      A+  L
Sbjct: 61  AKEVLKEAKAQAQNVLSQAEKRGSEIVEDAKIKATEEADRIKAAAQAELEQEVSRAREDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++   V    +I++++++   ++ + E  + SI
Sbjct: 121 RKEVSTLVVSGAEKILNKEVDAAAHNDMLETLVKSI 156


>gi|294616245|ref|ZP_06696038.1| ATP synthase F0, B subunit [Enterococcus faecium E1636]
 gi|291590759|gb|EFF22475.1| ATP synthase F0, B subunit [Enterococcus faecium E1636]
          Length = 174

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 68/149 (45%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L+ ++       +   L    DKI +D+  A + R  S  +  + +++      +  
Sbjct: 25  FLILLALLKHFAWEPISDILKKREDKIANDLDSAEQSRINSAKMEQEREQQLLASRSDAA 84

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK   ++  +   ++ ++ +A      +  I   +  A   +   +A+ S++I  
Sbjct: 85  DIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKDDVAELSLQIAE 144

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCHQM 162
           +I++++++ +++ S+  + I  + S ++ 
Sbjct: 145 KILNKELSPEMHESLINQYIEGLGSSNET 173


>gi|158321584|ref|YP_001514091.1| ATP synthase F0, B subunit [Alkaliphilus oremlandii OhILAs]
 gi|226694436|sp|A8MJW3|ATPF_ALKOO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158141783|gb|ABW20095.1| ATP synthase F0, B subunit [Alkaliphilus oremlandii OhILAs]
          Length = 167

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 68/159 (42%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            FD TF   ++  + + +++   +   +  F+D     I + I EA    ++S  +  QY
Sbjct: 6   SFDATFFFQLANTLIMFLILKHFLFQPVTEFMDKRTKAIEESIAEAELKNKESNELKAQY 65

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K +++++E  +II  A   A+   +E        +   ++    +I   K +    L 
Sbjct: 66  ESKLTEIKKERTQIIDEAVRNAQKRGDEIVSAAGVEARRTIEKATAEIEREKQKMMNELK 125

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +I+  ++   +++I + ++   +  + ++ I       
Sbjct: 126 GEISQLAIAAAQKVIEKDLDQSAHQQMIQQFIDKAGETQ 164


>gi|163794978|ref|ZP_02188947.1| ATP synthase B chain precursor [alpha proteobacterium BAL199]
 gi|159179797|gb|EDP64324.1| ATP synthase B chain precursor [alpha proteobacterium BAL199]
          Length = 160

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 80/161 (49%), Gaps = 1/161 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D TF V +S ++F+  + +  +     + LDA A++IR+ + EA+ LRE+++     
Sbjct: 1   MFADPTFWVAVSFVLFVA-LTFKMVWQKATTALDARANEIRNRLEEAQNLREEAQAAKAN 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+       +E   I+  A+  AK + EEG + +E   A   +   +KI   + +A + +
Sbjct: 60  YQRLQRDALKEAEAILAHAREEAKRMREEGEKKLEASLARREQLAIEKIAAAEAKALQDV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
             ++ D ++   R++I   ++  V S +    ++ I +  Q
Sbjct: 120 REQMVDLAMAATRQLIESNIDGAVRSRLVADAVAEIPTRLQ 160


>gi|329298806|ref|ZP_08256142.1| F0F1 ATP synthase subunit B [Plautia stali symbiont]
          Length = 154

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 64/154 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   +++ ++    +I + +  A R ++  +     
Sbjct: 1   MNINATILGQAIAFILFVAFCMKYVWPPIMAAIEKRQKEIAEGLASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +EE + II  A  R   + +E     E      +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKEEAQVIIEQANKRRAQILDEAKTEAETERNRIVSQAQAEIEAERSRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTIS 154
             ++A  ++    +II + +++  NS I +K ++
Sbjct: 121 RKQVALLALAGAEKIIERSVDEAANSDIVDKLVA 154


>gi|226694483|sp|Q7UFB9|ATPF2_RHOBA RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
          Length = 242

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 68/151 (45%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +  L I+    +   +L  L A  +KIR+D+  A +   +++ +L  Y+ K  +
Sbjct: 91  WNLIIFLCVLAILSKF-VWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLDE 149

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              + + ++  A+  A+   ++     +  +A   +     I   K  A   +  + +  
Sbjct: 150 AASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSKL 209

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++++ R ++ ++++ D ++ +  +++  + S
Sbjct: 210 AMQVARSVVGRELSADDHADLIRQSMERLPS 240


>gi|163867854|ref|YP_001609058.1| F0F1 ATP synthase subunit B [Bartonella tribocorum CIP 105476]
 gi|226694380|sp|A9IQI8|ATPF2_BART1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|161017505|emb|CAK01063.1| ATP synthase, B chain [Bartonella tribocorum CIP 105476]
          Length = 164

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 48/150 (32%), Positives = 91/150 (60%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++VY +IP  ++  LDA A +I+D++ EA RLRE+++ IL +Y+ KH
Sbjct: 4   TFWAFVGLVLFLALLVYFQIPQKIIHHLDARAKRIKDELDEALRLREEAQEILAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ E++ +EII AAKH  + +  E     E+      K  EQKI   + +A R++ +   
Sbjct: 64  AEAEKDAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAI 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           D ++   R +I+++++ +    + ++ +S 
Sbjct: 124 DLAISTARVLIAKELDSNRADELVKEALSK 153


>gi|329894816|ref|ZP_08270616.1| ATP synthase B chain [gamma proteobacterium IMCC3088]
 gi|328922710|gb|EGG30044.1| ATP synthase B chain [gamma proteobacterium IMCC3088]
          Length = 157

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M   I  V      +   +++ +   A+KI D +  A R     E    +
Sbjct: 1   MNINLTLIGQMVAFIVFVAFCMKYVWPPIVAAMQERAEKIADGLAAADRASLDLELAQKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + + E   II AA  RA  L EE        +         +I   K  AK  L
Sbjct: 61  AVEQMKEAKAEAAGIIDAANKRANALIEEAKNAASAEAEKVKASALAEIEQEKNRAKAEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  + +   +++   ++   ++ +  K  + +
Sbjct: 121 RAELASLTFQGAEKVLGAAIDQSAHADLVSKLTAEL 156


>gi|294668634|ref|ZP_06733730.1| ATP synthase F0, B subunit [Neisseria elongata subsp. glycolytica
           ATCC 29315]
 gi|291309396|gb|EFE50639.1| ATP synthase F0, B subunit [Neisseria elongata subsp. glycolytica
           ATCC 29315]
          Length = 156

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  + +   LV      +   +   LD  ADKI + +  A R +   E    +
Sbjct: 1   MNLNATLIAQLIVFFILVWFTMKYVWPPIAKALDERADKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  +    +  E++  A+ RA  + EE        +A      +  +      A+  L
Sbjct: 61  VAELLADGRNQATELVANAEKRAAQIVEEAKNQASVEAARIAAQAKSDVEQETNRAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  ++N   ++ +       +
Sbjct: 121 REQVAALAVKGAEAILRSEVNAAKHADLLANLKQEL 156


>gi|315128173|ref|YP_004070176.1| F0F1 ATP synthase subunit B [Pseudoalteromonas sp. SM9913]
 gi|315016686|gb|ADT70024.1| F0F1 ATP synthase subunit B [Pseudoalteromonas sp. SM9913]
          Length = 156

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V+     +   L   ++A   KI D +  + R  +  E    +
Sbjct: 1   MNLNATLIGELIAFTVFVLFCMKYVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQHK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  +II  AK RA ++ +E     +Q     +     +I   +      L
Sbjct: 61  AAEQLKDAKAQAADIIEQAKKRAVLIVDEETVRGQQEREKIIAQGHSEIESERNRVTEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +V     I+ +++N   +S I EK ++ +
Sbjct: 121 RKKVATLAVVGAERILEREINQAAHSDIVEKLVAEL 156


>gi|207722128|ref|YP_002252566.1| atp synthase b chain protein [Ralstonia solanacearum MolK2]
 gi|300702509|ref|YP_003744109.1| ATP synthase, f0 sector subunit B [Ralstonia solanacearum CFBP2957]
 gi|206587303|emb|CAQ17887.1| atp synthase b chain protein [Ralstonia solanacearum MolK2]
 gi|299070170|emb|CBJ41461.1| ATP synthase, F0 sector, subunit B [Ralstonia solanacearum
           CFBP2957]
          Length = 156

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  ++   E  + I  A+ RA++ A+E  QN +  +   +   + +     + A+  L
Sbjct: 61  VEQALTEARNEGAQRIADAEKRAQMSADEIKQNAQAEATRIIAQAKAEAEQQTVRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVATLAVKGAEQILKREVNAQVHTDLLNQLKAEL 156


>gi|13476166|ref|NP_107736.1| F0F1 ATP synthase subunit B [Mesorhizobium loti MAFF303099]
 gi|81776791|sp|Q986D1|ATPF2_RHILO RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|14026926|dbj|BAB53522.1| Fo ATP synthase B chain [Mesorhizobium loti MAFF303099]
          Length = 163

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 46/156 (29%), Positives = 90/156 (57%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T    ++LIIFL + +Y+++P ++   LDA A +I  ++ EAR+LR++++ +L QYK+K
Sbjct: 7   ATLWATIALIIFLGVAIYIKVPGLIAKALDARAARISSELDEARKLRDEAQQLLGQYKKK 66

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + E+E  +I+ AAK  A++LA E  +  E          EQKI   + +A   + A  
Sbjct: 67  RKEAEQEAADIVAAAKREAEMLATEAHKKTEDYVIRRTALAEQKIGQAERDAVAEVRASA 126

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            D +VE  R +++ K++    + +F+ +++ +++  
Sbjct: 127 VDIAVEAARALLAAKVDVKAGADLFKASLADVKAKL 162


>gi|21910031|ref|NP_664299.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS315]
 gi|28896271|ref|NP_802621.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes SSI-1]
 gi|81759289|sp|Q8K829|ATPF_STRP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21904221|gb|AAM79102.1| putative putative proton-translocating ATPase subunit b
           [Streptococcus pyogenes MGAS315]
 gi|28811522|dbj|BAC64454.1| putative proton-translocating ATPase, beta subunit [Streptococcus
           pyogenes SSI-1]
          Length = 164

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 62/153 (40%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V + ++I+   ++    S + +  +  +   
Sbjct: 132 LTVLLAKKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|226694481|sp|Q2S434|ATPF_SALRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 169

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +IFL I+        +   L+   ++I   I  A    E+++ I  + +E   
Sbjct: 18  FWKTVAFLIFLYILYRFG-WGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEEARR 76

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + E++ ++I+  A+  A+ L EE      +      +  + +I   K  A + L  ++AD
Sbjct: 77  EAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDEVAD 136

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            ++E  ++II   ++ D +  + +  +    + 
Sbjct: 137 LAIEAAQKIIENDLDADRHRQLVDDALDDFPTN 169


>gi|224823528|ref|ZP_03696637.1| ATP synthase F0, B subunit [Lutiella nitroferrum 2002]
 gi|224603983|gb|EEG10157.1| ATP synthase F0, B subunit [Lutiella nitroferrum 2002]
          Length = 156

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 64/149 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M F+ T L        LV      +   L + +D  A +I D +  A R ++  E    +
Sbjct: 1   MEFNATLLGQAITFAILVWFTMKFVWPPLTNMMDERAKRIADGLAAAERGKQDLEAAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +++  EI++AA+ RA  + EE  +      A  + + +  I    L AK  L
Sbjct: 61  AGDELRKAKQQATEIVMAAEKRASQIVEEAKETARTEGARLVAEAKSDIDQEVLRAKETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIF 149
              +A  +V    +I+  +++   ++ + 
Sbjct: 121 REHVASLAVAGAEKILRHEIDKAKHAELL 149


>gi|255746822|ref|ZP_05420768.1| ATP synthase B chain [Vibrio cholera CIRS 101]
 gi|262155902|ref|ZP_06029024.1| ATP synthase B chain [Vibrio cholerae INDRE 91/1]
 gi|262167084|ref|ZP_06034799.1| ATP synthase B chain [Vibrio cholerae RC27]
 gi|255735579|gb|EET90978.1| ATP synthase B chain [Vibrio cholera CIRS 101]
 gi|262024470|gb|EEY43156.1| ATP synthase B chain [Vibrio cholerae RC27]
 gi|262030354|gb|EEY48996.1| ATP synthase B chain [Vibrio cholerae INDRE 91/1]
          Length = 154

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQAISFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L  
Sbjct: 61  DQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKILERSIDKDTHKDILDNITAKL 154


>gi|300087658|ref|YP_003758180.1| ATP synthase F0 subunit B [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527391|gb|ADJ25859.1| ATP synthase F0, B subunit [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 166

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 69/157 (43%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            +F+  +     L+ ++YL     +L  +D  A +I++ + +A   ++++E   +++K +
Sbjct: 9   ASFIAQLVNFGILLGLLYLVAYKPILRMMDGRAARIKESLEQAEETKKQAEAAEVEFKRQ 68

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            ++  ++ + +I  A   A  + ++  +     +   +   +  I   + E    L  + 
Sbjct: 69  IAEASKQGQAVIERASRTADEIRQKAQEEARTEAEALITRAKADIRRERDEVIDELRKEF 128

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           AD +V    ++I + ++ + +  +  + +       +
Sbjct: 129 ADLTVLAAGKVIGKSLDKEAHRDLINQVLEESTQLRK 165


>gi|15674804|ref|NP_268978.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes M1 GAS]
 gi|71910390|ref|YP_281940.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS5005]
 gi|81533828|sp|Q9A0J1|ATPF_STRP1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13621934|gb|AAK33699.1| putative proton-translocating ATPase, subunit b [Streptococcus
           pyogenes M1 GAS]
 gi|71853172|gb|AAZ51195.1| ATP synthase B chain [Streptococcus pyogenes MGAS5005]
          Length = 164

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 61/153 (39%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRLQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + +  +  +   
Sbjct: 132 LTVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|300933620|ref|ZP_07148876.1| F0F1 ATP synthase subunit B [Corynebacterium resistens DSM 45100]
          Length = 186

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/152 (13%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +I L++     +P      L+   D+I   +  A   + +++  L +Y  + ++
Sbjct: 30  WSLIPFVIILLVFWKFVLP-KFQEVLNQREDQIEGGMQRAEAAQAEAQAALEKYNAQLAE 88

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+++ + +  +      + SA  ++   +++   +      L  ++ + 
Sbjct: 89  ARTEAAQIRDDARNQGQKIIADMKAQATEESARIVESGNKQLEAQRSAVVSDLRKEMGEN 148

Query: 128 SVEIVREIISQKMNDDVNSS-IFEKTISSIQS 158
           S+ +   ++ ++++DDV  S   +  ++ + S
Sbjct: 149 SISLAERLLGEQLSDDVKRSGTIDNFLADLDS 180


>gi|298370411|ref|ZP_06981727.1| ATP synthase F0, B subunit [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281871|gb|EFI23360.1| ATP synthase F0, B subunit [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + + I LV      +   +   LD  A K+ + +  A R +   E    +
Sbjct: 1   MNINATLFAQILVFIGLVWFTMKFVWPPIAKALDERAAKVAEGLAAAERGKNDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +    + A+ +L
Sbjct: 61  VAELLAEGRTQVAEMVANAEKRAAKIVEEAKEQASTEAARITAQAKADVEQEMVRAREIL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  +++   ++ +       +
Sbjct: 121 REQVASLAVKGAESILRDEIDVSKHAQLLGALKQEL 156


>gi|29655225|ref|NP_820917.1| F0F1 ATP synthase subunit B [Coxiella burnetii RSA 493]
 gi|153206129|ref|ZP_01945392.1| ATP synthase F0, B subunit [Coxiella burnetii 'MSU Goat Q177']
 gi|154706921|ref|YP_001423606.1| F0F1 ATP synthase subunit B [Coxiella burnetii Dugway 5J108-111]
 gi|161831252|ref|YP_001597757.1| F0F1 ATP synthase subunit B [Coxiella burnetii RSA 331]
 gi|165918762|ref|ZP_02218848.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 334]
 gi|212211719|ref|YP_002302655.1| F0F1 ATP synthase subunit B [Coxiella burnetii CbuG_Q212]
 gi|212217734|ref|YP_002304521.1| F0F1 ATP synthase subunit B [Coxiella burnetii CbuK_Q154]
 gi|81722488|sp|Q83AF9|ATPF_COXBU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741420|sp|B6J959|ATPF_COXB1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741421|sp|B6J2D6|ATPF_COXB2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741422|sp|A9KBG1|ATPF_COXBN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741423|sp|A9NBC6|ATPF_COXBR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29542497|gb|AAO91431.1| ATP synthase B chain [Coxiella burnetii RSA 493]
 gi|120577259|gb|EAX33883.1| ATP synthase F0, B subunit [Coxiella burnetii 'MSU Goat Q177']
 gi|154356207|gb|ABS77669.1| ATP synthase B chain [Coxiella burnetii Dugway 5J108-111]
 gi|161763119|gb|ABX78761.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 331]
 gi|165917590|gb|EDR36194.1| ATP synthase F0, B subunit [Coxiella burnetii RSA 334]
 gi|212010129|gb|ACJ17510.1| ATP synthase B chain [Coxiella burnetii CbuG_Q212]
 gi|212011996|gb|ACJ19376.1| ATP synthase B chain [Coxiella burnetii CbuK_Q154]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + + +V M + +  + +    I   L   L+A    I D +  A   R++ E   ++
Sbjct: 1   MDINASLIVQMLVFVVFIGLTMKFIWPPLTKALEARRKNIADGLAAAEEGRKELELAEIK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            KE+ ++ + +   II  A  RA  + EE      +  A  ++  + +I      AK  L
Sbjct: 61  SKEQLTEAKTQAAHIIEQANQRANHIVEEAKNKAREEGAHLIQLAKNEIEQEYNAAKTEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +I+  +V   ++I+ ++++   N  + ++ +S I
Sbjct: 121 LKQISTIAVAGAQKILQREVDKASNDRLVDELVSEI 156


>gi|187930581|ref|YP_001901068.1| F0F1 ATP synthase subunit B [Ralstonia pickettii 12J]
 gi|226694448|sp|B2UGV3|ATPF_RALPJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|187727471|gb|ACD28636.1| ATP synthase F0, B subunit [Ralstonia pickettii 12J]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +  ++   E  + I  A+ RA++ A+E  QN +  +A  +   + +     + A+  L
Sbjct: 61  VDQALTEARNEGAQRIADAEKRAQMTADEIKQNAQAEAARIIAQAKAEAEQQTVRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHADLLNQLKAEL 156


>gi|15677768|ref|NP_274932.1| F0F1 ATP synthase subunit B [Neisseria meningitidis MC58]
 gi|121635594|ref|YP_975839.1| F0F1 ATP synthase subunit B [Neisseria meningitidis FAM18]
 gi|161869275|ref|YP_001598442.1| F0F1 ATP synthase subunit B [Neisseria meningitidis 053442]
 gi|218767491|ref|YP_002342003.1| F0F1 ATP synthase subunit B [Neisseria meningitidis Z2491]
 gi|254804247|ref|YP_003082468.1| ATP synthase B chain [Neisseria meningitidis alpha14]
 gi|304388490|ref|ZP_07370593.1| ATP synthase F0 sector subunit B [Neisseria meningitidis ATCC
           13091]
 gi|81832758|sp|Q7DD66|ATPF_NEIMB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694325|sp|A1KW15|ATPF_NEIMF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694330|sp|A9M119|ATPF_NEIM0 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694333|sp|A1IPX1|ATPF_NEIMA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|7227196|gb|AAF42267.1| ATP synthase F0, B subunit [Neisseria meningitidis MC58]
 gi|120867300|emb|CAM11071.1| ATP synthase B chain [Neisseria meningitidis FAM18]
 gi|121051499|emb|CAM07792.1| ATP synthase B chain [Neisseria meningitidis Z2491]
 gi|161594828|gb|ABX72488.1| ATP synthase B chain [Neisseria meningitidis 053442]
 gi|254667789|emb|CBA03746.1| ATP synthase B chain [Neisseria meningitidis alpha14]
 gi|254670871|emb|CBA07366.1| ATP synthase B chain [Neisseria meningitidis alpha153]
 gi|254672599|emb|CBA06305.1| ATP synthase B chain [Neisseria meningitidis alpha275]
 gi|261393268|emb|CAX50894.1| ATP synthase B chain [Neisseria meningitidis 8013]
 gi|304337487|gb|EFM03653.1| ATP synthase F0 sector subunit B [Neisseria meningitidis ATCC
           13091]
 gi|308390036|gb|ADO32356.1| ATP synthase B chain [Neisseria meningitidis alpha710]
 gi|316985560|gb|EFV64507.1| ATP synthase F0, B subunit [Neisseria meningitidis H44/76]
 gi|319409753|emb|CBY90059.1| ATP synthase B chain [Neisseria meningitidis WUE 2594]
 gi|325127452|gb|EGC50382.1| ATP synthase F0, B subunit [Neisseria meningitidis N1568]
 gi|325129476|gb|EGC52306.1| ATP synthase F0, B subunit [Neisseria meningitidis OX99.30304]
 gi|325131661|gb|EGC54367.1| ATP synthase F0, B subunit [Neisseria meningitidis M6190]
 gi|325133399|gb|EGC56063.1| ATP synthase F0, B subunit [Neisseria meningitidis M13399]
 gi|325135531|gb|EGC58149.1| ATP synthase F0, B subunit [Neisseria meningitidis M0579]
 gi|325137524|gb|EGC60107.1| ATP synthase F0, B subunit [Neisseria meningitidis ES14902]
 gi|325139591|gb|EGC62131.1| ATP synthase F0, B subunit [Neisseria meningitidis CU385]
 gi|325141532|gb|EGC64002.1| ATP synthase F0, B subunit [Neisseria meningitidis 961-5945]
 gi|325143649|gb|EGC65968.1| ATP synthase F0, B subunit [Neisseria meningitidis M01-240013]
 gi|325199029|gb|ADY94485.1| ATP synthase F0, B subunit [Neisseria meningitidis G2136]
 gi|325200989|gb|ADY96444.1| ATP synthase F0, B subunit [Neisseria meningitidis H44/76]
 gi|325201423|gb|ADY96877.1| ATP synthase F0, B subunit [Neisseria meningitidis M01-240149]
 gi|325204890|gb|ADZ00344.1| ATP synthase F0, B subunit [Neisseria meningitidis M01-240355]
 gi|325206845|gb|ADZ02298.1| ATP synthase F0, B subunit [Neisseria meningitidis M04-240196]
 gi|325207404|gb|ADZ02856.1| ATP synthase F0, B subunit [Neisseria meningitidis NZ-05/33]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A K+ + +  A R +   E    +
Sbjct: 1   MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKVAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +A      +  +      A+  L
Sbjct: 61  VAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQASSEAARIAAQAKADVEQELFRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  +++   ++ + +     +
Sbjct: 121 REQVAVLAVKGAESILRSEVDASKHAKLLDTLKQEL 156


>gi|120556783|ref|YP_961134.1| ATP synthase F0, B subunit [Marinobacter aquaeolei VT8]
 gi|226741522|sp|A1U7H8|ATPF_MARAV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120326632|gb|ABM20947.1| ATP synthase F0 subcomplex B subunit [Marinobacter aquaeolei VT8]
 gi|302608312|emb|CBW44762.1| membrane-bound ATP synthase, F0 sector, subunit b [Marinobacter
           hydrocarbonoclasticus]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   + + ++A   KI D +  A R     E    +
Sbjct: 1   MNINLTLIGQSIAFAIFVWFCVKYVWPPITAAMEARQKKIADGLSAADRASLDLELAQEK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K +EE   +I  A  RA  + E   ++  +     ++    +I   +++A+  L
Sbjct: 61  ATKELQKAKEEAAALIDQANKRAAQIVEASKEDARKEGEKLIEQARAEIQQERVQARDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  +V    +I+   ++   +S + EK  + +
Sbjct: 121 RAEVATLAVAGAEKILETSVDAKAHSEMLEKLAAEL 156


>gi|319948461|ref|ZP_08022597.1| F0F1 ATP synthase subunit B [Dietzia cinnamea P4]
 gi|319437881|gb|EFV92865.1| F0F1 ATP synthase subunit B [Dietzia cinnamea P4]
          Length = 190

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 66/159 (41%), Gaps = 2/159 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              + L + L +     +P      LD   ++I   +  A + + +++  L +YK + ++
Sbjct: 33  WSLIPLAVILWLFWKFILP-KFQQVLDEREERIEGGLRRAEQTQAEAKEELAKYKAQLAE 91

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+ + + +  +     +  S   +    Q++   + +    L + +   
Sbjct: 92  ARSEAAKIRDDARAQGQQILADMKAEAQAESDRIVAAGNQQLAAQRQQIVAELRSDLGRQ 151

Query: 128 SVEIVREIISQKMNDDVNSS-IFEKTISSIQSCHQMDKN 165
           SV++   ++ ++++D V  S   ++ ++ +       KN
Sbjct: 152 SVDLAERLMGEQLSDSVRRSGTIDRFLADLDRVPGAGKN 190


>gi|228474878|ref|ZP_04059607.1| ATP synthase F0, B subunit [Staphylococcus hominis SK119]
 gi|314935944|ref|ZP_07843294.1| ATP synthase F0, B subunit [Staphylococcus hominis subsp. hominis
           C80]
 gi|228271110|gb|EEK12490.1| ATP synthase F0, B subunit [Staphylococcus hominis SK119]
 gi|313655950|gb|EFS19692.1| ATP synthase F0, B subunit [Staphylococcus hominis subsp. hominis
           C80]
          Length = 176

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 22/141 (15%), Positives = 63/141 (44%)

Query: 17  LVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREII 76
           L+ ++       L   +D     I  DI EA   +  ++ +  + K+   + ++E   I+
Sbjct: 34  LLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTLKETQDEVHHIL 93

Query: 77  LAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREII 136
             A+ +A+   EE  ++  + +   ++  + +I   K  A   +  ++++ SV I  +++
Sbjct: 94  EDARIQARKQHEEIIKDAHERANGMIETAQSEIKSEKERALADINNQVSELSVLIASKVL 153

Query: 137 SQKMNDDVNSSIFEKTISSIQ 157
            +++++     + +K +    
Sbjct: 154 QKEISEQDQKGLVDKYLKEAG 174


>gi|119776780|ref|YP_929520.1| F0F1 ATP synthase subunit B [Shewanella amazonensis SB2B]
 gi|226694475|sp|A1SBU4|ATPF_SHEAM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119769280|gb|ABM01851.1| ATP synthase F0, B subunit [Shewanella amazonensis SB2B]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      I  V      +   L++ ++    +I D +  A R  +  E    +
Sbjct: 1   MNINATLIGQTVAFIIFVWFCMKYVWPPLMNAIEERQKRIADGLANADRAAKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +    EII +A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATEQLKEAKATANEIIESANKRKAQIVEEAKAEADAERARIIAQGKAEIEAERNRVKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++   +S I EK ++ I
Sbjct: 121 RKQVATLALAGAEKILERSIDAAAHSDIVEKLVAEI 156


>gi|83945330|ref|ZP_00957678.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
 gi|83851164|gb|EAP89021.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
          Length = 164

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 42/154 (27%), Positives = 83/154 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D +F  F+ LI+F V+++++  P ++   LD  AD IR ++ EARRLRE+++ ++  Y+ 
Sbjct: 7   DTSFWAFVGLILFFVVIIFVGAPKMIGKALDDRADLIRKELDEARRLREEAQELMATYER 66

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K ++   E   II  AK  A  L +     I Q         EQ+I   + +A + + + 
Sbjct: 67  KQTEAAAEAEAIIKQAKAEADYLRDNAKTEISQRIERRTAMAEQRIAQAEAQAAKEVKSL 126

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            AD +VE   +++S+K+     +++ +   ++++
Sbjct: 127 AADLAVEAAEQLLSKKLTKTQRNALLKADTAALK 160


>gi|251812180|ref|ZP_04826653.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282876485|ref|ZP_06285351.1| ATP synthase F0, B subunit [Staphylococcus epidermidis SK135]
 gi|251804277|gb|EES56934.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281294737|gb|EFA87265.1| ATP synthase F0, B subunit [Staphylococcus epidermidis SK135]
 gi|329735666|gb|EGG71949.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU028]
          Length = 171

 Score = 80.6 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   + L+I++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TTIVTLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKELVEKYLKEAG 169


>gi|167856125|ref|ZP_02478866.1| F0F1 ATP synthase subunit B [Haemophilus parasuis 29755]
 gi|219871745|ref|YP_002476120.1| F0F1 ATP synthase subunit B [Haemophilus parasuis SH0165]
 gi|167852766|gb|EDS24039.1| F0F1 ATP synthase subunit B [Haemophilus parasuis 29755]
 gi|219691949|gb|ACL33172.1| F0F1 ATP synthase subunit B/H(+)-transporting two-sector ATPase,
           F(1) beta subunit [Haemophilus parasuis SH0165]
          Length = 156

 Score = 80.6 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   L+  ++     I D +  A + +++  +  + 
Sbjct: 1   MNLNATLIGQLIAFALFVWFCMKFVWPPLIKAIETRQANIADALASAEKAKQEQADTKVL 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ +K  EE + II  A  R   + E      E   A  ++    ++   +   +  L
Sbjct: 61  VEQELAKAREEAQHIIDLATKRRNEILESVQAEAEAEKAKIIEQGYAEVENERRRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +V    +I+ + ++   N+ I +K ++ +
Sbjct: 121 RQKVAALAVAGAEKIVGRSVDAAANNDIIDKLVAEL 156


>gi|237809871|ref|YP_002894311.1| ATP synthase F0, B subunit [Tolumonas auensis DSM 9187]
 gi|237502132|gb|ACQ94725.1| ATP synthase F0, B subunit [Tolumonas auensis DSM 9187]
          Length = 156

 Score = 80.6 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      I  V      +   L++ ++    +I D +  A R ++  +    +
Sbjct: 1   MNINATILGQTIAFIIFVWFCMKFVWPPLMAAIEKRQKEIADGMASADRAKKDLDLAQNK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +++  EII  A  R   + +E  Q+        L     +I   +  AK  L
Sbjct: 61  AMEQIKEAKQQAAEIIEQANKRRAQVIDEANQDAMAEREKILNQARAEIEAERNRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              +A  +V    +I+ ++++   NS+I +K ++ +
Sbjct: 121 RKHVAALAVAGAEKILERQLDSAANSAIVDKLVAEL 156


>gi|89898931|ref|YP_521402.1| F0F1 ATP synthase subunit B [Rhodoferax ferrireducens T118]
 gi|122480311|sp|Q223D2|ATPF1_RHOFD RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|89343668|gb|ABD67871.1| ATP synthase F0, B subunit [Rhodoferax ferrireducens T118]
          Length = 156

 Score = 80.6 bits (197), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/149 (16%), Positives = 62/149 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T  +   +   LV      +   +   LD  A KI D +  A + + +  +   +
Sbjct: 1   MNINSTLFLQAIVFAILVWFTMKFVWPPITKALDERAQKIADGLAAADKAKSELSSANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + + +    ET   +  A  R + + EE      + +   +   + +      +A+ +L
Sbjct: 61  VEAELALSRTETTARLADADRRGQSIVEEAKSKATEEANKIIAAAKVEAEQQSNKAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIF 149
             ++A  +V+   +I+ +++N  V++ + 
Sbjct: 121 REQVAALAVKGAEQILRKEVNASVHADLL 149


>gi|123444377|ref|YP_001008342.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238759554|ref|ZP_04620716.1| ATP synthase B chain [Yersinia aldovae ATCC 35236]
 gi|238765111|ref|ZP_04626045.1| ATP synthase B chain [Yersinia kristensenii ATCC 33638]
 gi|238787866|ref|ZP_04631663.1| ATP synthase B chain [Yersinia frederiksenii ATCC 33641]
 gi|332163554|ref|YP_004300131.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|226698361|sp|A1JTD1|ATPF_YERE8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122091338|emb|CAL14224.1| ATP synthase subunit B protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238696663|gb|EEP89446.1| ATP synthase B chain [Yersinia kristensenii ATCC 33638]
 gi|238702213|gb|EEP94768.1| ATP synthase B chain [Yersinia aldovae ATCC 35236]
 gi|238724209|gb|EEQ15852.1| ATP synthase B chain [Yersinia frederiksenii ATCC 33641]
 gi|318608061|emb|CBY29559.1| ATP synthase B chain [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325667784|gb|ADZ44428.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861784|emb|CBX71957.1| ATP synthase subunit b [Yersinia enterocolitica W22703]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     I   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|255067778|ref|ZP_05319633.1| ATP synthase F0, B subunit [Neisseria sicca ATCC 29256]
 gi|255047989|gb|EET43453.1| ATP synthase F0, B subunit [Neisseria sicca ATCC 29256]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINATLFAQIIVFFGLVWFTMKFVWPPIAKALDERAAKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + EE  +     +       +         A+ +L
Sbjct: 61  VAELLAEGRNQVSEMVANAEKRAAKIVEEAKEQATVEAVRITAQAKADAQQEMNRAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+  +++   ++ +       +
Sbjct: 121 REQVAALAVKGAESILRSEVDTSKHAQLLSALKQEL 156


>gi|6625699|gb|AAF19358.1|AF188265_4 ATP synthase subunit b [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L     I+  V+     +   L++ ++    +I + +  A R  +  +     
Sbjct: 1   MNLNATILGQAIAIVLFVLFCMKYVWPPLMAAIEKRQKEIANGLASAERAHKDLDLAKAS 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L
Sbjct: 61  ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|319404579|emb|CBI78185.1| ATP synthase subunit b 2 [Bartonella rochalimae ATCC BAA-1498]
          Length = 164

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 44/159 (27%), Positives = 94/159 (59%), Gaps = 1/159 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++VY  +P+ ++  LD  A  I+D++ EA RLRE+++ +L +Y+ KH
Sbjct: 4   TFWAFIGLVLFLALLVYFEVPNAIIRKLDTRAKHIKDELDEALRLREEAQKVLAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            ++E+ET+EII  AK + + +  E     E+    + + +EQKI   +  A R L +   
Sbjct: 64  LEIEKETQEIIADAKDKVEAMLSETRIKTEEYIKNHSRLVEQKIAQAEANAIRTLSSTAV 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDK 164
           D ++  +  ++ ++++ +  +S+ ++ +   +S  +++ 
Sbjct: 124 DLAISAINRLLMKELDAEQANSLIKEPLVK-ESLKKIET 161


>gi|309322173|ref|YP_003934088.1| ATP synthase CF0 subunit I [Geranium palmatum]
 gi|197132346|gb|ACH47691.1| ATP synthase CF0 subunit I [Geranium palmatum]
 gi|300069266|gb|ADJ66387.1| ATP synthase CF0 subunit I [Geranium palmatum]
          Length = 184

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 57/151 (37%), Gaps = 1/151 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++L + L ++++     +L   LD    KI + I  +  LR  +   L +   +  KV+ 
Sbjct: 32  INLSVVLGVLIFFG-KGVLNDLLDNRKQKILNTIQNSEELRGGAIKQLEKAHARLRKVKT 90

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  +  +     A+        +  +          + I + +  A   +  ++   +++
Sbjct: 91  EVDQFRVNEYSEAERKRSNLITSTYKELERSENLKNESIRFEQQRAINQVRQRVFQQALQ 150

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              EI++  +N +++       I    S  +
Sbjct: 151 GALEILNSCLNKELHLRTISANIGLFGSMKE 181


>gi|15673750|ref|NP_267924.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116512627|ref|YP_811534.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125624729|ref|YP_001033212.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281492360|ref|YP_003354340.1| ATP synthase F0 subunit B [Lactococcus lactis subsp. lactis KF147]
 gi|61219599|sp|P0A2Z0|ATPF_LACLA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219602|sp|P0A2Z1|ATPF_LACLM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123320232|sp|Q02XA1|ATPF_LACLS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6048349|gb|AAF02204.1|AF059739_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|12724791|gb|AAK05866.1|AE006407_2 ATP synthase subunit b [Lactococcus lactis subsp. lactis Il1403]
 gi|116108281|gb|ABJ73421.1| ATP synthase F0 subcomplex B subunit [Lactococcus lactis subsp.
           cremoris SK11]
 gi|124493537|emb|CAL98518.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281376024|gb|ADA65515.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. lactis KF147]
 gi|300071526|gb|ADJ60926.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 168

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 64/145 (44%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + +  +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAA 83

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            II  A   A     +      + +    K  ++ I   + EA   +   +AD SV+I  
Sbjct: 84  NIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAE 143

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I Q ++      + +  ++ +  
Sbjct: 144 KLIGQSLDASAQQELIDSYLAKLGE 168


>gi|326382090|ref|ZP_08203783.1| F0F1 ATP synthase subunit B [Gordonia neofelifaecis NRRL B-59395]
 gi|326199516|gb|EGD56697.1| F0F1 ATP synthase subunit B [Gordonia neofelifaecis NRRL B-59395]
          Length = 184

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 56/151 (37%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++  + L +     IP      LD   D I   I  A   + ++   L  Y+E+ + 
Sbjct: 27  WSLVAFAVVLFVFWKFVIP-KYRKVLDERHDTIEGGIARAEAAQAEAAQQLAAYREQLAG 85

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             EE   I   A+ +   +  +        S   + +   ++   + +    L   +   
Sbjct: 86  AREEAAAIRDEARTQGAQIVSDMKAQASTESDRIIANGNAQLDAQRQQVVSELRGDLGKL 145

Query: 128 SVEIVREIISQKMNDD-VNSSIFEKTISSIQ 157
           SV++  +++   ++DD   +   ++ ++ + 
Sbjct: 146 SVDLAEKLVGASLSDDVKQAGTVDRFLAELD 176


>gi|282881588|ref|ZP_06290257.1| ATP synthase F0, B subunit [Prevotella timonensis CRIS 5C-B1]
 gi|281304574|gb|EFA96665.1| ATP synthase F0, B subunit [Prevotella timonensis CRIS 5C-B1]
          Length = 172

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 66/155 (42%), Gaps = 2/155 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F++ ++   ++     P ++++ ++     I D + +A    E+   I  +      
Sbjct: 16  FWMFLAFLVVFFVLSKYGFP-VIINMVEKRKSYIDDSLRKAHEASERLAKIQQEGDAILH 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              E+   ++  A      + E+     +  S+  + +   +I   K  A R + +++A+
Sbjct: 75  DAREKQAVMLKEAAATRDSIVEKAHVKAKDESSRLISEARTEIDIEKQNAIRDIRSQVAE 134

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCH 160
            SV+I  ++I +++ + D    +  K ++ I    
Sbjct: 135 LSVQIAEKVIREELASKDSQMELINKLLNDISVEK 169


>gi|313884674|ref|ZP_07818430.1| ATP synthase F0, B subunit [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620042|gb|EFR31475.1| ATP synthase F0, B subunit [Eremococcus coleocola ACS-139-V-Col8]
          Length = 169

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 64/153 (41%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
           + +   + L+  V+    + L++ LD     I  ++ E   L+  SE    + + K ++ 
Sbjct: 15  MTLISFLILIFCVHRFAWTPLMNVLDQRKRLITKELNEGHDLKAASEKANKEAQAKLTQS 74

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
             E  +I+  AK + + L     Q   Q         +++I   + E    +   IA  S
Sbjct: 75  RVEANKIVNDAKKQGEELKMRLKQEANQDIDAMKAQAQRRIERERQEVLAEMEDTIASVS 134

Query: 129 VEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           VEI  +II  ++N++ +  +    I  ++   +
Sbjct: 135 VEIAEKIIKHEINEEDHRRLINDFIHRLEEEVK 167


>gi|284007077|emb|CBA72352.1| F0F1 ATP synthase subunit B [Arsenophonus nasoniae]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLDLAKAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  K + E + II  A  +   + EE     E      +   + +I   +  A+  L
Sbjct: 61  ATERLRKAKAEAQIIIEQANKQRVQMIEEAKAEAEIERNKIVTQAQIEIDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + ++   NS I +K ++ +
Sbjct: 121 RKQVAMLAISGAEKIIERSVDVAANSDIVDKLVNEL 156


>gi|309322116|ref|YP_003933932.1| ATP synthase CF0 subunit I [Erodium texanum]
 gi|197132340|gb|ACH47688.1| ATP synthase CF0 subunit I [Erodium texanum]
 gi|300069209|gb|ADJ66331.1| ATP synthase CF0 subunit I [Erodium texanum]
          Length = 184

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/152 (13%), Positives = 56/152 (36%), Gaps = 1/152 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L + L ++++     +L   LD    +I + I  +  LR  +   L +   +  KV+
Sbjct: 31  LINLSVVLGVLIFFG-KGVLNDLLDNRKQRILNTIRNSEELRGGAVEELEKAHARLRKVK 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            +     +     A+        +  +          + I + +  A   +   +   ++
Sbjct: 90  TDVELFRVNEYSEAERKRSNLITSAYKELEQAESLKNESIRFEQQRAINQVRQWVVQQAL 149

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           E   EI++  +N +++       I  + S  +
Sbjct: 150 EGALEILNSSLNKELHLRTINANIGLLGSMKE 181


>gi|198274972|ref|ZP_03207504.1| hypothetical protein BACPLE_01131 [Bacteroides plebeius DSM 17135]
 gi|198272419|gb|EDY96688.1| hypothetical protein BACPLE_01131 [Bacteroides plebeius DSM 17135]
          Length = 167

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 70/156 (44%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++  +   I+     P ++L  ++     I + +  AR   E+  N+ ++ ++  +
Sbjct: 12  FWMVITFGVVFFILAKYGFP-VILKTVEDRKAYIDNSLKAAREANEQLANVKVEGEKLLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      + ++  +         +++++++I   K  A R +  ++A 
Sbjct: 71  QAREEQHRILSEAAATRDRIIKDAQEKAFAEGNRLMEEMKKQIETEKESAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV I  +I+  K+ ++   +++ ++ +  +    +
Sbjct: 131 LSVGIAEKIMRNKLADEKEQAALIDRLLDEMIETSK 166


>gi|241765090|ref|ZP_04763081.1| ATP synthase F0, B subunit [Acidovorax delafieldii 2AN]
 gi|241365282|gb|EER60110.1| ATP synthase F0, B subunit [Acidovorax delafieldii 2AN]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   + + LV      +   +   LD  A KI D +  A R + +      +
Sbjct: 1   MSINATLFVQAIVFLILVWFTMKFVWPPIAKALDERAQKIADGLAAADRAKSELTAANQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ S+   ET   +  A  RA+ + EE      +     +     +     ++A+  L
Sbjct: 61  VEKELSQARNETASRLADADRRAQAIIEEAKARATEEGNKIVAAARAEAEQQTVQARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL 156


>gi|329726099|gb|EGG62571.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU144]
          Length = 171

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 71/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V +   + L+I++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TTIVTLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKELVEKYLKEAG 169


>gi|242241513|ref|ZP_04795958.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis W23144]
 gi|242235056|gb|EES37367.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis W23144]
 gi|319399590|gb|EFV87845.1| ATP synthase F0, B subunit [Staphylococcus epidermidis FRI909]
          Length = 171

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 72/152 (47%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V ++  + L+I++       L   +D     I  DI +A + +  ++ +  + ++  
Sbjct: 18  TTIVTLATFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + ++E ++I+  AK +A+   EE      + +   ++  + +I+  K  A   +  +++
Sbjct: 78  KETQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++     + EK +    
Sbjct: 138 ELSVLIASKVLRKEISEQDQKELVEKYLKEAG 169


>gi|262190637|ref|ZP_06048872.1| ATP synthase B chain [Vibrio cholerae CT 5369-93]
 gi|262033475|gb|EEY51978.1| ATP synthase B chain [Vibrio cholerae CT 5369-93]
 gi|327485236|gb|AEA79643.1| ATP synthase B chain [Vibrio cholerae LMA3894-4]
          Length = 154

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQAIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L  
Sbjct: 61  DQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKILERSIDKDTHKDILDNITAKL 154


>gi|317121014|ref|YP_004101017.1| ATP synthase F0 subunit beta [Thermaerobacter marianensis DSM
           12885]
 gi|315590994|gb|ADU50290.1| ATP synthase F0, B subunit [Thermaerobacter marianensis DSM 12885]
          Length = 160

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 24/160 (15%), Positives = 65/160 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M      +         VI++ +     +L  LD   ++I  ++  A R RE++     +
Sbjct: 1   MQISPELIWAFINFFVFVILMTVFFWRPMLELLDRRREEIEANLAAAERAREEAARSEAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+++ +  + E + I+  A   A+   ++  +   + +   L+     I   K +A   L
Sbjct: 61  YRQRLAAAQREAQSILERATQLAEEERQQRLEAARREAEQLLERARATIEREKEQAIAAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
             ++AD ++     ++ + ++ D    +  + +  + +  
Sbjct: 121 RREVADLTLLATERVLGRALDADDQRRLVAEAVEEVANLR 160


>gi|238025749|ref|YP_002909980.1| F0F1 ATP synthase subunit B [Burkholderia glumae BGR1]
 gi|237874943|gb|ACR27276.1| ATP synthase F0, B subunit [Burkholderia glumae BGR1]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 71/156 (45%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + + + L       +   L++ LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQLVVFLILAWFTMKFVWPPLINALDERAKKIADGLAAAEKGKAELEAAHQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA  +AEE   N +  +A  +   +       ++A+  L
Sbjct: 61  ADQELAQARTDGQQRIADAEKRALAVAEEIKANAQAEAARIVAQAKADAEQQVVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A +A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RADVATLAVKGAEQILKREVDQTAHAELLNQLKAEL 156


>gi|150395674|ref|YP_001326141.1| F0F1 ATP synthase subunit B' [Sinorhizobium medicae WSM419]
 gi|226698822|sp|A6U6M6|ATPX_SINMW RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|150027189|gb|ABR59306.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           medicae WSM419]
          Length = 204

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 69/146 (47%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + IP  + S L+   D+I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 57  LWLAITFGLFYLLMSKVIIPR-IGSILETRHDRIAQDLDEASRLKGEADAAIAAYEQELA 115

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  A+     +E   A  +   E +I  +K +A   + A   +
Sbjct: 116 GARAKGHSIADTAREAAKSKAKADRDGVEADLAKKIAAAEARIGDIKSKALADVGAIAEE 175

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            +  IV+++I   +     ++ F+ +
Sbjct: 176 TATAIVKQLIGGTVTKSEIAAAFKAS 201


>gi|302346241|ref|YP_003814539.1| ATP synthase F0, B subunit [Prevotella melaninogenica ATCC 25845]
 gi|302150336|gb|ADK96597.1| ATP synthase F0, B subunit [Prevotella melaninogenica ATCC 25845]
          Length = 170

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 68/154 (44%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  ++   I+     PSI+   ++   + I + + +A     +  NI  Q +E   
Sbjct: 12  FWMTLVFLVVFFILWKWGFPSII-KMVNERKEYIDESLAKAEEANLRLANIQKQGEELLM 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A    + +  +  +     SA  L + + +I   K  A R + +++A+
Sbjct: 71  EAREKQAQILREASETRETIVGQAQEKARDESARILSEAKAEIESQKQAAIRDIRSQVAE 130

Query: 127 FSVEIVREIISQKMNDDV-NSSIFEKTISSIQSC 159
            SV+I  +I+ ++++     + +    +  + S 
Sbjct: 131 LSVQIAEKILHKELSGSAEQTQLINSLLDEVASS 164


>gi|78042703|ref|YP_361342.1| ATP synthase F0 subunit B [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123575369|sp|Q3A942|ATPF_CARHZ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77994818|gb|ABB13717.1| ATP synthase F0, B subunit [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 159

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/159 (21%), Positives = 77/159 (48%), Gaps = 3/159 (1%)

Query: 1   MHFDET--FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           MHFD +      ++  + L I+  + +   +L  ++     I + + +A + +E++E I 
Sbjct: 1   MHFDWSDFIWTLINFFVLLFIL-KILLYKPVLKTIEDRKKSIEESLEKAAKAQEEAERIK 59

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            +Y    +K  EE REII  A+  A+   EE     ++ +   L D +  I   K +A R
Sbjct: 60  AEYDGMIAKAREEAREIIAKAQKTAQAEKEEIIATAQREAQSLLADAKATIAQEKEKALR 119

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            L  +I + +V    +I+++ +  + +  + ++ ++ ++
Sbjct: 120 ELRQEIGNLAVLAAGKILNRAVTLEDHQKLVDEFLNEVK 158


>gi|256848009|ref|ZP_05553453.1| ATP synthase F0, B subunit [Lactobacillus coleohominis 101-4-CHN]
 gi|256715069|gb|EEU30046.1| ATP synthase F0, B subunit [Lactobacillus coleohominis 101-4-CHN]
          Length = 167

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 65/146 (44%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           +   I L ++V+      +   ++  A+KI DDI  A + R+ +  +  Q + +    ++
Sbjct: 19  LISFIILALLVWHFAWKPVTEMMEKRANKIADDIDSAAKDRKDAAKLAAQRQAELQGSKQ 78

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  +I+  A+   + L  +      Q +    +  ++     + +A       +A+ S+E
Sbjct: 79  EATQIVDEARKNGENLRNQIVDEAHQNAQSIQEQAQRDAEQARQDALNGAKDDVANLSLE 138

Query: 131 IVREIISQKMNDDVNSSIFEKTISSI 156
           I  ++I++++N D    + +  I  +
Sbjct: 139 IAAKLINKQLNADDQQQLIDSYIEGL 164


>gi|241664770|ref|YP_002983130.1| F0F1 ATP synthase subunit B [Ralstonia pickettii 12D]
 gi|309780421|ref|ZP_07675171.1| ATP synthase F0, B subunit [Ralstonia sp. 5_7_47FAA]
 gi|240866797|gb|ACS64458.1| ATP synthase F0, B subunit [Ralstonia pickettii 12D]
 gi|308920814|gb|EFP66461.1| ATP synthase F0, B subunit [Ralstonia sp. 5_7_47FAA]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 74/156 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  ++   E  + I  A+ RA++ AEE  QN +  +A  +   + +     + A+  L
Sbjct: 61  VEQALTEARNEGAQRIADAEKRAQMSAEEIKQNAQAEAARIIAQAKAEAEQQTVRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVATLAVKGAEQILKREVNAQVHADLLNQLKAEL 156


>gi|41019057|gb|AAR98500.1| ATP synthase B subunit [Pasteuria penetrans]
          Length = 160

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 70/151 (46%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               ++ ++ + +V    +   +   ++A  ++I+  + EA   R+++   + Q +E   
Sbjct: 10  LFQLVAFLVLVFLVSRFAV-RPVSKMMEARTERIKSTLEEAEAKRKEALLYVEQQREALK 68

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +E + ++  A+ + +  A    Q   Q +   L+  + ++   + EA R L  +++ 
Sbjct: 69  QARQEAQGMLATARFQKEQEAASILQEARQRAEQTLESAKSEVAREREEAVRQLRVEVSG 128

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +V++   I+ ++++   +  + E+ +  + 
Sbjct: 129 LAVQLASRILHKEVDRSQHEQLLERYLRQVG 159


>gi|226694487|sp|Q1DF98|ATPF_MYXXD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 184

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I   +V+  +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 21  FWTLVTFVI-AAVVLKWKAWGPILSLVEEREKQIASSIESAKRERAEAEKLLADQKTAIA 79

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++       +   EE      + +        ++I   K +A   + +   D
Sbjct: 80  EARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKLSARREIDEQKAKAIAEVRSMAVD 139

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++E+  ++IS++M+D    ++ E+ +  +
Sbjct: 140 LAMEVAGKLISERMDDSKQRALAEQFVQGL 169


>gi|84494530|ref|ZP_00993649.1| ATP synthase subunit B [Janibacter sp. HTCC2649]
 gi|84384023|gb|EAP99903.1| ATP synthase subunit B [Janibacter sp. HTCC2649]
          Length = 211

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 18/150 (12%), Positives = 59/150 (39%), Gaps = 2/150 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  I   +     +P +  +        I   + +A   + ++   L QY+ +  +  
Sbjct: 31  LIAFGIMYWLYKSKVVPRM-EALYAERTAAIEGGMEQAEEAQAQAHAALQQYEAQLHEAR 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+    ++  E  +  +  +A   +  +++I   + +A   L +++   S 
Sbjct: 90  TEANTIREEARAEGALIVTELREKAQAEAARITESAQRQIEAERQQALVSLRSEVGTLST 149

Query: 130 EIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            +   I+ + + ++       ++ ++ ++S
Sbjct: 150 TLAGRIVGESLEDEVRQKGTIDRFLAELES 179


>gi|90578416|ref|ZP_01234227.1| hypothetical ATP synthase B chain [Vibrio angustum S14]
 gi|90441502|gb|EAS66682.1| hypothetical ATP synthase B chain [Vibrio angustum S14]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V +    +   L + +D    +I + +       ++ E     
Sbjct: 1   MNLNATMLGQAISFVIFVWLCMKYVWPPLTALIDQRQREIAEGLIHTENASKELELAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++     ++   E++     R   + EE     E+  A  +     ++   +   ++ L
Sbjct: 61  GEKLLDDAKKSANELVEQGNKRRAQIIEEAQAEGEKEKARIIAQGNAEVESDRNRLRQEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++D  +E  +++I++ ++ D N  +  K I  +
Sbjct: 121 RAEMSDMVIETAQKLINRNLDTDANRDLVNKLIKDM 156


>gi|325832082|ref|ZP_08165179.1| ATP synthase F0, B subunit [Eggerthella sp. HGA1]
 gi|325486403|gb|EGC88855.1| ATP synthase F0, B subunit [Eggerthella sp. HGA1]
          Length = 206

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 66/154 (42%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  + + I L IV+         + L+     I+D + ++ + R +SE +L +YK +
Sbjct: 49  AEFIPMLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKSEQARVESERVLEEYKRQ 108

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               + +  +I+  AK   + +  +     +  +   ++     I   K  A   L   +
Sbjct: 109 LEDAKAQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHNAIEAEKKAAISELQGSV 168

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD S+ +   +I + +ND  +  I E+ ++   S
Sbjct: 169 ADLSISVASRLIGEDLNDAEHRKIIERYVNEAGS 202


>gi|209515780|ref|ZP_03264643.1| ATP synthase F0, B subunit [Burkholderia sp. H160]
 gi|209503807|gb|EEA03800.1| ATP synthase F0, B subunit [Burkholderia sp. H160]
          Length = 156

 Score = 80.2 bits (196), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ +D  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINAIDERAKKIADGLSAAEKGKLELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA  +A+E     +  +A  +   +       ++A+  L
Sbjct: 61  VDQELAQARNDGQQRIADAEKRAVAVADEIKAQAQVEAARIIAQAKADADQQVVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RGEVAALAVKGAEQILKREVDQAAHADLLNQLKAEL 156


>gi|289550277|ref|YP_003471181.1| ATP synthase B chain [Staphylococcus lugdunensis HKU09-01]
 gi|315660263|ref|ZP_07913118.1| ATP synthase F0 sector subunit B [Staphylococcus lugdunensis
           M23590]
 gi|289179809|gb|ADC87054.1| ATP synthase B chain [Staphylococcus lugdunensis HKU09-01]
 gi|315494690|gb|EFU83030.1| ATP synthase F0 sector subunit B [Staphylococcus lugdunensis
           M23590]
          Length = 174

 Score = 80.2 bits (196), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 70/152 (46%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V ++    L+ ++       L   +D     I  DI +A + +E ++ +  + ++  
Sbjct: 21  TIIVTLATFAILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKENAQKLEEENQKTL 80

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + +EE + I+  AK +A+   EE        +   ++  + +I+  K  A   +  +++
Sbjct: 81  KETQEEVQRILEDAKVQARKQQEEIIHEANVRANGMIETAQSEINSQKERALADINNQVS 140

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + SV I  +++ +++++    ++ +K I    
Sbjct: 141 ELSVLIASKVLQKEISEQDQKALVDKYIKEAG 172


>gi|150251444|ref|YP_001312177.1| ATP synthase CF0 B chain [Cycas taitungensis]
 gi|226741429|sp|A6H5F2|ATPF_CYCTA RecName: Full=ATP synthase subunit b, chloroplastic; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I
 gi|149941494|dbj|BAF64918.1| ATP synthase CF0 B chain [Cycas taitungensis]
          Length = 184

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 65/153 (42%), Gaps = 1/153 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L + L +++Y     +L + LD    KI   I ++  L + + + L + + +  +VE
Sbjct: 31  LINLSVVLGVLIYFG-KGVLSNLLDDRKQKILSTIRDSEELYKGATDQLEKARARLREVE 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
               EI +    + +   E+      +          + +++ +  A   +  +I+  ++
Sbjct: 90  MRADEIQVNGYSQIEREKEDLINAAHENLERLEDSKNETVNFEQQRAIDQVRQQISRQAL 149

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
                 ++ ++N++++    +  IS +++    
Sbjct: 150 RRALGTLNSRLNNELHLRTIDHNISMLRAMKNT 182


>gi|254475959|ref|ZP_05089345.1| ATP synthase B chain [Ruegeria sp. R11]
 gi|214030202|gb|EEB71037.1| ATP synthase B chain [Ruegeria sp. R11]
          Length = 185

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 86/157 (54%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++PS+L   LD+ A+ I+ D+ EAR LRE+++ IL  Y+ 
Sbjct: 28  NTDFVVTLAFLLFIGILLYAKVPSLLGGQLDSRAEGIKKDLEEARALREEAQTILASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   AE+   +++   A  +   E++I   +  A + +  +
Sbjct: 88  KQQEVQAQADRIVASAREDAAQAAEQAKADLQTSIARRMAAAEEQIAAAQNSAVKEVRDQ 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +++    +IS++M     + + +  I+ + +  
Sbjct: 148 AIVVAIQAADAVISKQMTATEANKLIDAAIADVDAKL 184


>gi|33519487|ref|NP_878319.1| F0F1 ATP synthase subunit B [Candidatus Blochmannia floridanus]
 gi|81713111|sp|Q7VQW0|ATPF_BLOFL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|33517150|emb|CAD83532.1| ATP synthase subunit B [Candidatus Blochmannia floridanus]
          Length = 161

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 57/158 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L  +   I  V      + + L+S ++    KI D +   +  + +SE I  +
Sbjct: 1   MYLNATILGQVIAFILFVWFCMKYVWNPLMSVIEERQKKIIDSLESIKTSKMESERIRNE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 +   ++ EII  A      +         Q     L   + +I   +      L
Sbjct: 61  ALACLKQAHIKSEEIIKYAYECKMQILHTAQNEAYQERDKILSQTQIQIDQERERIISEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              ++   +E   ++I   +N  ++    +K I  + +
Sbjct: 121 RNHVSKLVIESTEKVIDTSINKIIDYDFVDKIIKQLSN 158


>gi|310814623|ref|YP_003962587.1| ATP synthase F0, B subunit [Ketogulonicigenium vulgare Y25]
 gi|308753358|gb|ADO41287.1| ATP synthase F0, B subunit [Ketogulonicigenium vulgare Y25]
          Length = 188

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 87/155 (56%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ ++++ ++P++++  LDA A+ IR  + EAR LR+++  +L  Y++
Sbjct: 31  NTDFVVLLAFLLFIGVLIWAKVPALIVRVLDARAETIRAQLAEARALRDEAAALLASYEQ 90

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+E+   I+  A+  A+  AE+   +IE   A  L   E +I      A + +  +
Sbjct: 91  KQKEVQEQAARIVEVARREAEAAAEKARADIETSVARRLSAAEDQIASAHKAAIKDVRDR 150

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            A  ++   R++I+ +M+    + + +  I ++ +
Sbjct: 151 AASVAIAAARDVIAGQMDATKGNKLIDDAIKTVDA 185


>gi|227497327|ref|ZP_03927559.1| F family two-sector ATPase, F(1) beta subunit [Actinomyces
           urogenitalis DSM 15434]
 gi|226833198|gb|EEH65581.1| F family two-sector ATPase, F(1) beta subunit [Actinomyces
           urogenitalis DSM 15434]
          Length = 199

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 20/152 (13%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++   ++++  +P    + LD    KI + +  A + +E  ++  ++       
Sbjct: 34  WGTIAFLLIAGLLIFFALPR-FTAVLDERTKKIEEGLALADKAKEDQKDAELKAARLVED 92

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+  A+++  +     +  +   L+  +++I   +  A+  L + +   
Sbjct: 93  ARREAAQIRDQAQDEARLIIAQARTEAQAEAGRALEAAQRQILADRQAAQISLRSDVGLL 152

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           +  +  +I+ +++ +  V+S + ++ + S++S
Sbjct: 153 ATSLAEKIVGEQLSDAAVSSRVIDRFLDSLES 184


>gi|225352597|ref|ZP_03743620.1| hypothetical protein BIFPSEUDO_04222 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156791|gb|EEG70185.1| hypothetical protein BIFPSEUDO_04222 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 173

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y+ + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K   E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  KARVEASKIRDDARTEASHIIADARTRAENDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            +  +  +I+  K+ NDDV SS+ ++ I+ + S  +
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDQMIADLDSDKK 173


>gi|329939835|ref|ZP_08289136.1| F0F1 ATP synthase subunit B [Streptomyces griseoaurantiacus M045]
 gi|329301405|gb|EGG45300.1| F0F1 ATP synthase subunit B [Streptomyces griseoaurantiacus M045]
          Length = 186

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 62/151 (41%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    IP+ +   L+   + I   I +A   + +++++L QYK + ++
Sbjct: 24  IGLIAFVIVFGFLYKKLIPN-INKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 82

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 83  ARHEAARLRQEAQEQGAALIAEMRAEGQRQREEIIAAGHAQIEADRKAAAHTLRQDVGRL 142

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQ 157
           + ++  +++ + + +    S + ++ +  ++
Sbjct: 143 ATDLAGKLVGESLQDHARQSRVIDRFLDDLE 173


>gi|209559132|ref|YP_002285604.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes NZ131]
 gi|226696180|sp|B5XKP7|ATPF_STRPZ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|209540333|gb|ACI60909.1| ATP synthase B chain [Streptococcus pyogenes NZ131]
          Length = 164

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 60/153 (39%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + S L   + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQANLD 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +  +II  AK   ++  ++        +    +     I   K +A   +  +++D
Sbjct: 72  ASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
             V +  +I+   ++    S + +  +  +   
Sbjct: 132 LMVLLAEKIMGANLDKTAQSQLIDSYLDDLGEA 164


>gi|332687032|ref|YP_004456806.1| ATP synthase subunit B [Melissococcus plutonius ATCC 35311]
 gi|332371041|dbj|BAK21997.1| ATP synthase B chain [Melissococcus plutonius ATCC 35311]
          Length = 175

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 65/157 (41%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +V     + L++++       +   L    DKI +D+  A + R  +  +  + +++ 
Sbjct: 18  TIIVVTGAFLILMLLLKKFAWGAVTDMLKKREDKIANDLDSAEQSRIAAAKMEQERQQQL 77

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
              + +  EII  AK   +   ++         +   +     I     EA   +   ++
Sbjct: 78  LSSKSDAAEIIKNAKESGEQTRQKLLNEANGEISHLKEKARGDISQEHDEAMASIKTDVS 137

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
             S+EI  +I+++++++  + ++    I S+   ++ 
Sbjct: 138 KLSIEIAEKILNKELSEASHEALINSYIESLGKSNEA 174


>gi|262402098|ref|ZP_06078662.1| ATP synthase B chain [Vibrio sp. RC586]
 gi|262351744|gb|EEZ00876.1| ATP synthase B chain [Vibrio sp. RC586]
          Length = 154

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQAIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L  
Sbjct: 61  DQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIDAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKILERSIDKDAHKDILDNITAKL 154


>gi|315038008|ref|YP_004031576.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1112]
 gi|325956461|ref|YP_004291873.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus 30SC]
 gi|312276141|gb|ADQ58781.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1112]
 gi|325333026|gb|ADZ06934.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus 30SC]
          Length = 169

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I L ++V       +   ++    K+ +D+  A   R+K+E +  + +     
Sbjct: 20  WYLICFAILL-LLVKHYAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANEREAALKN 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A      ++AD 
Sbjct: 79  SRQEATQILSDAKTNAQNTGKEIVASANEDAAAIRKKANEEAAKAKSDALNAARDQVADI 138

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           SV I  ++I++ ++ +    + ++ I  + 
Sbjct: 139 SVAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|330447616|ref|ZP_08311264.1| ATP synthase F0, B subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491807|dbj|GAA05761.1| ATP synthase F0, B subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V +    +   L + ++     I + +       ++ E     
Sbjct: 1   MNLNATMLGQAISFVIFVWLCMKYVWPPLTALIEQRQRDIAEGLIHTENASKELELAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++     ++   E++     R   + E+     E+  A  +   + ++   +   ++ L
Sbjct: 61  GEKLLDDAKKSANELVEQGNKRRAQIIEDAQAEGEKEKARIIAQGQAEVESDRNRLRQEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++D  +E  +++I++ ++ D N  +  K I  +
Sbjct: 121 RAEMSDMVIETAQKLIARNLDTDANRDLVNKLIKDM 156


>gi|119026449|ref|YP_910294.1| F0F1 ATP synthase subunit B [Bifidobacterium adolescentis ATCC
           15703]
 gi|226741309|sp|A1A3C9|ATPF_BIFAA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|118766033|dbj|BAF40212.1| protein with similarity to ATP synthase B chain [Bifidobacterium
           adolescentis ATCC 15703]
          Length = 173

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y  + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  NARVEASKIRDDARAEASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            +  +  +I+  K+ +DDV S++ ++ I+ + S  +
Sbjct: 138 LATALAGKILGSKLESDDVQSTMIDQMIAELDSDKK 173


>gi|212703962|ref|ZP_03312090.1| hypothetical protein DESPIG_02015 [Desulfovibrio piger ATCC 29098]
 gi|212672665|gb|EEB33148.1| hypothetical protein DESPIG_02015 [Desulfovibrio piger ATCC 29098]
          Length = 181

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/149 (13%), Positives = 65/149 (43%), Gaps = 1/149 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ IIF  I+ Y  +  +   F      +I  D+ +    R +++  L + +++ S 
Sbjct: 31  WRVLNFIIFAGILWYF-VGGLARKFFSGRRARISQDLQDLEARRAEAQKRLDEVEKRISN 89

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
           +E E + ++  +  +A+ + +   +  ++ +   ++   +            + A IAD 
Sbjct: 90  LESERKALLDESLAQAESVKQAVVEEAKRQAEQIVQQARRTAENEGRAMLAEVRAAIADE 149

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
            V+   +++++K+    +  +   +++ +
Sbjct: 150 IVDAAEKVLAEKLTAAEHEKLITNSLNKV 178


>gi|121603168|ref|YP_980497.1| F0F1 ATP synthase subunit B [Polaromonas naphthalenivorans CJ2]
 gi|226694349|sp|A1VIU8|ATPF_POLNA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120592137|gb|ABM35576.1| ATP synthase F0, B subunit [Polaromonas naphthalenivorans CJ2]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T  +   +   LV      +   +   LD  A KI D +  A + + +  +   +
Sbjct: 1   MNINSTLFLQAVVFAILVWFTMKFVWPPITKALDERAQKIADGLAAADKAKSELSSANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + + +    ET   +  A  R + + E+      + +   +   + +     ++A+  L
Sbjct: 61  VEAELATSRTETATRLADADRRGQGIIEDAKARAVEEANKIIAAAQAEAAQQSVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVALLAVKGAEQILRKEVNAGVHADLLSRLKTEL 156


>gi|288803184|ref|ZP_06408619.1| ATP synthase F0, B subunit [Prevotella melaninogenica D18]
 gi|288334445|gb|EFC72885.1| ATP synthase F0, B subunit [Prevotella melaninogenica D18]
          Length = 170

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 66/154 (42%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  ++   I+     PSI+   ++   + I + + +A     +  NI  Q ++   
Sbjct: 12  FWMTLVFLVVFFILWKWGFPSII-KMVNERKEYIDESLAKAEEANLRLANIQKQGEDLLM 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      +  +  +     SA  L + + +I   K  A R + +++A+
Sbjct: 71  EAREKQAQILREASETRDTIVGQAQEKARDESARILSEAKAEIESQKQAAIRDIRSQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
            SV+I  +I+ +++      + +    +  + S 
Sbjct: 131 LSVQIAEKILHKELATSAEQTQLINSLLDEVASS 164


>gi|237785861|ref|YP_002906566.1| ATP synthase B chain [Corynebacterium kroppenstedtii DSM 44385]
 gi|237758773|gb|ACR18023.1| ATP synthase B chain [Corynebacterium kroppenstedtii DSM 44385]
          Length = 185

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 56/151 (37%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  ++ L +     +P      L    D+I   I  A   + +++  L +Y ++ ++
Sbjct: 30  WSIVCFVLILWLFWKFVLP-KFQEVLSEREDRIEGGIQRAEAAQSEAKAALQKYNDQLAE 88

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
                  I   A+   + +  +      + S   +   E+++   +      L   +   
Sbjct: 89  ARAAAARIRDEARADGQKIVADMKTEATEESNRIIAQGEKQLAAQRDAVVADLRKDMGQN 148

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQ 157
           SV++  +++   + +D   +   +  +SS+ 
Sbjct: 149 SVDLAEKLLGSHLSDDAKRAETVDSFLSSLD 179


>gi|262371351|ref|ZP_06064669.1| membrane-bound ATP synthase F0 sector [Acinetobacter johnsonii
           SH046]
 gi|262313688|gb|EEY94737.1| membrane-bound ATP synthase F0 sector [Acinetobacter johnsonii
           SH046]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   L++ +     KI D +  A + +    +   Q
Sbjct: 1   MNINLTLIGQAIAFAMFVAFCMKFVWPPLINAISERQRKIADGLNAAEKAKADLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K +    + +  ++I  A  R   L EE             +  ++ +      A+  L
Sbjct: 61  VKAELDAAKAQAAQLIEQANRRGAQLVEEARTQASAEGERIRQQAKEAVDTEINSAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++AD +V    +I+SQK++ + ++++  +  + +
Sbjct: 121 RQQVADLAVTGAEKILSQKVDAEAHNAMLTQLAAKL 156


>gi|197286885|ref|YP_002152757.1| F0F1 ATP synthase subunit B [Proteus mirabilis HI4320]
 gi|227354882|ref|ZP_03839297.1| H(+)-transporting two-sector ATPase [Proteus mirabilis ATCC 29906]
 gi|226694358|sp|B4F0E3|ATPF_PROMH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|194684372|emb|CAR46014.1| ATP synthase B chain [Proteus mirabilis HI4320]
 gi|227165035|gb|EEI49871.1| H(+)-transporting two-sector ATPase [Proteus mirabilis ATCC 29906]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 69/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAKAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+ +K + E + II +A  +   + EE     EQ  +  +   + ++   +  A+  L
Sbjct: 61  AGEQLAKAKAEAQAIIESANKQRTQMIEEAKAEAEQERSKIVAQAQSELEAERKRAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +II + +++  NS I +K ++ +
Sbjct: 121 RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|254523449|ref|ZP_05135504.1| ATP synthase F0, B subunit [Stenotrophomonas sp. SKA14]
 gi|219721040|gb|EED39565.1| ATP synthase F0, B subunit [Stenotrophomonas sp. SKA14]
          Length = 173

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L        L+ ++  +I   L++ ++    KI + +  A R ++       +
Sbjct: 18  MNINFTLLAQALAFAGLIWIIATKIWPPLMNAIEERQQKIAEGLAAADRSQKDLAQAQEK 77

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E   +   +  EII  A  RA  + +         +    +  + +I      A+  L
Sbjct: 78  VNEALKEARTKANEIIDQAHARANQIVDAARNEAITEATRQKELAQAEIDAAANRAREDL 137

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V    +++ ++++ + + ++ ++  S I
Sbjct: 138 RKQVSALAVTGAEKLLKREIDANAHKALLDELASEI 173


>gi|319940681|ref|ZP_08015023.1| ATP synthase subunit B [Sutterella wadsworthensis 3_1_45B]
 gi|319805832|gb|EFW02599.1| ATP synthase subunit B [Sutterella wadsworthensis 3_1_45B]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + +  V M + +    V    I   L+  ++    KI D +  A +  +       Q
Sbjct: 1   MNINASLFVQMVVFLLGAWVTMKYIWPPLIHAIEERQKKIADGLAAANKGEKALAVATEQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +   +        I+   + RA  + E+     +  +   ++  + +       A+  L
Sbjct: 61  GQAIEAAARARASTIVADGEKRALAIVEDAKAQAQVEADRIIESAKAEADVQVQRARDQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++AD +V+   +I++++++  V++ + ++  + +
Sbjct: 121 RDQVADLAVQGAEQILAREVDKTVHAQLLDQLKAKL 156


>gi|226741483|sp|A4ITJ3|ATPF_GEOTN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 180

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 69/149 (46%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +   I L++++       L+  +    + I ++I +A + R+++E +L + +E   +  
Sbjct: 27  QLVAFILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSR 86

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E + I+  A+  A+   E+   +    +    +  +Q+I   K +A   L  ++A  SV
Sbjct: 87  QEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSV 146

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            I  ++I +++ +     + E  I  IQ 
Sbjct: 147 LIASKVIERELTEQDQRKLIEAYIKDIQE 175


>gi|126724950|ref|ZP_01740793.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2150]
 gi|126706114|gb|EBA05204.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2150]
          Length = 185

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 41/158 (25%), Positives = 85/158 (53%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F+  F+V+++ I F+ ++VYL++P  L   LDA A+ IR ++ EA+ LRE+++ +L  Y+
Sbjct: 27  FNTNFVVWLAFIAFIAVLVYLKVPGKLGGALDARANDIRSELDEAKALREEAQTLLASYE 86

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  +V E++  II+ AK  A + A +    ++      L   E +I   + +A + +  
Sbjct: 87  RKQREVAEQSERIIVTAKEEAAVAAAKAKDELKTSIERRLAAAEDQITSAEAKAIQQVRD 146

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
                ++    + I+ KM    ++++ ++ I++  S  
Sbjct: 147 SAVSVAIGAAGDAIAAKMTAADSNALIDEAIANAGSKL 184


>gi|53802695|ref|YP_112549.1| ATP synthase F0 subunit B [Methylococcus capsulatus str. Bath]
 gi|81683272|sp|Q60CR8|ATPF1_METCA RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|53756456|gb|AAU90747.1| ATP synthase F0, B subunit [Methylococcus capsulatus str. Bath]
          Length = 157

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 60/157 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M     LV      +   LL  L+    KI + +  A + + + E    +
Sbjct: 1   MNINATLFGQMVTFALLVWFTMKYVWPPLLQALEERKKKIAEGLAAAEKGKHEMELAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + +++  EI+  A+ RA  L +E  +  +      L +   +I      AK  L
Sbjct: 61  ATAALKEAKDQAAEIVNQAQKRANALVDESKEAAKIEGERILANARSEIDRELENAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
             +++  ++    +I+ ++++   +  I       + 
Sbjct: 121 RKQVSALAISAAEKILQREVDQKKHKEILAGLGKQLG 157


>gi|118590788|ref|ZP_01548189.1| F0F1 ATP synthase subunit B [Stappia aggregata IAM 12614]
 gi|118436764|gb|EAV43404.1| F0F1 ATP synthase subunit B [Stappia aggregata IAM 12614]
          Length = 159

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/158 (31%), Positives = 87/158 (55%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF   + LI+F V++ Y+++P+ +   LD  A+ IR ++ +AR++RE+++ +L +Y+
Sbjct: 1   MDATFWALIGLILFFVVIFYVKVPAKINGSLDDRAETIRKELEDARKMREEAQALLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   II  A   A+ L  E  Q ++++ A   K  E KI   + +A   + A
Sbjct: 61  RKRHEAEGEAEAIIAEANSEAERLTLETSQALDEMIARRTKAAEDKIAQAESQAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           K AD +V    EI++ K+ D V   I  K+I+ ++   
Sbjct: 121 KAADIAVAAAEEILAAKVKDKVADDILTKSIAQVKERL 158


>gi|89074724|ref|ZP_01161182.1| ATP synthase subunit B [Photobacterium sp. SKA34]
 gi|89049488|gb|EAR55049.1| ATP synthase subunit B [Photobacterium sp. SKA34]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L       F V+     +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLLGQAIAFFFFVMFCMKYVWPPIMEAIEERQKKIADGLAAADRAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E     +      L     +I   +  A+  L
Sbjct: 61  ASDQLKEAKRAASELIEQANKRKAQIIDEAKTEAQTEREKILSQGMAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + ++ D  + I  K  + +
Sbjct: 121 RKQVATLAVIGAEKIIERSIDVDAQTDILNKVTAEL 156


>gi|326407255|gb|ADZ64326.1| F-type H+-transporting ATPase subunit b [Lactococcus lactis subsp.
           lactis CV56]
          Length = 168

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 65/145 (44%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + ++ +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELARSKEEAA 83

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            II  A   A     +      + +    K  ++ I   + EA   +   +AD SV+I  
Sbjct: 84  NIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAE 143

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I Q ++      + +  ++ +  
Sbjct: 144 KLIGQSLDASAQQELIDSYLAKLGE 168


>gi|291333880|gb|ADD93561.1| ATP synthase F0 B subunit [uncultured marine bacterium
           MedDCM-OCT-S04-C293]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + TF   +      V + Y  I   + S L+    +I + +  A   + + E    +
Sbjct: 1   MNINATFFAELIAFCIFVFITYRYIWPSMASVLEERRKEIDEGLQAASESKRQLEESKEE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                   + E   +I  A  RA  L +E  +     +    +  E  I     +AK  L
Sbjct: 61  SSRVIDAAKSEASTLINQAGSRADQLIDEAKEQATDEAKKIKETAESDIAQSTNKAKETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++   V    +I+++++++  N  I ++ I  +
Sbjct: 121 KEELSVLVVAGASKILNKEIDESANKEIVDQLIKEL 156


>gi|154488036|ref|ZP_02029153.1| hypothetical protein BIFADO_01605 [Bifidobacterium adolescentis
           L2-32]
 gi|154083509|gb|EDN82554.1| hypothetical protein BIFADO_01605 [Bifidobacterium adolescentis
           L2-32]
          Length = 173

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y  + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  SARVEASKIRDDARAEASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            +  +  +I+  K+ +DDV S++ ++ I+ + S  +
Sbjct: 138 LATALAGKILGSKLESDDVQSTMIDQMIAELDSDKK 173


>gi|299065193|emb|CBJ36359.1| ATP synthase, F0 sector, subunit B [Ralstonia solanacearum CMR15]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 74/156 (47%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  ++   E  + I  A+ RA++ A+E  QN +  +A  +   + +     + A+  L
Sbjct: 61  VEQALTEARTEGAQRIADAEKRAQMTADEIKQNAQAEAARIVAQAKAEAEQQAVRARESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHADLLTQLKAEL 156


>gi|161507272|ref|YP_001577226.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus DPC 4571]
 gi|226741493|sp|A8YUJ7|ATPF_LACH4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|160348261|gb|ABX26935.1| H+-transporting ATP synthase subunit b [Lactobacillus helveticus
           DPC 4571]
          Length = 169

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               +   I L +++       +   ++    K+ +D+  A   R+K+E +  + +    
Sbjct: 19  LWYLICFAILL-LLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANEREAALK 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A      ++AD
Sbjct: 78  NSRQEATQILSDAKANAQKTGKEIVASANEDAAAIRKKANEEAAKAKSDALDSARDQVAD 137

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            S+ I  ++I++ ++ +    + ++ I  + 
Sbjct: 138 ISLAIAEKVIAKNLSAEDQKDLVDQFIKELD 168


>gi|152998461|ref|YP_001343296.1| ATP synthase F0 subunit B [Marinomonas sp. MWYL1]
 gi|226694397|sp|A6W3T2|ATPF2_MARMS RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|150839385|gb|ABR73361.1| ATP synthase F0, B subunit [Marinomonas sp. MWYL1]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   +++ L+  + KI D +  A R     E    Q
Sbjct: 1   MNLNLTLLGQAISFAIFVWFCMKYVWPPVIAALEERSKKIADGLEAANRASRDLELAQEQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + +E   EII  A  RA  + +E  + +        +  + +I    + AK  L
Sbjct: 61  ASQILRESKENAAEIIEQANKRANQMVDEAKEQVIADGKRLREAAQAEIEQDVMRAKEAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++  +     +I+   +++  +S I E+    +
Sbjct: 121 RAQVSVLAFAGAEKILGATIDEKAHSEIVEQLAKEL 156


>gi|269468568|gb|EEZ80217.1| F0F1-type ATP synthase, subunit b [uncultured SUP05 cluster
           bacterium]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  + +           I   +++ +D    +I   +  A R   + +    +
Sbjct: 1   MNINLTMIGQLIMFAMFTWFCMKFIWPPIVAAMDERKKRIESSLIAAERGLSEQKEAEQK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E  ++ +++  EII  A  +A  + E+      Q +       + +I    + A+  L
Sbjct: 61  AQEVLNQSKDQAAEIIANAGRQAASMVEDAKDVASQEADRIKTSAQSEIEQEAMRARNEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++D  ++ V  ++S++++   +  +  K   S+
Sbjct: 121 KDQVSDLVMQGVSSVLSKEVDAKAHKGMLNKLSQSL 156


>gi|240850062|ref|YP_002971455.1| ATP synthase subunit B [Bartonella grahamii as4aup]
 gi|240267185|gb|ACS50773.1| ATP synthase subunit B [Bartonella grahamii as4aup]
          Length = 164

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 47/150 (31%), Positives = 91/150 (60%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL ++VY +IP  ++  LDA A +I+D++ EA RLRE+++ IL +Y+ KH
Sbjct: 4   TFWAFVGLVLFLALLVYFQIPQRVIHHLDARAKRIKDELDEALRLREEAQEILAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           ++ E++ +EII AAKH  + +  E     E+      K  EQKI   + +A R++ +   
Sbjct: 64  AEAEKDAQEIIAAAKHEVESVIAEARTKAEEYVKNRNKLAEQKIAQAEADAIRMVSSSAI 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISS 155
           D ++   R +I+++++ +    + ++++  
Sbjct: 124 DLAISTARILIAKELDSNKADELIKESLEK 153


>gi|196249756|ref|ZP_03148452.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16]
 gi|196210632|gb|EDY05395.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16]
          Length = 180

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 70/149 (46%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            +   I L++++ +     L+  +    + I ++I +A + R+++E +L + +E   +  
Sbjct: 27  QLVAFILLMLLLRIFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLKQSR 86

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E + I+  A+  A+   E+   +    +    +  +Q+I   K +A   L  ++A  SV
Sbjct: 87  QEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVASLSV 146

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            I  ++I +++ +     + E  I  IQ 
Sbjct: 147 LIASKVIERELTEQDQRKLIEAYIKDIQE 175


>gi|298207196|ref|YP_003715375.1| ATP synthase F0, subunit B [Croceibacter atlanticus HTCC2559]
 gi|83849831|gb|EAP87699.1| ATP synthase F0, subunit B [Croceibacter atlanticus HTCC2559]
          Length = 164

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 57/150 (38%), Gaps = 2/150 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +I   ++        +L  +      I+  +  A   R + EN+    +    +
Sbjct: 13  WTVITFLILFFLL-KKFAWKPILGAVHDRETSIKSALDSAEAARREMENLQADNERILQE 71

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   II  A+     +  +     +  +   +K  +  I   K  A   +  ++A+ 
Sbjct: 72  ARTERDSIIKEARSMKDKMIADASDEAQAKADQIIKQAQAAILSEKQAAIADIKNQVANL 131

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSI 156
           S++I  +++ +++ N +  + + E  +  +
Sbjct: 132 SIDIAEKVVREELSNKEKQAKLVEDMLGDV 161


>gi|319406086|emb|CBI79716.1| ATP synthase subunit b 2 [Bartonella sp. AR 15-3]
          Length = 164

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 87/148 (58%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL +++Y  +P++++  LD  A  I+D++ EA  LRE+++ +L +Y+ KH
Sbjct: 4   TFWAFIGLVLFLALLIYFEVPNVIIRKLDTRAKHIKDELNEALHLREEAQKVLAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            ++E+ET+EII  AK + + +  E     E+      +  EQKI   +    R++ +   
Sbjct: 64  LEIEKETQEIIADAKCKVEAIIAETRIKTEEYIKDRSRLAEQKIAQAEANVVRMVSSSAI 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTI 153
           D ++     ++++++  +  +S+ +K++
Sbjct: 124 DLAISAANRLLTKELGAEQANSLIKKSL 151


>gi|262273116|ref|ZP_06050933.1| ATP synthase B chain [Grimontia hollisae CIP 101886]
 gi|262222872|gb|EEY74180.1| ATP synthase B chain [Grimontia hollisae CIP 101886]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLIGQAIAFTMFVWFCMKYVWPPIMQAIEERQKKIADGLAAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII +A  R   + +E  +  +      L   + ++   +  A+  L
Sbjct: 61  ASDQLKEAKRAASEIIESANKRKAQILDEAREEAKAERENILNQGKAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++++ +  I +K  + +
Sbjct: 121 RKQVATLAVMGAEKILERSIDENAHKDILDKITAEL 156


>gi|119947327|ref|YP_945007.1| ATP synthase F0, B subunit [Psychromonas ingrahamii 37]
 gi|226694445|sp|A1T0Z3|ATPF_PSYIN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119865931|gb|ABM05408.1| ATP synthase F0, B subunit [Psychromonas ingrahamii 37]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   LL+ ++    KI D + +A R  +  E    +
Sbjct: 1   MNINATLLGQAIAFAVFVWFCMKYVWPPLLAAIEDRQKKISDGLTQAERAGKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             EK  + + +  EII  A  R   + E      E      +   E ++   +   +  L
Sbjct: 61  ASEKLKEAKVQAAEIIEQANKRRNQIVEAAKTEAETERQKIIAQGEAEVEVDRNRVREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K++  ++    +II + ++ + NS I +K ++ +
Sbjct: 121 RLKVSALAIAGAEKIIKRSIDKEANSDIIDKLVAEL 156


>gi|226326993|ref|ZP_03802511.1| hypothetical protein PROPEN_00853 [Proteus penneri ATCC 35198]
 gi|225204830|gb|EEG87184.1| hypothetical protein PROPEN_00853 [Proteus penneri ATCC 35198]
          Length = 165

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 57/136 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V+     +   +++ ++    +I D +  A R ++  +     
Sbjct: 1   MNLNATILGQAVAFVLFVLFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAKAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ +K + E + II +A  +   + E+     EQ  +  +   + ++   +  A+  L
Sbjct: 61  AGDQLAKAKAEAQAIIESANKQRTQMIEDAKAEAEQERSKIVAQAQSELDAERKRAREEL 120

Query: 121 YAKIADFSVEIVREII 136
             ++A  ++    +I+
Sbjct: 121 RKQVAMLAIAGAEKIL 136


>gi|288957578|ref|YP_003447919.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
 gi|288909886|dbj|BAI71375.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
          Length = 159

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F V ++ +IF   +V+ +  + + + LD  A++IR ++ EA RL + ++ +L  Y+ +
Sbjct: 4   PEFWVAIAFVIF-AALVWKKASAAIGTLLDGRAERIRGELDEAERLHKDAQALLNGYQSR 62

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  ++E   ++  A+  A  L  +   ++E            +I   +  A   +    
Sbjct: 63  LADAQKEAEAVMAHAREEAARLRTQAATDLEASLKRREAQAMDRIAQAEAAALAEVRNLT 122

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            D ++   + +++  +       + E++I  +
Sbjct: 123 VDVAIGASQRVLAGGLPAAQADKLIEQSIGEL 154


>gi|257790795|ref|YP_003181401.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|317488493|ref|ZP_07947044.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
 gi|257474692|gb|ACV55012.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|316912425|gb|EFV33983.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
          Length = 206

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  + + I L IV+         + L+     I+D + ++ + R +SE +L +YK +
Sbjct: 49  AEFIPMLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKSEQARVESERVLEEYKRQ 108

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
               + +  +I+  AK   + +  +     +  +   ++     I   K  A   L   +
Sbjct: 109 LEDAKAQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHNAIEAEKKAAISELQGSV 168

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD SV +   +I + +ND  +  I E+ ++   S
Sbjct: 169 ADLSVSVASRLIGEDLNDAEHRKIIERYVNEAGS 202


>gi|254713046|ref|ZP_05174857.1| F0F1 ATP synthase subunit B' [Brucella ceti M644/93/1]
 gi|254716601|ref|ZP_05178412.1| F0F1 ATP synthase subunit B' [Brucella ceti M13/05/1]
 gi|261218400|ref|ZP_05932681.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261320751|ref|ZP_05959948.1| ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|260923489|gb|EEX90057.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293441|gb|EEX96937.1| ATP synthase subunit B [Brucella ceti M644/93/1]
          Length = 208

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIADYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++    +    S   +
Sbjct: 178 TTATIVEQLLGLTADKASVSEAVK 201


>gi|258517238|ref|YP_003193460.1| ATP synthase F0, B subunit [Desulfotomaculum acetoxidans DSM 771]
 gi|257780943|gb|ACV64837.1| ATP synthase F0, B subunit [Desulfotomaculum acetoxidans DSM 771]
          Length = 165

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 69/155 (44%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T    +   I L+I + +     L++ ++     I + +  A   R+K+E +   Y 
Sbjct: 7   INATLFAQIFNFIILLIFLRIVAWKPLINMIEQRQKHIENTVNAAEDERKKAEELRASYL 66

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  + +E  ++II  A   A+   ++     +  S    ++   +I   K +A   L  
Sbjct: 67  AEMQRSKEGAQQIIADANKAAEAQKDQIIAAAKAESERIKENATAEIQREKEKAVAELRE 126

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           ++A  ++ +  +++SQK+ +D+  S+ ++ I    
Sbjct: 127 QVASLAILVAGKVVSQKITEDLQHSMVQEFIKEAG 161


>gi|312794891|ref|YP_004027813.1| ATP synthase B chain [Burkholderia rhizoxinica HKI 454]
 gi|312166666|emb|CBW73669.1| ATP synthase B chain (EC 3.6.3.14) [Burkholderia rhizoxinica HKI
           454]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M + + L       +   L+S LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLIAQMVVFLILAWFTMKFVWPPLISALDERAKKIADGLAAADKGKTELEAAHKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ +    E ++ +  A+ RA+++A+E  +N +  +A  +   + +     ++ +  L
Sbjct: 61  IDQELANARNEGQQRVAEAEKRAQLMADEIKRNAQAEAARIIAQAKAEAEQQVVKVRDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
              +A  +V+   +I+ ++++ + +  +  +  + +
Sbjct: 121 RGDVAALAVKGAEQILKREIDQNAHVELLNQLKAEL 156


>gi|300313650|ref|YP_003777742.1| F0F1-type ATP synthase subunit b [Herbaspirillum seropedicae SmR1]
 gi|300076435|gb|ADJ65834.1| F0F1-type ATP synthase, subunit b protein [Herbaspirillum
           seropedicae SmR1]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +    +   L       +   L+  LD  A KI D +  A R +        +
Sbjct: 1   MNLNATLIAQFVVFFILAGFTMKFVWPPLIKALDERAKKIADGLAAADRGKADLAAAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + + +   +E ++ I  A+ RA+++ EE  +   + +A  + +          +A+  L
Sbjct: 61  IQGELASARDEGQKRIGEAEKRAQLIIEEAKKTAAEEAARIVANARADAQQQVNQAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N   ++ +  +  + +
Sbjct: 121 RGQVATLAVKGAEQILKREVNAAAHADLLNQLKTEL 156


>gi|257064831|ref|YP_003144503.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
 gi|256792484|gb|ACV23154.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
          Length = 203

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 72/156 (46%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            +E   + ++ II  +I+       I    L+     IR+D+  A   R +SE IL +YK
Sbjct: 45  MNEFIPMLVAFIILWIILAKFG-WPIFDGMLEKRESTIRNDLKNAEEARMESERILAEYK 103

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++ + E  +I+  AK   + +  +     +  +   ++     I   K  A   L  
Sbjct: 104 QQLAEAKAEASQIVANAKKAGEDVKADITAKAQVEADGMIEKARAAIEAEKKAAIADLQG 163

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +AD SVE+  ++I   ++DD + +I ++ +  + S
Sbjct: 164 SVADISVEVASKVIGTDLSDDEHRAIIKRYVEEVGS 199


>gi|227892674|ref|ZP_04010479.1| F0F1 ATP synthase subunit B [Lactobacillus ultunensis DSM 16047]
 gi|227865545|gb|EEJ72966.1| F0F1 ATP synthase subunit B [Lactobacillus ultunensis DSM 16047]
          Length = 169

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I + ++V       +   ++    K+ +D+  A   R+K+E +  + +     
Sbjct: 20  WYLICFAILM-LLVKHYAWGPVSDMMEKRRQKVINDLDAAASDRKKAETLANEREAALKN 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A      ++AD 
Sbjct: 79  SRQEATQILSDAKSNAQNTGKEIVASANEDAAAIRKKANEEAAKAKTDALNSARDQVADI 138

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           SV I  ++I++ ++ +    + ++ I  + 
Sbjct: 139 SVAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|332828936|gb|EGK01619.1| ATP synthase subunit B [Dysgonomonas gadei ATCC BAA-286]
          Length = 166

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 67/150 (44%), Gaps = 2/150 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  I   I+     P ++   +D   + I+D +  A +  E+   I  +  E  +
Sbjct: 12  FWMLLSFGIVFFILAKFGFP-VITKMVDERKNYIQDSLDAAHKANEQLAKIKEKSDELLN 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + E  +I+  A      +  E  +  +   A  L+++ ++I   K +A R +  ++A+
Sbjct: 71  SAKAEQVKILKDAADTRDRIVNEAREQAKVAGAKELEEIRKQIQAEKEQAIRDIRRQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISS 155
            SV++  +++ + + +     S+ ++ +  
Sbjct: 131 LSVDVAEKVLRESLKDPKAQMSMIDRLVDE 160


>gi|144898768|emb|CAM75632.1| ATP synthase B chain precursor [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 176

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 74/153 (48%), Gaps = 1/153 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D  F V ++    +  + +  +   L + LDA A KI+  + EA RLRE+++ +L  Y+ 
Sbjct: 20  DAAFWVGVAFF-LVAGLAFKPVFRALGAGLDARAAKIKARLDEAARLREEAQEMLATYQR 78

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K     +E  EII  AK  A+ LA++  ++++            +I   +  A R +   
Sbjct: 79  KQRDAMKEAEEIIAHAKAEAERLAQQAAKDLDASLKRREAQAMDRIAQAEAAALREVQNV 138

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             + ++   R++++  ++ D  + + +K I+ +
Sbjct: 139 AVEVAINAARDVLASSISADQAAKLVDKAIAEL 171


>gi|190890578|ref|YP_001977120.1| ATP synthase, subunit B [Rhizobium etli CIAT 652]
 gi|218509939|ref|ZP_03507817.1| F0F1 ATP synthase subunit B [Rhizobium etli Brasil 5]
 gi|226694451|sp|B3PRF9|ATPF_RHIE6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190695857|gb|ACE89942.1| ATP synthase protein, subunit B [Rhizobium etli CIAT 652]
 gi|327190881|gb|EGE57940.1| ATP synthase protein, subunit B [Rhizobium etli CNPAF512]
          Length = 163

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 93/159 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 4   HLDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 63

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  +  +  E+  A      EQKI   + EA + + 
Sbjct: 64  QRKRKEAEAEAAHIVAAAEREAEMLTADAKKKTEEFVANRTALSEQKILQAEAEAMKAVR 123

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +   D ++     +++++ +  V S +F   +S +++  
Sbjct: 124 SAAVDLAIAAAETVLAKQADAKVQSELFGNAVSQVKTRL 162


>gi|295095363|emb|CBK84453.1| ATP synthase F0 subcomplex B subunit [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 154

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 63/154 (40%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L      I  V      +   L++ ++    +I D +  A R ++  +       
Sbjct: 1   MNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANAT 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L  
Sbjct: 61  DQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVTQAQAEIEAERKRAREELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 QVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 154


>gi|332637154|ref|ZP_08416017.1| ATP synthase B chain [Weissella cibaria KACC 11862]
          Length = 171

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 64/152 (42%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++ ++ + +++       ++  +++ ADK+  D+  A   R+++E    +   +  
Sbjct: 20  LFVLVAFLVLM-LLIKHFAWGPVVKMMESRADKVSRDLDSAEEARKQAEADAAERSAQLQ 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   II  AK  A    ++   +    +         +I   + EA   +   +A+
Sbjct: 79  TARTDANGIIADAKTAAGKQRDQIVADAHAAAQATKDQASAQIEQERAEAMAGVKNDVAE 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I ++II +++  D   ++ +  I  + +
Sbjct: 139 LSVSIAQKIIQKELKLDDQKALIDAYIEGLGN 170


>gi|258622938|ref|ZP_05717953.1| ATP synthase F0, B subunit [Vibrio mimicus VM573]
 gi|258625005|ref|ZP_05719928.1| ATP synthase F0, B subunit [Vibrio mimicus VM603]
 gi|262166766|ref|ZP_06034503.1| ATP synthase B chain [Vibrio mimicus VM223]
 gi|262172745|ref|ZP_06040423.1| ATP synthase B chain [Vibrio mimicus MB-451]
 gi|258582703|gb|EEW07529.1| ATP synthase F0, B subunit [Vibrio mimicus VM603]
 gi|258584721|gb|EEW09455.1| ATP synthase F0, B subunit [Vibrio mimicus VM573]
 gi|261893821|gb|EEY39807.1| ATP synthase B chain [Vibrio mimicus MB-451]
 gi|262026482|gb|EEY45150.1| ATP synthase B chain [Vibrio mimicus VM223]
          Length = 154

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQAIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    E+I  A  R   + +E  +  +      L   + +I   +  A+  L  
Sbjct: 61  DQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQADAEIEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKILERSIDKDAHKDILDNITAKL 154


>gi|220905446|ref|YP_002480758.1| H+transporting two-sector ATPase B/B' subunit [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
 gi|219869745|gb|ACL50080.1| H+transporting two-sector ATPase B/B' subunit [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 193

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 59/149 (39%), Gaps = 1/149 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +IF  I+ Y  +  +   F     + I   +      R +++  L   + + ++
Sbjct: 43  WRVLNFVIFAGILWYF-VGGLAKRFFKNRRETIGGALDNLEERRARAKEQLAAVESRIAR 101

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
           + EE   I+  ++ +A+ L     +   + +A  ++                + A IAD 
Sbjct: 102 LNEEREAILAESRKQAENLKAGIVEEAHRQAAQIVEQARMTAENEGRTVLAEVRAVIADE 161

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
            V+   + +S K+N D +  +   ++  +
Sbjct: 162 IVDAAEKALSGKLNADAHDKLIANSLKKV 190


>gi|261867028|ref|YP_003254950.1| F0F1 ATP synthase subunit B [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412360|gb|ACX81731.1| ATP synthase F0, B subunit [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 68/156 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   ++  ++    +I + +  A   +++  +    
Sbjct: 1   MNLNATLIGQLISFALFVWFCMKFVWPPIIKAIETRQSQIANALASAEVAKKEQADTKAL 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ SK + + +EI+  A  R   + +E     E++ A  ++    ++   +   +  L
Sbjct: 61  VEQEISKAKIQAQEILDDANKRRNEVLDEVKNEAEELKAKIIEQGYAEVEAERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +V    +I+ + +++  N+ I +K ++ +
Sbjct: 121 RVKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156


>gi|227529633|ref|ZP_03959682.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus vaginalis
           ATCC 49540]
 gi|227350423|gb|EEJ40714.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus vaginalis
           ATCC 49540]
          Length = 172

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 62/146 (42%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           +   I L++++       +   +   ADKI  DI  A + RE +E +  + + +     +
Sbjct: 22  IVTFIILMLLIKHFAWKPVTDMMKKRADKIASDIDNAAKSRENAEKMAAKRQAELQNSHQ 81

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  +I+  AK   +    +  +  +  +    +  ++     + +A       +A+ S+E
Sbjct: 82  EAADIVNNAKKSGEAQRTQIVEAAQNDAQALKQRAQEDAKQARRDALNGAKDDVANLSIE 141

Query: 131 IVREIISQKMNDDVNSSIFEKTISSI 156
           I  ++I +++N D    + +  I  +
Sbjct: 142 IASKLIHKELNADDQKELIDSYIEGL 167


>gi|307294417|ref|ZP_07574261.1| H+transporting two-sector ATPase B/B' subunit [Sphingobium
           chlorophenolicum L-1]
 gi|306880568|gb|EFN11785.1| H+transporting two-sector ATPase B/B' subunit [Sphingobium
           chlorophenolicum L-1]
          Length = 208

 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 70/155 (45%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D T  V +++ +F++I+V  ++P ++   LD    +I+  + EA +LR ++E +  +Y+
Sbjct: 51  MDATAWVSLAMAVFILILVIKKVPGLIGGALDGRIAQIKTQLEEASKLRAEAEALKAEYE 110

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K +    E   +  +A+H A  L E+   N   + +   K  E KI   +  A   +  
Sbjct: 111 AKLTAAAGEADAMRKSAEHEAATLLEDAKTNAAALVSRRQKMAEDKIGAAERSAIADIRT 170

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K    +      +I+Q  +   +  + +  I  + 
Sbjct: 171 KAVRAATSAAASLIAQGHDAKADKLLVDDAIKGLG 205


>gi|319899221|ref|YP_004159314.1| ATP synthase, B chain [Bartonella clarridgeiae 73]
 gi|319403185|emb|CBI76744.1| ATP synthase, B chain [Bartonella clarridgeiae 73]
          Length = 164

 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 94/159 (59%), Gaps = 2/159 (1%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           TF  F+ L++FL +++Y  +P++L   LDA A +I+D++ EA RLRE+++ IL +Y+ KH
Sbjct: 4   TFWAFIGLVLFLALLIYFEVPAMLTRKLDARAKRIKDELDEALRLREEAQEILAEYQRKH 63

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            ++E+ET+EII  A+   + +  E     ++      K  EQKI   +  A R++ +   
Sbjct: 64  LEIEKETQEIIAEAQREIEAVLIETRVKTDEYIKSRNKLAEQKIAQAEANAVRMVASSAI 123

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDK 164
           D +V     +I+++++ +  +S+ ++++  ++   +  K
Sbjct: 124 DLAVSAANTLITKELDAEQANSLIKESL--VKESLKKVK 160


>gi|182435960|ref|YP_001823679.1| F0F1 ATP synthase subunit B [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|226695879|sp|B1W0A7|ATPF_STRGG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|178464476|dbj|BAG18996.1| putative ATP synthase B chain [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 189

 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 17/156 (10%), Positives = 63/156 (40%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +   I   +     +P ++   L+   + I   I +A   + +++++L QYK + ++
Sbjct: 33  IGLICFGIVFFVFSKKLLP-VINKTLEERREAIEGGIEKAESAQIEAQSVLEQYKAQLAE 91

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +  ++ +E     ++     +     +I   +  A   L   +   
Sbjct: 92  ARHEAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKL 151

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S   ++ +  +++  + 
Sbjct: 152 ATDLAGKLVGESLQDHARQSGTVDRFLDELEAKAEA 187


>gi|303256389|ref|ZP_07342403.1| ATP synthase F0, B subunit [Burkholderiales bacterium 1_1_47]
 gi|331001484|ref|ZP_08325102.1| ATP synthase F0, B subunit [Parasutterella excrementihominis YIT
           11859]
 gi|302859880|gb|EFL82957.1| ATP synthase F0, B subunit [Burkholderiales bacterium 1_1_47]
 gi|329568213|gb|EGG50030.1| ATP synthase F0, B subunit [Parasutterella excrementihominis YIT
           11859]
          Length = 156

 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T  V M++      +    I   L   ++    KI D +  A R     E    +
Sbjct: 1   MNINATLFVQMAVFFVGAWITMKFIWPPLNRAIEERQKKIADGLAAADRGEHALEEAKKE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                +    +++ I+   + R + + EE     +  +   +     +       A+  L
Sbjct: 61  GASIEAAARAQSQVIVAQGEKRGQAIIEEAKAQAQVEADKIIAAARAQAAQEVQSARDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ ++++   +  + ++  + +
Sbjct: 121 RDQVAQLAVSGASQILGKEVDASAHQQLLDQLKAKL 156


>gi|260102576|ref|ZP_05752813.1| ATP synthase F0 [Lactobacillus helveticus DSM 20075]
 gi|260083603|gb|EEW67723.1| ATP synthase F0 [Lactobacillus helveticus DSM 20075]
          Length = 169

 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               +   I L +++       +   ++    K+ +D+  A   R+K+E +  + +    
Sbjct: 19  LWYLICFAILL-LLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANEREAALK 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A      ++AD
Sbjct: 78  NSRQEATKILSDAKANAQKTGKEIVASANEYAAAIRKKANEEAAKAKSDALDSARDQVAD 137

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            S+ I  ++I++ ++ +    + ++ I  + 
Sbjct: 138 ISLAIAEKVIAKNLSAEDQKDLVDQFIKELD 168


>gi|167762920|ref|ZP_02435047.1| hypothetical protein BACSTE_01284 [Bacteroides stercoris ATCC
           43183]
 gi|167699260|gb|EDS15839.1| hypothetical protein BACSTE_01284 [Bacteroides stercoris ATCC
           43183]
          Length = 166

 Score = 79.5 bits (194), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 65/151 (43%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  AR+   +   +  +     +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEERRAYIDQSLEVARQANAQLAKLKEESDALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  ++ E ++   L D++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRIMREAMHERDKIIVEARKHAEALAQKELDDVKQQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSI 156
            SV+I  +II   ++ +     + ++ +  +
Sbjct: 131 LSVDIAEKIIRHNLDKEQDQMEMIDRMLDEM 161


>gi|306842325|ref|ZP_07474984.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
 gi|306845018|ref|ZP_07477599.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306274650|gb|EFM56439.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306287541|gb|EFM59000.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
          Length = 208

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++  K +    S   +
Sbjct: 178 TTATIVEQLLGLKADKASVSEAVK 201


>gi|261213279|ref|ZP_05927561.1| ATP synthase B chain [Vibrio sp. RC341]
 gi|260837553|gb|EEX64256.1| ATP synthase B chain [Vibrio sp. RC341]
          Length = 154

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQALAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L  
Sbjct: 61  DQLKEAKRTATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +II + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKIIERSIDKDAHKDILDNITAKL 154


>gi|254293423|ref|YP_003059446.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
 gi|254041954|gb|ACT58749.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
          Length = 204

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 43/158 (27%), Positives = 82/158 (51%), Gaps = 1/158 (0%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D TF   ++++IFL I+V+ +IP+ +   LD  A KI+D++  AR LREK++  L + + 
Sbjct: 46  DPTFWATIAVLIFLGILVWKKIPATIAKSLDDRAQKIQDELDNARLLREKAQAALAEAER 105

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
             ++ EE+ + I+ AAK  AK  A+    ++++      K  E++I   + EA + +   
Sbjct: 106 SQAQAEEDAKAIVAAAKAEAKAFADTSRADLKERMERREKMAEERIARAEAEATQAVRNT 165

Query: 124 IADFSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCH 160
            A+ +      I+ +         S+FE ++  I+   
Sbjct: 166 AAEAASAAAAGILRESTAKGPAKKSLFETSLEDIKKSL 203


>gi|171742079|ref|ZP_02917886.1| hypothetical protein BIFDEN_01184 [Bifidobacterium dentium ATCC
           27678]
 gi|283456795|ref|YP_003361359.1| ATP synthase subunit B [Bifidobacterium dentium Bd1]
 gi|306822062|ref|ZP_07455446.1| ATP synthase F0 sector subunit B [Bifidobacterium dentium ATCC
           27679]
 gi|309802600|ref|ZP_07696704.1| ATP synthase F0, B subunit [Bifidobacterium dentium JCVIHMP022]
 gi|171277693|gb|EDT45354.1| hypothetical protein BIFDEN_01184 [Bifidobacterium dentium ATCC
           27678]
 gi|283103429|gb|ADB10535.1| ATP synthase B chain [Bifidobacterium dentium Bd1]
 gi|304554662|gb|EFM42565.1| ATP synthase F0 sector subunit B [Bifidobacterium dentium ATCC
           27679]
 gi|308220664|gb|EFO76972.1| ATP synthase F0, B subunit [Bifidobacterium dentium JCVIHMP022]
          Length = 173

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 67/156 (42%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y+ + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  TARVEASKIRDDARAEASHIIADARSRAESDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            +  +  +I+  K+ NDDV SS+ ++ I+ + S  +
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDRMIADMDSDKK 173


>gi|15964590|ref|NP_384943.1| F0F1 ATP synthase subunit B' [Sinorhizobium meliloti 1021]
 gi|307309336|ref|ZP_07588999.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti BL225C]
 gi|307320072|ref|ZP_07599493.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti AK83]
 gi|81635006|sp|Q92RM6|ATPX_RHIME RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|15073768|emb|CAC45409.1| Probable ATP synthase subunit B' transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306894287|gb|EFN25052.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti AK83]
 gi|306900205|gb|EFN30823.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti BL225C]
          Length = 204

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 68/146 (46%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + IP  +   L+   D+I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 57  LWLAITFGLFYLLMSKVIIPR-IGGILETRHDRIAQDLDEASRLKGEADAAIAAYEQELA 115

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  A+     +E   A  +   E +I  +K +A   + A   +
Sbjct: 116 GARAKGHSIADTAREAAKAKAKADRDGVEAGLAKKIAAAEARIADIKSKALADVGAIAEE 175

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            +  +V+++I   +     ++ F+ +
Sbjct: 176 TATAVVKQLIGGTVTKAEIAAAFKAS 201


>gi|260222688|emb|CBA32497.1| ATP synthase subunit b [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 156

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T  +   +   LV      +   +   LD  A KI D +  A + + +  N   +
Sbjct: 1   MNINATLFLQAIVFAILVWFTMKFVWPPITKALDERAQKIADGLAAADKAKAELANANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + + +    ET   +  A+ RA+ + EE      +     +   + +     ++A+  L
Sbjct: 61  VEAELATSRNETATRLADAERRAQTIVEEAKARAVEEGNRIIAAAKAEAEQQSVKARDAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILRKEVNAGVHADLLSRLKTEL 156


>gi|289209750|ref|YP_003461816.1| ATP synthase F0 subunit beta [Thioalkalivibrio sp. K90mix]
 gi|288945381|gb|ADC73080.1| ATP synthase F0, B subunit [Thioalkalivibrio sp. K90mix]
          Length = 156

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   + + L+    KI D +  A R  ++ E    +
Sbjct: 1   MNINLTIIGQLLAFAVFVWFTMRYVWPPMSAALEERRKKIADGLAAAERGEKEQELAQER 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + +++  EI+ +A+ RA  L EE      +      +    +I      AK  L
Sbjct: 61  ATAVIKEAKQQANEIMASAQKRATELVEESKTTAREEGERIKEQAHSEIEQEINRAKEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V    +I++++++   +  + +K  + +
Sbjct: 121 RKQVSQLAVAGAEQILAKEIDAKAHGDLLKKLAAKL 156


>gi|90581147|ref|ZP_01236946.1| ATP synthase subunit B [Vibrio angustum S14]
 gi|90437668|gb|EAS62860.1| ATP synthase subunit B [Vibrio angustum S14]
          Length = 156

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V+     +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLLGQAIAFFLFVVFCMKYVWPPIMEAIEERQKKIADGLAAADRAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E     +      L     +I   +  A+  L
Sbjct: 61  ASDQLKEAKRAASELIEQANKRKAQIIDEAKTEAQTEREKILAQGMAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + ++ D  + I  K  + +
Sbjct: 121 RKQVATLAVIGAEKIIERSIDVDAQADILNKVTAEL 156


>gi|327183288|gb|AEA31735.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1118]
          Length = 169

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I L ++V       +   ++    K+ +D+  A   R+K+E +  + +     
Sbjct: 20  WYLICFAILL-LLVKHYAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANEREAALKN 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A      ++AD 
Sbjct: 79  SRQEATQILSDAKTNAQNTGKEIVASANEDAAAIRKKANEEAAKAKSDALNAARDQVADI 138

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           S+ I  ++I++ ++ +    + ++ I  + 
Sbjct: 139 SIAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|148272345|ref|YP_001221906.1| F0F1 ATP synthase subunit B [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|226741358|sp|A5CQ56|ATPF_CLAM3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|147830275|emb|CAN01209.1| ATP synthase B chain (Subunit I) [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 188

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/140 (14%), Positives = 63/140 (45%), Gaps = 1/140 (0%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAK 80
           ++      + + LD   + I   I +A R + +++    +   + ++   E   I   A+
Sbjct: 39  IWKYALPRVYAMLDGRTEAIAGGIEKAERAQAEADAAKAELTAQLAEARAEAGRIREQAR 98

Query: 81  HRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKM 140
             A  +A E  +     +A      +Q+I   + +A   L +++   ++++   +I Q +
Sbjct: 99  VDATAIAAEIKEQATADAARITASAQQQIEAERQQAVVSLRSEVGSLAIDLASGVIGQSL 158

Query: 141 -NDDVNSSIFEKTISSIQSC 159
            +D  ++++ ++ ++ +++ 
Sbjct: 159 TDDQRSTALVDRFLADLEAS 178


>gi|195977923|ref|YP_002123167.1| F0F1 ATP synthase subunit B [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|226695877|sp|B4U2D7|ATPF_STREM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|195974628|gb|ACG62154.1| ATP synthase B chain AtpF [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 164

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 62/153 (40%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + + L A + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQQLEKEGQANLE 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I+ AAK   K           + +          I + K EA   +  +++D
Sbjct: 72  ASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAVALTDIEHSKSEAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + ++ +  +   
Sbjct: 132 LTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA 164


>gi|227877277|ref|ZP_03995350.1| F0F1 ATP synthase subunit B [Lactobacillus crispatus JV-V01]
 gi|256842840|ref|ZP_05548328.1| ATP synthase F0, B subunit [Lactobacillus crispatus 125-2-CHN]
 gi|256848796|ref|ZP_05554230.1| H+-transporting ATP synthase chain b [Lactobacillus crispatus
           MV-1A-US]
 gi|262045806|ref|ZP_06018770.1| ATP synthase F0, B subunit [Lactobacillus crispatus MV-3A-US]
 gi|293381675|ref|ZP_06627656.1| ATP synthase F0, B subunit [Lactobacillus crispatus 214-1]
 gi|295692629|ref|YP_003601239.1| ATP synthase subunit b [Lactobacillus crispatus ST1]
 gi|312977640|ref|ZP_07789387.1| ATP synthase F0, B subunit [Lactobacillus crispatus CTV-05]
 gi|227863133|gb|EEJ70579.1| F0F1 ATP synthase subunit B [Lactobacillus crispatus JV-V01]
 gi|256614260|gb|EEU19461.1| ATP synthase F0, B subunit [Lactobacillus crispatus 125-2-CHN]
 gi|256714335|gb|EEU29322.1| H+-transporting ATP synthase chain b [Lactobacillus crispatus
           MV-1A-US]
 gi|260573765|gb|EEX30321.1| ATP synthase F0, B subunit [Lactobacillus crispatus MV-3A-US]
 gi|290921722|gb|EFD98743.1| ATP synthase F0, B subunit [Lactobacillus crispatus 214-1]
 gi|295030735|emb|CBL50214.1| ATP synthase subunit B [Lactobacillus crispatus ST1]
 gi|310895379|gb|EFQ44446.1| ATP synthase F0, B subunit [Lactobacillus crispatus CTV-05]
          Length = 168

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I + +++       +   ++    K+ DD+  A   R+K+E +  + +     
Sbjct: 19  WYLICFAILM-LLIKHFAWGPVSDMMEKRRQKVIDDLDSAASERKKAETLANEREAALKN 77

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I+  AK  A+  ++E   N  + +A   K   +     K +A      ++AD 
Sbjct: 78  SRQEATQILSDAKSNAQNTSKEIVANANEDAAAIRKKANEDAAQAKADALNSARDQVADI 137

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           SV I  ++I++ ++      + ++ I  + 
Sbjct: 138 SVAIAEKVIAKNLSAKDQKDLVDQFIKGLD 167


>gi|237714630|ref|ZP_04545111.1| ATP synthase B subunit [Bacteroides sp. D1]
 gi|262406495|ref|ZP_06083044.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_22]
 gi|294646113|ref|ZP_06723776.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CC 2a]
 gi|294808292|ref|ZP_06767050.1| ATP synthase F0, B subunit [Bacteroides xylanisolvens SD CC 1b]
 gi|229445399|gb|EEO51190.1| ATP synthase B subunit [Bacteroides sp. D1]
 gi|262355198|gb|EEZ04289.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_22]
 gi|292638557|gb|EFF56912.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CC 2a]
 gi|294444511|gb|EFG13220.1| ATP synthase F0, B subunit [Bacteroides xylanisolvens SD CC 1b]
          Length = 167

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSKLKQEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQMEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + D    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKSLEDKDAQMGMIDRMLDEV 161


>gi|209696447|ref|YP_002264378.1| F0F1 ATP synthase subunit B [Aliivibrio salmonicida LFI1238]
 gi|226694433|sp|B6EHU1|ATPF_ALISL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|208010401|emb|CAQ80747.1| ATP synthase B chain [Aliivibrio salmonicida LFI1238]
          Length = 156

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 56/156 (35%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLLGQAIAFALFVWFCMKYVWPPIMEAIEERQKKIADGLSAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +         L   E ++   +  A+  L
Sbjct: 61  ASDQLKEAKRAATEIIEQANKRKGQILDEAREEALTERQNILTQGEAELETERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + +N +    I +   + +
Sbjct: 121 RKQVATLAVIGAEKILERSINLEAQKDILDNITAKL 156


>gi|332533714|ref|ZP_08409573.1| ATP synthase B chain [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036878|gb|EGI73339.1| ATP synthase B chain [Pseudoalteromonas haloplanktis ANT/505]
          Length = 156

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V+     +   L   ++A   KI D +  + R  +  E    +
Sbjct: 1   MNLNATLIGELIAFTVFVLFCMKYVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+    + +  +II  AK RA ++ +E     +Q     +     ++   +      L
Sbjct: 61  AAEQLKDAKAQAADIIDQAKKRAVLIVDEETLRGQQERESIIAQGHSEVESERNRITEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V     I+ +++N   +S I EK ++ +
Sbjct: 121 RKQVATLAVIGAERILEREINQAAHSDIVEKLVAEL 156


>gi|163743800|ref|ZP_02151173.1| ATP synthase F0, B subunit [Phaeobacter gallaeciensis 2.10]
 gi|161382949|gb|EDQ07345.1| ATP synthase F0, B subunit [Phaeobacter gallaeciensis 2.10]
          Length = 186

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P +L   LDA A+ I+ D+ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTDFVVTLAFLLFVGILLYAKVPGLLGGQLDARAEGIKKDLEEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   A++   ++E   A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVQAQADRIVASAREDAAKAADQAKADLEISIARRMTAAEEQITAAQDSAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++     +IS++M     + + +  I+ + +  
Sbjct: 149 AITVAIAAADAVISKQMTATEANKLIDAAIADVDAKL 185


>gi|71891797|ref|YP_277526.1| F0F1 ATP synthase subunit B [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|123641228|sp|Q494C7|ATPF_BLOPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71795903|gb|AAZ40654.1| ATP synthase, F0 sector, subunit b [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 160

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V      +    +S ++    +I D++  A   + +SE +  +
Sbjct: 1   MNLNATILGQTISFVLFVWFCMKYVWYPFISIIEKRQKEISDNLVSATHAKTESERVNAE 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 +   + +EII  A      +  E     E+  +  L    ++I Y +      L
Sbjct: 61  ALLCLRQARVKAQEIIKQANKCKMQIINEAKHEAEKEQSRILSQAREQIIYERKRVTDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +I++  +E   ++I   +N+ ++  +    I+++
Sbjct: 121 RKQISELVIEGTEKVIEHSINEMIDIDLLNNIINTL 156


>gi|257454334|ref|ZP_05619597.1| ATP synthase F0, B subunit [Enhydrobacter aerosaccus SK60]
 gi|257448237|gb|EEV23217.1| ATP synthase F0, B subunit [Enhydrobacter aerosaccus SK60]
          Length = 156

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V+     +   L++ +     KI D +  A + +         
Sbjct: 1   MNINATLIGQSIAFAIFVMFCMKFVWPPLVAAISDRQRKIADGLNAAEKAKADLATASQA 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++    + +   +I  A   A  + E+     +       +   + I     +A+  L
Sbjct: 61  AEQELIAAKAKAASLIDQANKSANQMIEDARVQAQVEGERIRQQAREAIDQEINKAREGL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A+ +V    +I+ +K+N + ++++  +  + +
Sbjct: 121 RAQVAELAVLGAEKILQEKVNPETHANMLNQLATKL 156


>gi|254483167|ref|ZP_05096400.1| ATP synthase F0, B subunit [marine gamma proteobacterium HTCC2148]
 gi|214036538|gb|EEB77212.1| ATP synthase F0, B subunit [marine gamma proteobacterium HTCC2148]
          Length = 146

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 56/143 (39%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I  V+     +   +++ +     KI D +  A R     E    +  E+  + +EE  
Sbjct: 4   FICFVVFCMKYVWPPIIAAMSEREQKIADGLAAADRASHDLELAKEKAVERLKEAKEEAS 63

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            II +A  RA  L EE        +       + +I      A+  L  ++A  S+    
Sbjct: 64  GIIDSANKRAGQLVEEAKDAAVVEADRVKASAQAEIEQETNRAREQLRGQVAALSLAGAE 123

Query: 134 EIISQKMNDDVNSSIFEKTISSI 156
           +++   ++ + ++ + EK  S +
Sbjct: 124 KVLGSAIDQEAHNELVEKLASEL 146


>gi|241895229|ref|ZP_04782525.1| H(+)-transporting ATPase F(0) B subunit [Weissella
           paramesenteroides ATCC 33313]
 gi|241871535|gb|EER75286.1| H(+)-transporting ATPase F(0) B subunit [Weissella
           paramesenteroides ATCC 33313]
          Length = 171

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++ ++ ++++        ++  ++  A+K+  D+  A   R+++E +  +  E+  
Sbjct: 20  LFVLVAFLVLMLLL-KKYAWGPVVKMMEKRAEKVAHDLDTAEEARQQAEEMAAKRSEQLQ 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I+  AK  A    ++   + +  +    +    +I   + EA   + +++A+
Sbjct: 79  SARTEANSIVSDAKTAAGKQRDQIVADAQADAQATKEQASAQIAQERSEAMADVKSEVAE 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            SV I ++II +++  D   ++ +  I  + +
Sbjct: 139 LSVTIAQKIIQKELKLDDQKALIDAYIEGLGN 170


>gi|256825633|ref|YP_003149593.1| ATP synthase F0 subcomplex B subunit [Kytococcus sedentarius DSM
           20547]
 gi|256689026|gb|ACV06828.1| ATP synthase F0 subcomplex B subunit [Kytococcus sedentarius DSM
           20547]
          Length = 192

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/152 (13%), Positives = 61/152 (40%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +++ I   +     +P++         D I   +  A     ++     +Y+ + ++
Sbjct: 32  FGLIAIGIVYYVASKFFVPAM-EKAYAERRDAIEGGMARAEEAEAEARAAQQKYESQLAE 90

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   I   A+     +  E  Q  +  +A  L+  +++I   + +A+  L  ++   
Sbjct: 91  ARAEANAIREKAREEGDAIRAEKRQQADAEAARVLETAQKQIASERQQAQVQLRGEVGRL 150

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           S ++   I+ + + ++     + ++ +S ++S
Sbjct: 151 STDLAGRIVGESLTDETRQKGLVDRFLSELES 182


>gi|225870299|ref|YP_002746246.1| ATP synthase B chain [Streptococcus equi subsp. equi 4047]
 gi|225699703|emb|CAW93431.1| ATP synthase B chain [Streptococcus equi subsp. equi 4047]
          Length = 164

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 62/153 (40%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + + L A + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKAFAWGAIEAVLQARSQQISQDIDQAEQARLNAQQLEKEGQANLE 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I+ AAK   K           + +          I + K EA   +  +++D
Sbjct: 72  ASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAAALTDIEHSKSEAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + ++ +  +   
Sbjct: 132 LTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA 164


>gi|254718568|ref|ZP_05180379.1| F0F1 ATP synthase subunit B' [Brucella sp. 83/13]
 gi|265983543|ref|ZP_06096278.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306837305|ref|ZP_07470188.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
 gi|264662135|gb|EEZ32396.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306407618|gb|EFM63814.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
          Length = 208

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E +I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEGRIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++  K +    S   +
Sbjct: 178 TTATIVEQLLGLKADKASVSEAVK 201


>gi|288550151|ref|ZP_05969465.2| hypothetical protein ENTCAN_08070 [Enterobacter cancerogenus ATCC
           35316]
 gi|288315959|gb|EFC54897.1| ATP synthase F0, B subunit [Enterobacter cancerogenus ATCC 35316]
          Length = 154

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 63/154 (40%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L      I  V      +   L++ ++    +I D +  A R ++  +       
Sbjct: 1   MNATILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANAT 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L  
Sbjct: 61  DQLKKAKAEAQVIIEQANKRRAQILDEAKAEAEQERTKIVTQAQAEIEAERKRAREELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 QVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 154


>gi|320154854|ref|YP_004187233.1| ATP synthase subunit B [Vibrio vulnificus MO6-24/O]
 gi|319930166|gb|ADV85030.1| ATP synthase B chain [Vibrio vulnificus MO6-24/O]
          Length = 154

 Score = 79.5 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 56/154 (36%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R  +  +       
Sbjct: 1   MNATLLGQAISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  + +    EII  A  R   + +E  ++ +      L   E ++   +  A+  L  
Sbjct: 61  SQLKEAKRTATEIIEQANKRKAQILDEAREDAQTERQKILAQAEAQLEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  +V    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAVAGAEKILERSIDKDAHKDILDNITAKL 154


>gi|197132344|gb|ACH47690.1| ATP synthase CF0 subunit I [Geranium macrorrhizum]
          Length = 184

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 59/151 (39%), Gaps = 1/151 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++L + L ++++     +L   LD    KI + I  +  LR  +   L +   +  KV+ 
Sbjct: 32  INLSVVLGVLIFFG-KGVLKDLLDNRKRKILNTIRNSEELRGGAIKQLEKAHARLRKVKT 90

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  +  +    +A+        +  +          + IH+ +  A   +  ++   +++
Sbjct: 91  EVDQFRVNEYSKAERKRSNLITSTYKELERSENLQNESIHFEQQRAINQVRQRVFQQALQ 150

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              EI++  +N +++       I    S  +
Sbjct: 151 GALEILNSCLNKELHLRTISANIGLFGSMKE 181


>gi|68536424|ref|YP_251129.1| F0F1 ATP synthase subunit B [Corynebacterium jeikeium K411]
 gi|260577557|ref|ZP_05845496.1| ATP synthase F0, B subunit [Corynebacterium jeikeium ATCC 43734]
 gi|123650711|sp|Q4JUJ6|ATPF_CORJK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68264023|emb|CAI37511.1| ATP synthase B chain [Corynebacterium jeikeium K411]
 gi|258604281|gb|EEW17519.1| ATP synthase F0, B subunit [Corynebacterium jeikeium ATCC 43734]
          Length = 186

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/152 (12%), Positives = 62/152 (40%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   + L +     +P      L+   D+I   I  A   + +++  L +Y  + ++
Sbjct: 30  WSIIPFAVILFVFWKFVLP-KFQEVLNQREDQIEGGIRRAESAQAEAKAALEKYNAQLAE 88

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +I   A+ + + +  +      + S   ++   +++   +      L  ++ + 
Sbjct: 89  ARTEAAQIRDDARSQGQKIIADMKAQATEESNRIVESGHKQLEAQRSAVVTDLRKEMGEN 148

Query: 128 SVEIVREIISQKMNDDVNSS-IFEKTISSIQS 158
           S+ +   ++ ++++DDV  S   +  ++ + +
Sbjct: 149 SINLAERLLGEQLSDDVKRSGTIDNFLAGLDN 180


>gi|260771031|ref|ZP_05879959.1| ATP synthase B chain [Vibrio furnissii CIP 102972]
 gi|260613920|gb|EEX39111.1| ATP synthase B chain [Vibrio furnissii CIP 102972]
          Length = 154

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQALSFALFVWFCMKYVWPPIIKAIEERQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +   + +    E+I AA  R   + +E  +  +      L   + +I   +  A+  L  
Sbjct: 61  DSLKEAKRTATEVIEAANKRKAQILDEAREEAQAERQKILAQADAEIDAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKILERTIDKDAHKDILDNITAKL 154


>gi|328468720|gb|EGF39702.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus MTCC 5463]
          Length = 169

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/151 (15%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               +   I L +++       +   ++    K+ +D+  A   R+K+E +  + +    
Sbjct: 19  LWYLICFAILL-LLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANEREAALK 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E  +I+  AK  A+   +E   +  + +A   K   ++    K +A      ++AD
Sbjct: 78  NSRQEATKILSDAKANAQKTVKEIVASANEYAAAIRKKANEEAAKAKSDALDSARDQVAD 137

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            S+ I  ++I++ ++ +    + ++ I  + 
Sbjct: 138 ISLAIAEKVIAKNLSAEDQKDLVDQFIKELD 168


>gi|163761009|ref|ZP_02168087.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
 gi|162281790|gb|EDQ32083.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
          Length = 203

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 68/136 (50%), Gaps = 1/136 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + +P  +   L+   D+I  D+ EA RL+E+++  +  Y+++ +
Sbjct: 56  LWLAITFGLFYLLMSRVVVPR-IGGILEHRRDRIAQDLDEANRLKEEADAAIAAYEQELA 114

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +++  I  AA+ +AK  A+      E   +  + D E+ I  +K +A   +     D
Sbjct: 115 EARKKSSAIAEAAREKAKSAADAERAATEAELSAKMADAEKSIAAIKAKALGDVDTIAQD 174

Query: 127 FSVEIVREIISQKMND 142
            + ++V+ ++   +  
Sbjct: 175 TATDLVKHLLGGTVTK 190


>gi|296119528|ref|ZP_06838086.1| ATP synthase F0, B subunit [Corynebacterium ammoniagenes DSM 20306]
 gi|295967411|gb|EFG80678.1| ATP synthase F0, B subunit [Corynebacterium ammoniagenes DSM 20306]
          Length = 189

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +I L++     IP      L    D+I   I  A   + +++  L +Y  + + 
Sbjct: 33  WSLIPFVIILIVFAMFVIP-KFQELLQEREDRIEGGIKRAEAQQAEAKAALEKYNAQLAD 91

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  EI   A+ R K +  E     E+ +   +   E+++   + +    L ++I   
Sbjct: 92  ARAEAAEIREQARERGKQIEAEAKTQAEEEAQRIVAGGEKQLEASRAQVVSELRSEIGQN 151

Query: 128 SVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQMDK 164
           S+ +  +++  ++++    SS  +  +S + S     K
Sbjct: 152 SINLAEKLLGGELSESTKQSSTIDNFLSELDSVASAGK 189


>gi|189465905|ref|ZP_03014690.1| hypothetical protein BACINT_02268 [Bacteroides intestinalis DSM
           17393]
 gi|224539740|ref|ZP_03680279.1| hypothetical protein BACCELL_04649 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189434169|gb|EDV03154.1| hypothetical protein BACINT_02268 [Bacteroides intestinalis DSM
           17393]
 gi|224518640|gb|EEF87745.1| hypothetical protein BACCELL_04649 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 168

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 67/154 (43%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  A+    + + +  + +   +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEGRRTYIDQSLEVAKEANAQLQRLKAESEALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  +  E  +   L D++++I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMHERDKIIVEARKQAEVAAQKELDDVKKQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSC 159
            SV+I  ++I + ++++     + ++ +  + + 
Sbjct: 131 LSVDIAEKVIRKNLDEEHEQMEMIDRMLDEVLAA 164


>gi|255320602|ref|ZP_05361779.1| ATP synthase F0, B subunit [Acinetobacter radioresistens SK82]
 gi|262380765|ref|ZP_06073918.1| ATP synthase F0, B subunit [Acinetobacter radioresistens SH164]
 gi|255302218|gb|EET81458.1| ATP synthase F0, B subunit [Acinetobacter radioresistens SK82]
 gi|262297713|gb|EEY85629.1| ATP synthase F0, B subunit [Acinetobacter radioresistens SH164]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   L++ +     +I D +  A + +    +   Q
Sbjct: 1   MNINLTLIGQAIAFAVFVAFCMKFVWPPLINAISERQRRIADGLNAAEKAKADLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K++    + +  ++I  A  RA  L EE             +  ++ +      A+  L
Sbjct: 61  VKQELDVAKAQAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQAKEAVDQEINSAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I++Q+++   ++++  +  + +
Sbjct: 121 RQQVAALAVSGAEKILNQQVDAQAHNAMLTQLAAKL 156


>gi|23501288|ref|NP_697415.1| F0F1 ATP synthase subunit B' [Brucella suis 1330]
 gi|62289374|ref|YP_221167.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 1 str. 9-941]
 gi|82699299|ref|YP_413873.1| F0F1 ATP synthase subunit B' [Brucella melitensis biovar Abortus
           2308]
 gi|148559980|ref|YP_001258411.1| F0F1 ATP synthase subunit B' [Brucella ovis ATCC 25840]
 gi|161618360|ref|YP_001592247.1| F0F1 ATP synthase subunit B' [Brucella canis ATCC 23365]
 gi|163842668|ref|YP_001627072.1| F0F1 ATP synthase subunit B' [Brucella suis ATCC 23445]
 gi|189023627|ref|YP_001934395.1| F0F1 ATP synthase subunit B' [Brucella abortus S19]
 gi|225626899|ref|ZP_03784938.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237814861|ref|ZP_04593859.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|254688689|ref|ZP_05151943.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 6 str. 870]
 gi|254693172|ref|ZP_05155000.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 3 str. Tulya]
 gi|254696816|ref|ZP_05158644.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701196|ref|ZP_05163024.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 5 str. 513]
 gi|254703741|ref|ZP_05165569.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 3 str. 686]
 gi|254707879|ref|ZP_05169707.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M163/99/10]
 gi|254709537|ref|ZP_05171348.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis B2/94]
 gi|254729723|ref|ZP_05188301.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 4 str. 292]
 gi|256031031|ref|ZP_05444645.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M292/94/1]
 gi|256060523|ref|ZP_05450692.1| F0F1 ATP synthase subunit B' [Brucella neotomae 5K33]
 gi|256159089|ref|ZP_05456915.1| F0F1 ATP synthase subunit B' [Brucella ceti M490/95/1]
 gi|256254434|ref|ZP_05459970.1| F0F1 ATP synthase subunit B' [Brucella ceti B1/94]
 gi|256256936|ref|ZP_05462472.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 9 str. C68]
 gi|256368840|ref|YP_003106346.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260168163|ref|ZP_05754974.1| F0F1 ATP synthase subunit B' [Brucella sp. F5/99]
 gi|260545873|ref|ZP_05821614.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260567004|ref|ZP_05837474.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260754165|ref|ZP_05866513.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757385|ref|ZP_05869733.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761209|ref|ZP_05873552.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883190|ref|ZP_05894804.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213412|ref|ZP_05927693.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|261221602|ref|ZP_05935883.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315370|ref|ZP_05954567.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317063|ref|ZP_05956260.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261324517|ref|ZP_05963714.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751733|ref|ZP_05995442.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261754386|ref|ZP_05998095.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|261757621|ref|ZP_06001330.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265988101|ref|ZP_06100658.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265997566|ref|ZP_06110123.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851767|ref|ZP_06792440.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297247787|ref|ZP_06931505.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
 gi|75505336|sp|Q57EX8|ATPF_BRUAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81753123|sp|Q8G2D9|ATPF1_BRUSU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|123546350|sp|Q2YMC5|ATPF1_BRUA2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694367|sp|B2S9N0|ATPF1_BRUA1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694385|sp|A9M8G0|ATPF1_BRUC2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694387|sp|A5VNW4|ATPF1_BRUO2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694388|sp|B0CK72|ATPF1_BRUSI RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|23347176|gb|AAN29330.1| ATP synthase F0, B subunit, putative [Brucella suis 1330]
 gi|62195506|gb|AAX73806.1| ATP synthase F0, B subunit, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82615400|emb|CAJ10369.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|148371237|gb|ABQ61216.1| putative ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
 gi|161335171|gb|ABX61476.1| ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|163673391|gb|ABY37502.1| ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|189019199|gb|ACD71921.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|225618556|gb|EEH15599.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237789698|gb|EEP63908.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|255998998|gb|ACU47397.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260097280|gb|EEW81155.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260156522|gb|EEW91602.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260667703|gb|EEX54643.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671641|gb|EEX58462.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674273|gb|EEX61094.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872718|gb|EEX79787.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915019|gb|EEX81880.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|260920186|gb|EEX86839.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261296286|gb|EEX99782.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300497|gb|EEY03994.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304396|gb|EEY07893.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737605|gb|EEY25601.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741486|gb|EEY29412.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261744139|gb|EEY32065.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|262552034|gb|EEZ08024.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|264660298|gb|EEZ30559.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|294820356|gb|EFG37355.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297174956|gb|EFH34303.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
          Length = 208

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 68/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV +++    +    S   +
Sbjct: 178 TTATIVEQLLGLTADKASVSEAVK 201


>gi|258647877|ref|ZP_05735346.1| ATP synthase F0, B subunit [Prevotella tannerae ATCC 51259]
 gi|260851709|gb|EEX71578.1| ATP synthase F0, B subunit [Prevotella tannerae ATCC 51259]
          Length = 168

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 64/153 (41%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++  +   ++     P  +   ++   + I + +  AR   E+  N+ ++ +    
Sbjct: 16  FWMLLAFGVVFFLLAKYGFP-AITKAVEERKNYIDESLKNARETNERLANVKVESENILK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+   II  A      +  E     +       ++ +++I   K  A R + +++AD
Sbjct: 75  EAHEQQARIIKEAMATRDNIIAEARNKAQTEGQQLFEEAKKQIVAEKENALRDIRSQVAD 134

Query: 127 FSVEIVREIISQKMN-DDVNSSIFEKTISSIQS 158
            SV I  ++I ++++  +      ++ ++ +  
Sbjct: 135 LSVLIAEKVIRRQLDNAEEQEKYIDRILNDMNK 167


>gi|15963433|dbj|BAB69467.1| H+-ATPase b subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + +  +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAGSKEEAA 83

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            II  A   A     +      +      K  ++ I   + EA   +   +AD SV+I  
Sbjct: 84  NIIQVANDTASQNRAKVLATANRRDTSLKKRAQEDIEQERKEALNTVKGDVADISVQIAE 143

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I Q ++      + +  ++ +  
Sbjct: 144 KLIGQSLDASAQQELIDSYLAKLGE 168


>gi|254382324|ref|ZP_04997684.1| ATP synthase B chain [Streptomyces sp. Mg1]
 gi|194341229|gb|EDX22195.1| ATP synthase B chain [Streptomyces sp. Mg1]
          Length = 179

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/156 (12%), Positives = 65/156 (41%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    +P+ +   L+   ++I   I +A   + +++++L QYK + ++
Sbjct: 23  IGLIAFVIVFGFLAKKLLPN-INKVLEERREQIEGGIEKAEAAQTEAQSVLEQYKAQLAE 81

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A  +   L EE     ++     +     +I   +  A + L   +   
Sbjct: 82  ARHEAARLRQEALEQGTALKEELRAEGQRQREEIIAAGHAQIEADRKAASQALRQDVGKL 141

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S   ++ +S ++   + 
Sbjct: 142 ATDLAGKLVGESLEDAARQSRTIDRFLSELEEKAEA 177


>gi|315178657|gb|ADT85571.1| F0F1 ATP synthase subunit B [Vibrio furnissii NCTC 11218]
          Length = 154

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 57/154 (37%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R ++  +       
Sbjct: 1   MNATLLGQALSFALFVWFCMKYVWPPIIKAIEERQKKIADGLQAAERAKKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +   + +    E+I AA  R   + +E  +  +      L   + +I   +  A+  L  
Sbjct: 61  DSLKEAKRTATEVIEAANKRKAQILDEAREEAQAERQKILAQADAEIEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  I +   + +
Sbjct: 121 QVATLAIAGAEKILERTIDKDAHKDILDNITAKL 154


>gi|297192044|ref|ZP_06909442.1| F0F1 ATP synthase subunit B [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197719506|gb|EDY63414.1| F0F1 ATP synthase subunit B [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 184

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 62/151 (41%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    +P+ +   L+   + I   I +A   + ++E++L QYK + ++
Sbjct: 25  IGLIAFVIVFGFLAKKLLPN-INKVLEERREAIEGGIEKADAAKTEAESVLEQYKAQLAE 83

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A  +   + +E     ++     +     +I   +  A   L   +   
Sbjct: 84  ARHEAARLRQEATEQGTAIIQEMKAEGQRQREEIIAAGHAQIEADRKAAASALRQDVGKL 143

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQ 157
           + ++  +++ + + +    S   ++ + S++
Sbjct: 144 ATDLAGKLVGESLEDHARQSRTIDRFLDSLE 174


>gi|298481156|ref|ZP_06999350.1| ATP synthase F0, B subunit [Bacteroides sp. D22]
 gi|298272730|gb|EFI14297.1| ATP synthase F0, B subunit [Bacteroides sp. D22]
          Length = 167

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSKLKQEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQMEKDEAIRDIRRQVAM 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + D    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKSLEDKDAQMGMIDRMLDEV 161


>gi|187479688|ref|YP_787713.1| F0F1 ATP synthase subunit B [Bordetella avium 197N]
 gi|115424275|emb|CAJ50828.1| ATP synthase B chain [Bordetella avium 197N]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 59/155 (38%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           + + T    M +   L       +   L   +D    KI D +  A + +        + 
Sbjct: 2   NLNATIFFQMLVFFVLGWFTMKFVWPPLTKAIDERRQKIADGLAAAEKGKADLAQAQARV 61

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
               +  + ET   I+ A+ +A  L E+  ++ E   A  +    Q        A+  L 
Sbjct: 62  SLIEASAKSETHARIVDAEKQAAGLIEQARRDAETERARIVAQAAQDAAAEVQRARDALR 121

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 122 DEVAVLAVKGAEQILKREVDARAHAELLNQLKAQL 156


>gi|84393412|ref|ZP_00992169.1| ATP synthase subunit B [Vibrio splendidus 12B01]
 gi|84375928|gb|EAP92818.1| ATP synthase subunit B [Vibrio splendidus 12B01]
          Length = 154

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 56/154 (36%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R  +          
Sbjct: 1   MNATLLGQAIAFSLFVWFCMKYVWPPIMQAIEERQKKIADGLVAAERAAKDLNLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E+  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L  
Sbjct: 61  EQMKEAKRTATEVIDQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERTRARDDLRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ DV++ +     + +
Sbjct: 121 QVATLAIAGAEKILERTIDKDVHNDLLNNITAKL 154


>gi|218130972|ref|ZP_03459776.1| hypothetical protein BACEGG_02574 [Bacteroides eggerthii DSM 20697]
 gi|317476283|ref|ZP_07935533.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|217986844|gb|EEC53176.1| hypothetical protein BACEGG_02574 [Bacteroides eggerthii DSM 20697]
 gi|316907557|gb|EFV29261.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 166

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 68/154 (44%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  AR+   +   +  + +   +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEGRRTYIDQSLEVARQANIQLAKLKEESEALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  ++ E ++   L D++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRIMREAMHERDKIIIEARKHAEAVAQKELDDVKQQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSC 159
            SV+I  +II + +++      + ++ +  + + 
Sbjct: 131 LSVDIAEKIIRRNLDEKHEQMEMIDRMLDEMLAA 164


>gi|159900581|ref|YP_001546828.1| F0F1 ATP synthase subunit B [Herpetosiphon aurantiacus ATCC 23779]
 gi|226741472|sp|A9AVV0|ATPF_HERA2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|159893620|gb|ABX06700.1| ATP synthase F0, B subunit [Herpetosiphon aurantiacus ATCC 23779]
          Length = 164

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 64/153 (41%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
              +  +     L  ++   +   +L+ L A +++IR+ +  A +++++   +   Y+ K
Sbjct: 9   PLLISQIVNFCLLAFLLNTFLYKPVLNALQARSERIRESLDNAEKVKQQLARVDADYEAK 68

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +   E + II  A+ RA+    E        +A   ++   K+   + +  R L  ++
Sbjct: 69  LQEARREGQTIISQAQERARAQEAELLVVARNNAAKIEEEARGKVEQERQQVLRGLQGQL 128

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           A    E    ++ +++    +  +  K+I  + 
Sbjct: 129 ASLVTETASNVLGRELQTKGHDELINKSIDQLG 161


>gi|212715315|ref|ZP_03323443.1| hypothetical protein BIFCAT_00208 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661772|gb|EEB22347.1| hypothetical protein BIFCAT_00208 [Bifidobacterium catenulatum DSM
           16992]
          Length = 173

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + LII  V      +P    +  D  A KI   I +A + ++ ++    +Y+ + S
Sbjct: 19  FWSLVILIIVAVFFYKFFLP-KFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           K   +  +I   A+  A  +  +     E  +A      ++ I   + +A   L  ++  
Sbjct: 78  KARVDASKIRDDARTEASHIIADARTRAESDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            +  +  +I+  K+ NDDV SS+ ++ I+ + S  +
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDQMIADMDSDKK 173


>gi|197132350|gb|ACH47693.1| ATP synthase CF0 subunit I [Sarcocaulon vanderietiae]
          Length = 183

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/153 (14%), Positives = 60/153 (39%), Gaps = 1/153 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L + L ++++     +L   LD    +I + I  A  LR  +   L + +++  KV+
Sbjct: 31  LINLSVVLGVLIFFG-KGVLKDLLDNRKQRILNTIRNAEELRGGAVEELEKAQDRLRKVK 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E     +    + +    E   +  +          + I + +  A   +  ++   ++
Sbjct: 90  MEVDRFRVNQYSQGEWENSEWITSTYKDLEQSENSKNESIRFEQQRAVNQVRQRVVQRAL 149

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
               EI++  +N +++       I   +S  ++
Sbjct: 150 RGALEILNSCLNKELHLRTISANIVLFRSMKEI 182


>gi|28202155|ref|NP_777396.1| ATP synthase CF0 B subunit [Anthoceros formosae]
 gi|48474821|sp|Q85AL8|ATPF_ANTFO RecName: Full=ATP synthase subunit b, chloroplastic; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I
 gi|27807857|dbj|BAC55332.1| ATPase I subunit [Anthoceros formosae]
 gi|27807957|dbj|BAC55423.1| ATPase I subunit [Anthoceros formosae]
          Length = 184

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L + L ++VY     +L + LD     I   I +A    +++ + L Q + +  + E
Sbjct: 31  LINLGVVLGLLVYFG-KGVLNNLLDKRKQTILSTIRDAEERYKEATDKLKQAQIRLQQAE 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            +  EI +      +   ++     ++ S          I + +  A   +  +++  ++
Sbjct: 90  LKANEIRVNGLSEMEKEKQDLINIADEDSKRLEDSKNATIRFEEQRAIEQVRQQVSRLAL 149

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           E   E+++  +N +++S + +  I  +++ 
Sbjct: 150 ERASEVLNNCLNSELHSRMIDYHIGLLKTM 179


>gi|313204904|ref|YP_004043561.1| ATP synthase f0 subcomplex b subunit [Paludibacter propionicigenes
           WB4]
 gi|312444220|gb|ADQ80576.1| ATP synthase F0 subcomplex B subunit [Paludibacter propionicigenes
           WB4]
          Length = 166

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/155 (16%), Positives = 67/155 (43%), Gaps = 2/155 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  I   I+V    P +++  ++     I + +  A +  E+  N+  + +    
Sbjct: 12  FWMLLSFGIVAFILVKYGFP-VIIKMVEERKAYIDNSLNVAIQAHEELANVRAEGEAIVD 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I+  A     +L ++  +     +   ++D  ++I   K +A R +  ++A+
Sbjct: 71  NARREQVKIMNEAAQTRDMLIKDAKEKAGIEADKLIEDARKQILIEKEDAIRDIRRQVAE 130

Query: 127 FSVEIVREIISQKMNDDVNS-SIFEKTISSIQSCH 160
            SV+I  +I+  ++ +     ++ ++ +  I    
Sbjct: 131 LSVDIAEKILRGQLAEKDQQMAMIDRLLDEINISK 165


>gi|327441432|dbj|BAK17797.1| F0F1-type ATP synthase, subunit b [Solibacillus silvestris StLB046]
          Length = 173

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 65/153 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  + + + L+ ++       L+  +    + +   I  A + +++++ +L + K    +
Sbjct: 21  IATLVIFLGLMALLKKFAWGPLMGIMREREELVASGIDAAEKAKKETQALLEEQKSLLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E + II  AK + +   EE        +    +   + I   + +A   +  ++   
Sbjct: 81  ARTEAQSIIENAKKQGEATREEIVVTARAEANRLKESAVRDIEAEREKAIAAVREEVVSL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           SV    +++ +++++  NS++ ++TI+      
Sbjct: 141 SVLAASKVLGKEISEADNSALIKETIAKAGEAK 173


>gi|110636606|ref|YP_676813.1| F0F1 ATP synthase subunit B [Cytophaga hutchinsonii ATCC 33406]
 gi|123354860|sp|Q11YP3|ATPF_CYTH3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|110279287|gb|ABG57473.1| ATP synthase F0 subcomplex B subunit [Cytophaga hutchinsonii ATCC
           33406]
          Length = 167

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 55/152 (36%), Gaps = 2/152 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   +  ++ L ++        ++S +    D I D +  A + R   E +    +   +
Sbjct: 15  FWQTVIFLVTLYLLSKF-AWGPIMSAMKEREDSITDALSAADKARADIEKLQATNEALLA 73

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  +I+  A   A  + E+            ++     I   K  A   +    A 
Sbjct: 74  EARIERDKILADAHKAATTMMEDAKVKASTEGNRLMEAARVSIQTEKNAALHEVKNYAAT 133

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQ 157
            +VEI  +I+ +++ N +    +  + I  + 
Sbjct: 134 LAVEIAEKILRKELNNAEEQKKLVSEYIKEVN 165


>gi|120600839|ref|YP_965413.1| F0F1 ATP synthase subunit B [Shewanella sp. W3-18-1]
 gi|146295040|ref|YP_001185464.1| F0F1 ATP synthase subunit B [Shewanella putrefaciens CN-32]
 gi|226694915|sp|A4YCI2|ATPF_SHEPC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694918|sp|A1RQB4|ATPF_SHESW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120560932|gb|ABM26859.1| ATP synthase F0, B subunit [Shewanella sp. W3-18-1]
 gi|145566730|gb|ABP77665.1| ATP synthase F0, B subunit [Shewanella putrefaciens CN-32]
 gi|319428558|gb|ADV56632.1| ATP synthase F0, B subunit [Shewanella putrefaciens 200]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T L         V      +   L++ ++    KI D + +A R  +  E    +
Sbjct: 1   MSINATLLGQAISFALFVWFCIKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQAK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +    EII  A  R   + EE     +   A  +   + +I   +   K  L
Sbjct: 61  ATEQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIENERSRVKDDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V     I+ + ++   +S I +K ++ I
Sbjct: 121 RKQVAALAVLGAERILERSIDQAAHSDIVDKLVAEI 156


>gi|254000520|ref|YP_003052583.1| F0F1 ATP synthase subunit B [Methylovorus sp. SIP3-4]
 gi|313202479|ref|YP_004041137.1| ATP synthase f0 subunit B [Methylovorus sp. MP688]
 gi|253987199|gb|ACT52056.1| ATP synthase F0, B subunit [Methylovorus sp. SIP3-4]
 gi|312441795|gb|ADQ85901.1| ATP synthase F0, B subunit [Methylovorus sp. MP688]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T          L+      +   LL  ++     I D +    R +++ E    +
Sbjct: 1   MNINLTLFAQAVSFAILIWFTVKFVWPPLLKAIETRQKTIADGLAAGERGKQELEAATQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
                 + + +   II  A+ RA  + EE   N +      L   + +I      AK  L
Sbjct: 61  STAAVEEAKLKASSIIAQAEKRATDIIEEAKNNAKAEGDRILAGAKAEIDQEVNRAKEGL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++  +V    +I+ ++++  V++ +     + +
Sbjct: 121 RAQVSALAVAGAEKILRKEIDAKVHADMLNTIANEL 156


>gi|294676301|ref|YP_003576916.1| ATP synthase F0 subunit B [Rhodobacter capsulatus SB 1003]
 gi|75498234|sp|O05333|ATPF_RHOCA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|1934978|emb|CAA72984.1| FoF1 ATP synthase, subunit B [Rhodobacter capsulatus]
 gi|294475121|gb|ADE84509.1| ATP synthase F0, B subunit [Rhodobacter capsulatus SB 1003]
          Length = 185

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 90/157 (57%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F++ ++ +IF+ +++  ++PS+LL  LD  A+ I+ D+ EA+ LR++++ IL  Y+ 
Sbjct: 28  NAHFVILVAFLIFVGVLIKFKVPSMLLGMLDKRAEGIKADLDEAKALRDEAQKILASYER 87

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +  EI+ AAK  A++ AE+   ++++  A  LK  E +I   +  A + +  +
Sbjct: 88  KAREVQGQADEIVAAAKRDAQLAAEQAKADLKEAIARRLKGAEDRIASAEAAALKDVKDR 147

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V    E+++ +M+    S + +  I+ +++  
Sbjct: 148 AVQVAVAAAAEVLANQMSASDKSGMIDAAITEVETRL 184


>gi|17548038|ref|NP_521440.1| F0F1 ATP synthase subunit B [Ralstonia solanacearum GMI1000]
 gi|81502570|sp|Q8XU72|ATPF_RALSO RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|17430344|emb|CAD17109.1| probable atp synthase b chain transmembrane protein [Ralstonia
           solanacearum GMI1000]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 73/156 (46%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  M +   L  VV   I   L+  LD  A KI D +  A + + + E    +
Sbjct: 1   MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLAAADKGKAELELANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            ++  ++   E  + I  A+ RA++ A+E  QN +  +A  +   + +     +  +  L
Sbjct: 61  VEQALTEARTEGAQRIADAEKRAQMTADEIKQNAQAEAARIVAQAKAEAEQQAVRVRESL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 RDQVAVLAVKGAEQILKREVNAQVHADLLTQLKAEL 156


>gi|225868745|ref|YP_002744693.1| ATP synthase B chain [Streptococcus equi subsp. zooepidemicus]
 gi|225702021|emb|CAW99608.1| ATP synthase B chain [Streptococcus equi subsp. zooepidemicus]
          Length = 164

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 62/153 (40%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++    +I L++++       + + L A + +I  DI +A + R  ++ +  + +    
Sbjct: 12  FILVTGSVIVLLLLIKAFAWGAIEAILQARSQQISQDIDQAEQARLNAQQLEKEGQANLE 71

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +I+ AAK   K           + +          I + K EA   +  +++D
Sbjct: 72  ASRSEASQIVEAAKETGKAQETRIVAEATEEADRLKAAALTDIEHSKSEAISAVKTEMSD 131

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            +V +  +I+   ++    S + ++ +  +   
Sbjct: 132 LTVLLAEKIMGANLDKAAQSQLIDRYLDDLGEA 164


>gi|260642519|ref|ZP_05416185.2| ATP synthase F0, B subunit [Bacteroides finegoldii DSM 17565]
 gi|260621785|gb|EEX44656.1| ATP synthase F0, B subunit [Bacteroides finegoldii DSM 17565]
          Length = 167

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSRLKEEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + +    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKNLADKEAQMGMIDRMLDEV 161


>gi|320160464|ref|YP_004173688.1| ATP synthase subunit B/ATP synthase delta chain [Anaerolinea
           thermophila UNI-1]
 gi|319994317|dbj|BAJ63088.1| ATP synthase B chain/ATP synthase delta chain [Anaerolinea
           thermophila UNI-1]
          Length = 246

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/154 (12%), Positives = 59/154 (38%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            LV++     + I +   +   L   ++     I   + +AR   E   N   + +   +
Sbjct: 11  LLVYIFSFAVVFITLRAWVFVPLSEMMEKRRKTIAQGLEDARIAAEARANAEKEAQSILA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             +++  EI+  A  RA+ + EE     E  +      +  ++   +      L  ++  
Sbjct: 71  DAQQKAAEIVREATLRAQKVEEEIRAQAEAEAGKARAQVMAELEGERNRMLSELRGQVGA 130

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            ++   +++I + +++    ++  +  + ++   
Sbjct: 131 LAIAAAQKLIGENLDEKRQHALLNEFFAGVRGGK 164


>gi|309322264|ref|YP_003934342.1| ATP synthase CF0 subunit I [Monsonia speciosa]
 gi|197132348|gb|ACH47692.1| ATP synthase CF0 subunit I [Monsonia speciosa]
 gi|300069357|gb|ADJ66477.1| ATP synthase CF0 subunit I [Monsonia speciosa]
          Length = 184

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 61/153 (39%), Gaps = 1/153 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++L + L ++++     +L   LD    +I + I  A  LR  +   L + +++  KV+
Sbjct: 31  LINLSVVLGVLIFFG-KGVLKDLLDNRKQRILNTIRNAEELRGGAVEELEKAQDRLRKVK 89

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E     +    +A+    E      +          + I + +  A   +  ++   ++
Sbjct: 90  MEVDRFRVNQYSQAEWENSEWITKTYKDLEQLENSKNESIRFEQQRAVNQVRQRVFQRAI 149

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
               EI++  +N +++       I+  +S  ++
Sbjct: 150 RGALEILNSCLNKELHLRTISANIALFRSMKEI 182


>gi|299537988|ref|ZP_07051274.1| ATP synthase B chain [Lysinibacillus fusiformis ZC1]
 gi|298726570|gb|EFI67159.1| ATP synthase B chain [Lysinibacillus fusiformis ZC1]
          Length = 172

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 67/153 (43%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  + + I L++++       L+  +    + +  +I  A + R++S   L + K    +
Sbjct: 20  IATLVIFIGLMLLLRKFAWGPLMGIMQQREELVASEIEAAEKARKESHQFLEEQKSLLKE 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E + I+  AK + ++  EE        +    +   ++I   K +A   +  ++   
Sbjct: 80  ARTEAQSIVEGAKKQGELQKEEILTVARNEANRLKESALREIESEKEKAIAAVRDEVVSL 139

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           SV    +++S+++++  N ++ E+TI+      
Sbjct: 140 SVLAASKVLSKEISEADNRALIEETIAKAGEAR 172


>gi|281423285|ref|ZP_06254198.1| ATP synthase F0, B subunit [Prevotella oris F0302]
 gi|299140475|ref|ZP_07033613.1| ATP synthase F0, B subunit [Prevotella oris C735]
 gi|281402621|gb|EFB33452.1| ATP synthase F0, B subunit [Prevotella oris F0302]
 gi|298577441|gb|EFI49309.1| ATP synthase F0, B subunit [Prevotella oris C735]
          Length = 172

 Score = 78.7 bits (192), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 70/158 (44%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ ++  + +     P +++  +D     I + + +A    E+  NI  + +    
Sbjct: 16  FWMLLAFLVVFICLARFGFP-VIIKMVDERKQYIDESLNKAHEASERLANIKQEGETLLQ 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+  +I+  A      + E+      + S   + + +++I   K  A R + +++A+
Sbjct: 75  EAREQQAKIMKEAATTRDAIIEQAQDKAREESTRIISEAKKQIEVEKQSAIRDIRSQVAE 134

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            S+++  +I+ +K+ ND     + ++ +  +      D
Sbjct: 135 LSIQVAEKILREKLSNDKAQMDMIDRLLDEVSEKENKD 172


>gi|163738206|ref|ZP_02145622.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
 gi|161388822|gb|EDQ13175.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 186

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/157 (23%), Positives = 84/157 (53%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +  F+V ++ ++F+ I++Y ++P +L   LDA A+ I+ D+ EAR LRE+++ IL  Y+ 
Sbjct: 29  NTDFVVTLAFLLFVGILLYAKVPGLLGGQLDARAEGIKKDLEEARALREEAQTILASYER 88

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+ +A+  A   A++   ++E   A  +   E++I   +  A + +  +
Sbjct: 89  KQQEVQAQADRIVASAREDAAKAADQAKADLEISIARRMTAAEEQITAAQDSAVKEVRDQ 148

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               ++     +IS++M     + + +  I+ + +  
Sbjct: 149 AITVAIAAADAVISKQMTATEANKLIDAAIADVDAKL 185


>gi|88811297|ref|ZP_01126553.1| ATP synthase F0, subunit B [Nitrococcus mobilis Nb-231]
 gi|88791836|gb|EAR22947.1| ATP synthase F0, subunit B [Nitrococcus mobilis Nb-231]
          Length = 154

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 61/154 (39%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T    ++       +VY  +   + + L+    ++ D +  A R + + E      +
Sbjct: 1   MNLTLFGQLASFALFSYLVYRFLWDPITNMLEERRKRVADGLAAAERGQREQELAEKHAR 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           E   + +E+  EII  A+ RA  + E    +        +     ++      A+  L  
Sbjct: 61  EVLLEAKEQANEIIANAQRRADEIVEGAKDDARIEGERIVSAARSEVDQQINLAREGLRR 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++   ++E   +++ +K++   NS   EK  + +
Sbjct: 121 EVVALAIEGAEQVLKRKIDAKTNSEALEKLAAQL 154


>gi|256372562|ref|YP_003110386.1| ATP synthase F0, B subunit [Acidimicrobium ferrooxidans DSM 10331]
 gi|256009146|gb|ACU54713.1| ATP synthase F0, B subunit [Acidimicrobium ferrooxidans DSM 10331]
          Length = 173

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +S +I LV++        +   +   +D+IR D+  A   R ++E +  + + +   
Sbjct: 22  WSVISFVILLVVLAK-VAYPPVARMMAQRSDRIRADLEAADAARREAEALRAERERELQG 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             E+ R I+  A+  A+ L +E  +     +      +E ++   +++  R L +++AD 
Sbjct: 81  AREDARRILDDARRTAEALRQEASERARAEAEAIRAQVEAQLAAERVQLLRSLRSEVADL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           +VE+  +I+++++       + E  +   +
Sbjct: 141 AVELAGKIVARELEQSSFDPLIEAFLREAE 170


>gi|261856903|ref|YP_003264186.1| ATP synthase F0 subunit beta [Halothiobacillus neapolitanus c2]
 gi|261837372|gb|ACX97139.1| ATP synthase F0, B subunit [Halothiobacillus neapolitanus c2]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +   + LV +V   + + L + ++A   KI D +  + R + + +    +
Sbjct: 1   MNINITLVAQIIAFVVLVWLVSKYLWTPLSALMEARRQKIADGLSASERGKHELKLAQER 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E   + +E+  +I+  A  RA  + E+   N +  +   +     +I      AK +L
Sbjct: 61  SAEMLRETKEKANDIVAQANSRANQILEDARVNAKAEAERIVAQASAEIDREVNRAKEVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +++  +V     I+ +++ +  +       I+ I
Sbjct: 121 RTQVSAIAVTGAERILKREVTNKDHEVALADLIAHI 156


>gi|149190478|ref|ZP_01868749.1| F0F1 ATP synthase subunit B [Vibrio shilonii AK1]
 gi|148835732|gb|EDL52698.1| F0F1 ATP synthase subunit B [Vibrio shilonii AK1]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   +++ ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLLGQAISFALFVWFCMKYVWPPIMNAIEERQKKIADGLVAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E  +         L   E +I   +  A+  L
Sbjct: 61  ASDQMKEAKRTATEVIEQANKRKAQIVDEAREEALAERQKILAQAEAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156


>gi|323496910|ref|ZP_08101938.1| F0F1 ATP synthase subunit B [Vibrio sinaloensis DSM 21326]
 gi|323317984|gb|EGA70967.1| F0F1 ATP synthase subunit B [Vibrio sinaloensis DSM 21326]
          Length = 154

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 55/154 (35%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   ++  ++    KI D +  A R  +  +       
Sbjct: 1   MNATLLGQAISFALFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L  
Sbjct: 61  DQLKEAKRTATEIIEQANKRKAQILDEAREEAQAERQKILTQAEAELEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 QVATLAVAGAEKILERSIDKDAQKDILDNITAKL 154


>gi|91786234|ref|YP_547186.1| F0F1 ATP synthase subunit B [Polaromonas sp. JS666]
 gi|123060396|sp|Q12GQ4|ATPF_POLSJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91695459|gb|ABE42288.1| ATP synthase F0, B subunit [Polaromonas sp. JS666]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 68/156 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   +   LV      +   ++  LD  A KI D +  A + + +      +
Sbjct: 1   MSINATLFVQAIVFAILVWFTMKFVWPPIMKALDERAQKIADGLAAADKAKSELSVANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+ +K   E+   +  A+ RA+ L EE      +  +  +   + +     ++A+  L
Sbjct: 61  VEEELAKSRGESAVRLAEAERRAQALIEEAKAKATEEGSKIIAAAKVEAEQQTVKARETL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILRKEVNAGVHADLLGRLKTEL 156


>gi|237718123|ref|ZP_04548604.1| ATP synthase B subunit [Bacteroides sp. 2_2_4]
 gi|229452544|gb|EEO58335.1| ATP synthase B subunit [Bacteroides sp. 2_2_4]
          Length = 167

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSKLKEEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILRDAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + +    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKSLEDKEAQMGMIDRMLDEV 161


>gi|90023610|ref|YP_529437.1| F0F1 ATP synthase subunit B [Saccharophagus degradans 2-40]
 gi|122995709|sp|Q21DK4|ATPF_SACD2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|89953210|gb|ABD83225.1| ATP synthase F0, B subunit [Saccharophagus degradans 2-40]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      I  ++     +   L++ ++    +I + +  A R  +  E    +
Sbjct: 1   MNINLTLIGQSLTFIAFILFCMKYVWPQLIAMMEEREKRIAEGLEAADRADKDLELAQKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++ +E+   I+  A  R   + EE  +             + +I     +A+  L
Sbjct: 61  AGKQLTEAKEQAATIVEQANKRGNQIVEEAKEAAVAEGERIKAAAQAEIERQVAQAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +++   +++   ++   +S + +K  + +
Sbjct: 121 RGKVAALAIQGAEKVLGTTVDAKAHSEMLDKLAAEL 156


>gi|166033112|ref|ZP_02235941.1| hypothetical protein DORFOR_02834 [Dorea formicigenerans ATCC
           27755]
 gi|166027469|gb|EDR46226.1| hypothetical protein DORFOR_02834 [Dorea formicigenerans ATCC
           27755]
          Length = 166

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 77/158 (48%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D + L  +  ++   +++   +   ++  ++     I D +  A   +E++E++  +Y+ 
Sbjct: 5   DLSLLWTIINLVVFYLLLKKFLFKPVMGIMEKREQMIADGLKNASDRQEEAESLKKEYES 64

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
             S  +EE+ +I+  A+  AK  ++E   + ++ +   ++   + I   + +A   +  +
Sbjct: 65  ALSGAKEESVKIVENARVEAKRQSDEILADADRRADATIERARKTIETERKQALDGVETQ 124

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           IA  +++  R+I+ ++     N +I+++ + S+   H 
Sbjct: 125 IAGLAMQAARKIVDEETRKQGNQAIYDQFLESVGDAHD 162


>gi|302023930|ref|ZP_07249141.1| F0F1 ATP synthase subunit B [Streptococcus suis 05HAS68]
          Length = 168

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/151 (18%), Positives = 73/151 (48%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++  +    L+I++ +     +    +  A+KI +DI  A      + N++ Q +++  
Sbjct: 16  FILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANLVQQREDELV 75

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E+ +II  A  RAK+  +   +  +       +  + +I   K EA+  L  ++A+
Sbjct: 76  QGRIESPQIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQENLRVQVAE 135

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +V++  +II + ++   +S++ ++ +  + 
Sbjct: 136 LAVDLASKIILEDLDQQAHSNLIDRYLDKLG 166


>gi|282878919|ref|ZP_06287683.1| ATP synthase F0, B subunit [Prevotella buccalis ATCC 35310]
 gi|281298918|gb|EFA91323.1| ATP synthase F0, B subunit [Prevotella buccalis ATCC 35310]
          Length = 168

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 70/158 (44%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  II L I+     PS +++ +++  + I D + +A    E+  NI  + +    
Sbjct: 12  FWMAIVFIIVLAILWKWGFPS-IVNMVNSRKEFIDDSLRKAHEANERLANIQKEGETMLQ 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              E+  +I+  A      +  +  +      +  L + + +I   K  A R +  ++A+
Sbjct: 71  NAREKQAQILKDAADTRDAIVVKAQEKATNEGSRLLNEAKAEIEAEKQNAIRDIRTQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMD 163
            SV++  +I+ +K+ +++    +  K ++ I      +
Sbjct: 131 ISVQVAEKIVREKLSSNESQMELINKLLNDISVGKNNE 168


>gi|15082069|gb|AAK84015.1|AF393838_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 64/145 (44%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L++++ L   + + S   + A KI DDI  A    +++ +++ Q + + +  +EE  
Sbjct: 24  FIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVKQRQAELAASKEEAA 83

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
            II  A   A     +      + +    K  ++ I   + EA   +   +AD SV+I  
Sbjct: 84  NIIQVANDTASQNRAKVLAIANEEATSLKKRAQEDIEQERKEALNTVKGDVADISVQIAE 143

Query: 134 EIISQKMNDDVNSSIFEKTISSIQS 158
           ++I Q ++      + +  ++ +  
Sbjct: 144 KLIGQSLDASAQQELIDSYLAKLGE 168


>gi|170076620|ref|YP_001733259.1| ATP synthase b subunit [Synechococcus sp. PCC 7002]
 gi|226694399|sp|B1XRK5|ATPF2_SYNP2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|169887482|gb|ACB01190.1| ATP synthase b subunit [Synechococcus sp. PCC 7002]
          Length = 250

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/159 (13%), Positives = 59/159 (37%), Gaps = 3/159 (1%)

Query: 1   MHFDE--TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENIL 58
           M  D    F   ++ +I L ++ +  +   +L  +     ++ +    A  L+ ++   L
Sbjct: 1   MLIDWFTVFAQILNFVILLGLLRWF-LYKPILQVMAKRQAQLAEQWQTATDLQAQAHQAL 59

Query: 59  MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKR 118
            QY ++   ++ +    + AA+  A    +     + +      +  E  +H  +     
Sbjct: 60  EQYHQEQQSLQAQRASFLAAARAAADEERQRQLLTLREDIQAQREAWEADLHQEQRAFFH 119

Query: 119 LLYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            L  +++   V I R+ +    N  +   +  +    +Q
Sbjct: 120 TLRQQVSQQVVAIARQALRDLANATLEQQVVARFCEQLQ 158


>gi|58337086|ref|YP_193671.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus NCFM]
 gi|227903654|ref|ZP_04021459.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus ATCC 4796]
 gi|75420243|sp|Q9RGY5|ATPF_LACAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6652829|gb|AAF22494.1|AF098522_4 F1F0-ATPase subunit b [Lactobacillus acidophilus]
 gi|58254403|gb|AAV42640.1| H+-transporting ATP synthase chain b [Lactobacillus acidophilus
           NCFM]
 gi|227868541|gb|EEJ75962.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus ATCC 4796]
          Length = 169

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I + +++       +   ++    KI  D+  A   R+K+E +  + +     
Sbjct: 20  WYLLCFAILM-LLIKHYAWGPVSDMMEKRRQKIISDLDSAASDRKKAETLANEREAALKN 78

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I+  AK  A+  ++E   +  + +A   K   ++    K +A      ++AD 
Sbjct: 79  SRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEAAKAKSDALDAARDQVADI 138

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           SV I  ++I++ ++ +    + ++ I  + 
Sbjct: 139 SVAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|322372409|ref|ZP_08046945.1| ATP synthase F0, B subunit [Streptococcus sp. C150]
 gi|321277451|gb|EFX54520.1| ATP synthase F0, B subunit [Streptococcus sp. C150]
          Length = 165

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 60/152 (39%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++ +  +  L  ++       +     A   KI  DI  A   R+++E++  + +++ + 
Sbjct: 14  IITLGSVFLLYYLIRKFAWDQITGIFAAREKKIATDIDSAENARQEAESLAQKRQDELAG 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +II  AK   K    +        +        Q I   ++EA   +  ++AD 
Sbjct: 74  ARTEAAQIIDGAKETGKTQESKIIAEAHDEAKRLKDKANQDIAQSRVEALAGVKGEVADL 133

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V +  +++ Q ++    S + +  +  +   
Sbjct: 134 TVLLAEKVMKQNLDAKAQSDLIDSYLDQLGDA 165


>gi|58039570|ref|YP_191534.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
 gi|81352058|sp|Q5FRW8|ATPF1_GLUOX RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|58001984|gb|AAW60878.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
          Length = 166

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/163 (25%), Positives = 81/163 (49%), Gaps = 3/163 (1%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  D  F   ++ ++F VI     +   +   LDA AD +R D+ EA RLR ++E +L  
Sbjct: 1   MFHDPRFWTALAFVLFFVIFGRK-LWVAITGHLDARADSVRHDLDEAARLRREAEQMLED 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  K   ET+ ++  ++  A  LAE   ++ E  +A Y K  + +IH  +  A R +
Sbjct: 60  ANREREKTLAETQAMLARSEAEAAGLAERARKDAEAAAARYEKMAQDRIHAAERSAIREI 119

Query: 121 YAKIADFSVEIVREIISQKMNDD--VNSSIFEKTISSIQSCHQ 161
             + A  +V   R+++S ++ +   + +++ +K I S+    +
Sbjct: 120 QDRAAQIAVAAARDVVSTRLTESPDIAATLIDKGIDSLPEALR 162


>gi|189462114|ref|ZP_03010899.1| hypothetical protein BACCOP_02794 [Bacteroides coprocola DSM 17136]
 gi|189431195|gb|EDV00180.1| hypothetical protein BACCOP_02794 [Bacteroides coprocola DSM 17136]
          Length = 167

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 62/156 (39%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   +   I+     P +++  ++     I + +  A    E+  N+  + ++  +
Sbjct: 12  FWMIIVFGVVFFILAKYGFP-VIIKMVEDRKAYIDNSLKAACEANEQLANVKAEGEKILA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      + ++            + +++++I   K  A R +  ++A 
Sbjct: 71  QAHEEQARILAEAAATRDRIIKDAQNRAISEGDRLMIEIKKQIETEKESAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV I  +I+  K+ +      + ++ +  +    +
Sbjct: 131 LSVGIAEKIMRNKLADAKEQEELIDRMLDEMIESSK 166


>gi|228478369|ref|ZP_04062977.1| ATP synthase F0, B subunit [Streptococcus salivarius SK126]
 gi|312864174|ref|ZP_07724408.1| ATP synthase F0, B subunit [Streptococcus vestibularis F0396]
 gi|322517280|ref|ZP_08070157.1| ATP synthase F0 sector subunit B [Streptococcus vestibularis ATCC
           49124]
 gi|228250048|gb|EEK09318.1| ATP synthase F0, B subunit [Streptococcus salivarius SK126]
 gi|311100175|gb|EFQ58384.1| ATP synthase F0, B subunit [Streptococcus vestibularis F0396]
 gi|322124110|gb|EFX95649.1| ATP synthase F0 sector subunit B [Streptococcus vestibularis ATCC
           49124]
          Length = 165

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 61/152 (40%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           ++ +  +  L  ++       +     A   KI  DI  A   R+++E++  + +++ + 
Sbjct: 14  IITLGSVFLLYYLIRKFAWDQITGIFAAREKKIATDIDSAENARQEAESLAQKRQDELAG 73

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  +II  AK   K    +        +    +   Q I   ++EA   +  ++AD 
Sbjct: 74  ARTEAAQIIDGAKETGKTQESKIIAEAHDEAKRLKEKANQDIAQSRVEALAGVKGEVADL 133

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           +V +  +++ Q ++    S + +  +  +   
Sbjct: 134 TVLLAEKVMKQNLDAKAQSDLIDSYLDQLGDA 165


>gi|302558372|ref|ZP_07310714.1| ATP synthase F0, B subunit [Streptomyces griseoflavus Tu4000]
 gi|302475990|gb|EFL39083.1| ATP synthase F0, B subunit [Streptomyces griseoflavus Tu4000]
          Length = 183

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 62/156 (39%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    +P+ +   L+   + I   I +A   + +++++L QYK + ++
Sbjct: 27  IGLIAFVIVFGFLAKKLLPT-INKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 85

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 86  ARHEAARLRQEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIEADRKAAASALRQDVGKL 145

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S + ++ +  +    + 
Sbjct: 146 ATDLAGKLVGESLEDHARQSRVIDRFLDELDQKAEA 181


>gi|119503559|ref|ZP_01625642.1| ATP synthase subunit B [marine gamma proteobacterium HTCC2080]
 gi|119460621|gb|EAW41713.1| ATP synthase subunit B [marine gamma proteobacterium HTCC2080]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 59/155 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +   +  V      +   ++S +     KI D +  A R     E    +
Sbjct: 1   MNINLTLIGQLIAFVAFVAFCMRFVWPPIVSAMAERQQKIADGLAAADRAGHDLELAQKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+ +  + E   II AA  RA  L +E        +         ++   +  A+  L
Sbjct: 61  ATEEMADAKREAAVIIDAANKRAAALIDEAKVAAVAEADRVKAAAAAEVEQERARAQEQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISS 155
            ++++  ++    +++  +++   ++ + +   + 
Sbjct: 121 MSQVSSLALAGAEKVLGSEIDAAKHAELLKSLTAD 155


>gi|83313095|ref|YP_423359.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1]
 gi|123540650|sp|Q2W025|ATPF_MAGSA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|82947936|dbj|BAE52800.1| ATP synthase B chain precursor [Magnetospirillum magneticum AMB-1]
          Length = 178

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 74/152 (48%), Gaps = 1/152 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F V ++  I +V + +  +   + + LDA + KI+  + EA +LRE+++ +L  Y+ K
Sbjct: 23  PHFWVDVAF-ILVVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQRK 81

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                +E  EII  AK  A+ LA++  +++E       +    +I   + +A R +    
Sbjct: 82  QRDAMKEAEEIIAHAKAEAERLAKQAAKDLEVSMKRREQMAMDRIAQAEAQAVREVQNLA 141

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            D ++   +++I + ++     S+ +  I  +
Sbjct: 142 VDVAIGAAQKVIGESLSAAQTGSLVDNAIKDL 173


>gi|330813669|ref|YP_004357908.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486764|gb|AEA81169.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 162

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 86/161 (53%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D TF V +S  +F++++VY ++P I+ + L+    +I++ + +A  L+++S ++L +Y+
Sbjct: 1   MDSTFWVGISFCLFVLLLVYKKVPGIINNVLEGKIKEIKNKLEDAENLKKESNHLLGKYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + ++E  EI+  A    +  +    + +  + AL  K++ +K++  K  A + +  
Sbjct: 61  KQLDESKKECEEILQRASKINESESSTMKEKMNSMMALKEKNINEKVNQAKNGAIKEMKK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMD 163
                +VE  ++II+Q ++ +   SI   +I       + D
Sbjct: 121 IATIIAVESAKKIITQTIDKEKIDSINYTSIQENLESLKKD 161


>gi|312865390|ref|ZP_07725618.1| ATP synthase F0, B subunit [Streptococcus downei F0415]
 gi|311099501|gb|EFQ57717.1| ATP synthase F0, B subunit [Streptococcus downei F0415]
          Length = 165

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/146 (15%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ L  ++       +    +  A+KI  DI +A   R++++ +  + +E+ +  +++  
Sbjct: 20  VLVLYWLIRTFAWKQITGIFEERANKINQDIDDAENARQEAQELAQKRQEQLNSAKDDAA 79

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK      + +         +   +   Q I   K EA   +   +AD +V +  
Sbjct: 80  KIIDDAKETGNAQSAKILAETRDEVSRLKEKANQDIAQNKAEALSSVKGDVADLTVLLAE 139

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           +++++ ++    S + ++ +  +   
Sbjct: 140 KVMTKNLDKAAQSELIDQYLDQLGDA 165


>gi|152972645|ref|YP_001337791.1| F0F1 ATP synthase subunit B [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238897243|ref|YP_002921991.1| F0F1 ATP synthase subunit B [Klebsiella pneumoniae NTUH-K2044]
 gi|262040359|ref|ZP_06013605.1| ATP synthase F0 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|330005177|ref|ZP_08305139.1| ATP synthase F0, B subunit [Klebsiella sp. MS 92-3]
 gi|226741524|sp|A6TG40|ATPF_KLEP7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150957494|gb|ABR79524.1| ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238549573|dbj|BAH65924.1| ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259042300|gb|EEW43325.1| ATP synthase F0 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|328536383|gb|EGF62742.1| ATP synthase F0, B subunit [Klebsiella sp. MS 92-3]
          Length = 154

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 63/154 (40%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L      +  V      +   L++ ++    +I D +  A R ++  +       
Sbjct: 1   MNATILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQANAT 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  K + E + II  A  R   + +E     EQ     +   + +I   +  A+  L  
Sbjct: 61  DQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  +V    +II + +++  NS I +K ++ +
Sbjct: 121 QVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL 154


>gi|323493005|ref|ZP_08098141.1| F0F1 ATP synthase subunit B [Vibrio brasiliensis LMG 20546]
 gi|323312741|gb|EGA65869.1| F0F1 ATP synthase subunit B [Vibrio brasiliensis LMG 20546]
          Length = 154

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 55/154 (35%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   L+  ++    KI D +  A R  +  +       
Sbjct: 1   MNATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L  
Sbjct: 61  DQLKEAKRTATEIIEQANKRKAQILDEAREEAQTERQKILTQAEAELEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 QVATLAVAGAEKILERSIDKDAQKDILDNITAKL 154


>gi|297202399|ref|ZP_06919796.1| ATP synthase F0, B subunit [Streptomyces sviceus ATCC 29083]
 gi|197710080|gb|EDY54114.1| ATP synthase F0, B subunit [Streptomyces sviceus ATCC 29083]
          Length = 181

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/156 (12%), Positives = 63/156 (40%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    +P+ +   LD   + I   I +A   + +++++L QYK + ++
Sbjct: 25  IGLIAFVIVFGFLAKKLLPN-INKVLDERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 83

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 84  ARHEAARLRQEAQEQGATLIAEMRAEGQRQREEIVAAGHAQIEADRKAAASALRQDVGKL 143

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S + ++ +  ++   + 
Sbjct: 144 ATDLAGKLVGESLEDHARQSRVIDRFLDDLEEKAEA 179


>gi|313894469|ref|ZP_07828034.1| ATP synthase F0, B subunit [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313441293|gb|EFR59720.1| ATP synthase F0, B subunit [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 165

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 61/149 (40%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  I + ++        LL+ +    ++I  D+  A + R ++E     Y  + +K  
Sbjct: 13  MLNFFILVWLLARF-AYKPLLAMMTERKERIAKDLEAAEKARVEAEGFKADYAAQIAKAR 71

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E ++I+  A   A+    E      +          Q I   +  A   L  ++   SV
Sbjct: 72  QEAQQIVEKAVQEAEHTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNEVVSLSV 131

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +++++ MN + N+ + E  I  + S
Sbjct: 132 AMAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|126653445|ref|ZP_01725541.1| AtpF [Bacillus sp. B14905]
 gi|126589801|gb|EAZ83934.1| AtpF [Bacillus sp. B14905]
          Length = 173

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 65/153 (42%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  + + + L+ ++       L+  +    + +  +I  A + R+ S   L + K    +
Sbjct: 21  IATLVIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKDSHQFLEEQKSLLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E + I+  AK + ++  +E        +    +   ++I   K +A   +  ++   
Sbjct: 81  ARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVRDEVVSL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           SV    +++S+++++  N ++ E+TI+      
Sbjct: 141 SVLAASKVLSKEISEADNRALIEETIAKAGEAR 173


>gi|323490917|ref|ZP_08096112.1| ATP synthase B chain [Planococcus donghaensis MPA1U2]
 gi|323395397|gb|EGA88248.1| ATP synthase B chain [Planococcus donghaensis MPA1U2]
          Length = 173

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 66/150 (44%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
             + + I L++++       L+  +    D I+ +I  A   R +S+ +L + +      
Sbjct: 22  ATLVIFIGLMLLLKKFAWGPLMGVMQQREDLIKSEIETAENSRLESQKMLEEQRGLLKDA 81

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
             + +EI+  AK + ++  EE        S+   +   Q+I   + +A   +  ++   S
Sbjct: 82  RTQAQEIVENAKKQGEVSREEIITTARAESSRMKEAAVQEIANERDKAISAVREEVVALS 141

Query: 129 VEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           +    +++ ++++++ N  +  +TI+    
Sbjct: 142 LLAATKVLEKEISEEDNRQLINETIAKAGE 171


>gi|224024067|ref|ZP_03642433.1| hypothetical protein BACCOPRO_00784 [Bacteroides coprophilus DSM
           18228]
 gi|224017289|gb|EEF75301.1| hypothetical protein BACCOPRO_00784 [Bacteroides coprophilus DSM
           18228]
          Length = 167

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 63/156 (40%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +   +   I+     P +++  ++     I   +  AR   EK  ++  + +   +
Sbjct: 12  FWMIIVFGVVFFILAKYGFP-VIIRMVEDRKAYIDQSLKAAREANEKLASVKQEGERILA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  EE   I+  A      +  E  +         +++++++I   K  A R +  ++A 
Sbjct: 71  QANEEQVRILNEAAATRDRIINEAKERARLEGDRLMEEMKKQIETEKESAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV I  +++  K+ ++     + ++ +  +    +
Sbjct: 131 LSVGIAEKVMRSKLADEKEQMELIDRMLDEMIETSK 166


>gi|160884434|ref|ZP_02065437.1| hypothetical protein BACOVA_02418 [Bacteroides ovatus ATCC 8483]
 gi|260174640|ref|ZP_05761052.1| ATP synthase B subunit [Bacteroides sp. D2]
 gi|293369737|ref|ZP_06616313.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CMC 3f]
 gi|315922904|ref|ZP_07919144.1| ATP synthase B subunit [Bacteroides sp. D2]
 gi|156110173|gb|EDO11918.1| hypothetical protein BACOVA_02418 [Bacteroides ovatus ATCC 8483]
 gi|292635159|gb|EFF53675.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CMC 3f]
 gi|313696779|gb|EFS33614.1| ATP synthase B subunit [Bacteroides sp. D2]
          Length = 167

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKMVEGRKTYIDQSLEVAREANAQLSKLKEEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + +    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKSLEDKEAQMGMIDRMLDEV 161


>gi|254788508|ref|YP_003075937.1| F0F1 ATP synthase subunit B [Teredinibacter turnerae T7901]
 gi|237685213|gb|ACR12477.1| ATP synthase F0, B subunit [Teredinibacter turnerae T7901]
          Length = 156

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +      I  VI     +  +L+S ++A   +I D +  A R  +  E    +
Sbjct: 1   MNINLTLIGQSLTFIAFVIFTMKFVWPLLISAMEAREQRIEDGLLAADRADKDLELAQKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
              +  + +++   II  A  RA  L EE  +     +       + ++     +A+  L
Sbjct: 61  ATSQLHEAKQQAAAIIDQANKRATQLVEEAKEQARAEAERINAQAQAEVERQVSQAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +++A  ++    +++ + ++   ++S+ +K  + +
Sbjct: 121 RSQVAVLAIAGAEKVLGESIDASKHNSMLDKLAAEL 156


>gi|326776584|ref|ZP_08235849.1| ATP synthase F0, B subunit [Streptomyces cf. griseus XylebKG-1]
 gi|326656917|gb|EGE41763.1| ATP synthase F0, B subunit [Streptomyces cf. griseus XylebKG-1]
          Length = 178

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/156 (10%), Positives = 63/156 (40%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +   I   +     +P ++   L+   + I   I +A   + +++++L QYK + ++
Sbjct: 22  IGLICFGIVFFVFSKKLLP-VINKTLEERREAIEGGIEKAESAQIEAQSVLEQYKAQLAE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +  ++ +E     ++     +     +I   +  A   L   +   
Sbjct: 81  ARHEAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKL 140

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S   ++ +  +++  + 
Sbjct: 141 ATDLAGKLVGESLQDHARQSGTVDRFLDELEAKAEA 176


>gi|292492276|ref|YP_003527715.1| H+transporting two-sector ATPase B/B' subunit [Nitrosococcus
           halophilus Nc4]
 gi|291580871|gb|ADE15328.1| H+transporting two-sector ATPase B/B' subunit [Nitrosococcus
           halophilus Nc4]
          Length = 251

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/180 (13%), Positives = 68/180 (37%), Gaps = 9/180 (5%)

Query: 1   MHFDE-TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M  +  TF++ +   + LV  +       +L  ++     I+  + EA+ +R K+E +  
Sbjct: 1   MELNWSTFILEIINFLILVWFLKHFFYRPILGVIERRRSTIQQTLEEAKTIRSKAEAMEQ 60

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           QY+ +  + E+E    +           E     +        +  +  +   + +A+R 
Sbjct: 61  QYQNRLREWEKEKAAALEKLHRELNAEQERQVAALRNSLEAERERAQVLLERNQNQARRK 120

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI--------QSCHQMDKNTTETLG 171
                 + +V    +++S+    ++ + +    +  +        ++  +   NTTE + 
Sbjct: 121 DQEAALERTVRFASQLLSRLAGPELEAKLVALVLEDLTTLPLEQQENLRETLTNTTEPIK 180


>gi|258652333|ref|YP_003201489.1| ATP synthase F0 subunit B [Nakamurella multipartita DSM 44233]
 gi|258555558|gb|ACV78500.1| ATP synthase F0, B subunit [Nakamurella multipartita DSM 44233]
          Length = 181

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/151 (13%), Positives = 60/151 (39%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +   + LV++    +         A    I   I +A   + +++  L +Y ++ + 
Sbjct: 31  IAAIGFALLLVVLGKF-VWPQFEKAFAARTKAIEGGIAKAEEAQNEAKAALDRYNQQLAG 89

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             EE  +I   A+ +A+ + ++        +         ++   + +    L + +   
Sbjct: 90  AREEAAKIREDARAQAQAIRDDMLAQAHAETERIAAAGRAQLDAQRAQIVAELRSDLGRV 149

Query: 128 SVEIVREIISQKMNDDV-NSSIFEKTISSIQ 157
           SV++   I+ + ++DD   +   E+ ++ + 
Sbjct: 150 SVDLAGRIVGESLDDDARQNRTVERFLAELD 180


>gi|332146780|dbj|BAK19937.1| ApNa+ATPase b subunit [Aphanothece halophytica]
          Length = 256

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 67/158 (42%), Gaps = 1/158 (0%)

Query: 1   MHFDE-TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           M FD  TF   +   + LV +++  +   +   +D    ++++   +AR   EK++    
Sbjct: 1   MLFDWFTFFAQIINFVILVYLLWRFLYRPINKVMDDRQRQLQERWNDAREQEEKAQQEAQ 60

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
           +Y+++ +++E +   +I  AK  A+   ++  Q+  +      +  ++ +   K      
Sbjct: 61  KYRDQQAELEAQREALISEAKAEAEQKRQQLRQSAREEIQQRREQWQEALQQEKESFYAR 120

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
              K+   ++ I R ++    + ++        +  ++
Sbjct: 121 SRQKLQQETITICRRVLQDLADAELEDQAIALFLERLK 158


>gi|262376918|ref|ZP_06070145.1| ATP synthase F0, B subunit [Acinetobacter lwoffii SH145]
 gi|262308263|gb|EEY89399.1| ATP synthase F0, B subunit [Acinetobacter lwoffii SH145]
          Length = 156

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 59/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T           V      +   L++ +     KI D +  A + +    +   Q
Sbjct: 1   MNINLTLFGQAIAFAIFVAFCMKFVWPPLINAISERQRKIADGLNAAEKAKADLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K +    + +  ++I  A  R   L EE             +  ++ +      A+  L
Sbjct: 61  VKAELDAAKAQAAQLIEQANRRGAQLIEEARTQAAAEGERIRQQAKEAVDTEINAAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+SQ+++ + ++++  +  + +
Sbjct: 121 RQQVAALAVTGAEKILSQQVDAEAHNAMLTQLAAKL 156


>gi|171060200|ref|YP_001792549.1| F0F1 ATP synthase subunit B [Leptothrix cholodnii SP-6]
 gi|170777645|gb|ACB35784.1| ATP synthase F0, B subunit [Leptothrix cholodnii SP-6]
          Length = 156

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    + +   L       +   +   LD  A K+ D +  A + + +      +
Sbjct: 1   MNLNATLFAQIVVFGILWWFTMTFVWPPITKALDERAKKVADGLAAADKAKLELATANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +E+  +   E  +++  A+ RA+ + +E  +  E+  +  +   + +     ++A+ +L
Sbjct: 61  VEEQLVQSRNENAKLLADAEKRAQAIVDEAKKRAEEEGSKIVAAAKAEADQQSIQAREVL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILKREVNAGVHAELLTRLKTEL 156


>gi|254503348|ref|ZP_05115499.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
 gi|222439419|gb|EEE46098.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
          Length = 159

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 50/155 (32%), Positives = 88/155 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + L++F V++ YL++P ++   LD  AD I+ ++ EAR++RE+++ +L +Y+
Sbjct: 1   MDASFWALVGLVLFFVLIAYLKVPGMIGGALDKRADDIKKELEEARKMREEAQELLSEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+  A   A+ L  E  Q +E++ A   K  E+KI   + +A   + A
Sbjct: 61  RKRHEAESEAEAIVAEANAEAERLTVETNQALEEMIARRSKAAEEKIAQAETQAIAEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           K AD +V    EI+S K+ D V   I  K+I+ ++
Sbjct: 121 KAADIAVAAAEEILSAKVKDKVADDILAKSITQVK 155


>gi|300726960|ref|ZP_07060383.1| ATP synthase F0, B subunit [Prevotella bryantii B14]
 gi|299775745|gb|EFI72332.1| ATP synthase F0, B subunit [Prevotella bryantii B14]
          Length = 168

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 68/158 (43%), Gaps = 2/158 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  II  ++++    PSI+   ++     I D + +A    EK  NI  + +    
Sbjct: 12  FWMTIVFIIVFLVLLKWGFPSII-KMVNDRKAFIDDSLRKAHEANEKLANIQKEGESILQ 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+   I+  A      + E       +  A  + + + +I   K  A R + +++A+
Sbjct: 71  EAREKQAAILKEAAETRDAIVENAQDKAREEGARIVNEAKIQIETEKQNAIRDIRSQVAE 130

Query: 127 FSVEIVREIISQKMN-DDVNSSIFEKTISSIQSCHQMD 163
            S+ +  +++ Q ++ D     + ++ +  + S ++  
Sbjct: 131 LSILVAEKVLKQNLSTDAKQMELIDRLLDEVSSDNKKI 168


>gi|297539947|ref|YP_003675716.1| ATP synthase F0 subunit B [Methylotenera sp. 301]
 gi|297259294|gb|ADI31139.1| ATP synthase F0, B subunit [Methylotenera sp. 301]
          Length = 156

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +        L+      +   LLS ++    +I D +  A+  R   E    +
Sbjct: 1   MNINFTLIAQAIAFAVLIWFTVKFVWPPLLSAIETRQKEIADGLAAAQEGRSALEVAAKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +   ++ +++  EII  A+ R   + EE   N +      L   + +I      AK  L
Sbjct: 61  SEATLAEAKQKASEIIGQAEKRGTQIVEEAKGNAKAEGERILAGAKAEIDQEVNRAKEGL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++++  ++    +I+ ++++   +S +  K  + +
Sbjct: 121 RSQVSALAIAGAEKILRKEIDAKAHSEMLSKLAAEL 156


>gi|229823979|ref|ZP_04450048.1| hypothetical protein GCWU000282_01283 [Catonella morbi ATCC 51271]
 gi|229786333|gb|EEP22447.1| hypothetical protein GCWU000282_01283 [Catonella morbi ATCC 51271]
          Length = 170

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 60/152 (39%), Gaps = 1/152 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T +  ++ +I L ++V       L   L      I  DI  A   +  +++     +   
Sbjct: 17  TIVTLVAFVILL-LIVKHFAWGPLTKILSERKQVIDHDIQTAASEKAAAQDANRDAQLAL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
                E  +IIL AK ++  + +   +  ++      +  ++ I   +      L A++ 
Sbjct: 76  RDARAEATQIILQAKKQSLQVQDTMLKEAKEEVIRMKETAQKDIALERRRMLSDLRAELT 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           D S+EI  +II +++  +    + +  I  + 
Sbjct: 136 DISIEIAEKIIQREIKPEDYHRLVDDFIEGMD 167


>gi|227821028|ref|YP_002824998.1| F0F1 ATP synthase subunit B' [Sinorhizobium fredii NGR234]
 gi|227340027|gb|ACP24245.1| FoF1 ATP synthase subunit B [Sinorhizobium fredii NGR234]
          Length = 203

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + IP  +   L+   D+I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 56  LWLAITFGLFYLLMSKVIIPR-IGGILEKRHDRIAQDLDEASRLKGEADAAIASYEQELA 114

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I   A+  AK  A      +E      +   E +I  +K +A   + A   +
Sbjct: 115 NARAKGHSIADTAREEAKSKATADRAAVEAELTKKITAAETRIADIKSKALADVGAIAEE 174

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKT 152
            +  +V+++I   +     ++  + +
Sbjct: 175 TATAVVKQLIGGNVTKTEIAAAVKAS 200


>gi|85860962|ref|YP_463164.1| F0F1-type ATP synthase subunit b [Syntrophus aciditrophicus SB]
 gi|123517856|sp|Q2LY33|ATPF2_SYNAS RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|85724053|gb|ABC78996.1| F0F1-type ATP synthase, subunit b [Syntrophus aciditrophicus SB]
          Length = 274

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/167 (16%), Positives = 65/167 (38%), Gaps = 1/167 (0%)

Query: 1   MHFDE-TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILM 59
           MH D    L  +   + L+ ++   + + ++  ++    KI     EA RL+ ++E    
Sbjct: 1   MHIDWFVLLAQLVNFLILIYLLKRFLYTRIIQAMNEREAKIAARFDEAERLKREAEEAAR 60

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRL 119
            Y+EK+S ++ +  +++  A+       +E   +  +      +   + +   K      
Sbjct: 61  VYEEKNSFLQGQEEKMLNQAREVVNHRQKEWMDSAREEVDAIRRRWIETVLQEKAAFLEH 120

Query: 120 LYAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNT 166
           L  +       I R+I+    +  + S + +  I  I S    ++  
Sbjct: 121 LRQRTGKQVFAIARKILDDLADTAIESKMVDVLIDRIHSLDPAEREK 167


>gi|167463131|ref|ZP_02328220.1| hypothetical protein Plarl_11311 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 164

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 68/156 (43%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
           E+F+  +     L  ++       L   ++  A+ +++ +  A   R ++E ++ + KE 
Sbjct: 6   ESFVFAIFAFAILYWLLNKYAFGPLFGIMEKRAELVQEQLKSAETNRTQAEQLVAEQKEA 65

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             +  ++   I+  AK  +   AEE     ++ ++   ++  + I   K +A   L  ++
Sbjct: 66  IQEARKDAYNIVEQAKQASTRQAEEIVHKAKEDASRIKEEAVRDIESEKNKAIAALREQV 125

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            D SV I  +++ ++++      +  + +  ++   
Sbjct: 126 GDMSVLIASKVLEKEVDAGEQQKLVNQYLKEVEGDK 161


>gi|304413045|ref|ZP_07394518.1| membrane-bound ATP synthase, F0 complex, subunit b [Candidatus
           Regiella insecticola LSR1]
 gi|304283888|gb|EFL92281.1| membrane-bound ATP synthase, F0 complex, subunit b [Candidatus
           Regiella insecticola LSR1]
          Length = 158

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/158 (18%), Positives = 63/158 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         VI     +   L+  ++    +I D I  A R ++  +     
Sbjct: 1   MNLNATIVGQAIAFFLFVIFCMKYVWPPLIEAIEKRQKEIADSIASAERAKKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  K +E+ + II  A  R   + E      EQ     +   + +I   +  A   L
Sbjct: 61  MTEQLQKAKEQAQVIIEQANKRKVQILENAKVEAEQERKKIIMQAQAEIDADRKRAYEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
             +IA  ++     II+  +N+ +N ++ +  ++ ++ 
Sbjct: 121 RKQIAGLAIAGAERIINCSVNETINRTLVDTMVAELEQ 158


>gi|307327915|ref|ZP_07607097.1| ATP synthase F0, B subunit [Streptomyces violaceusniger Tu 4113]
 gi|306886433|gb|EFN17437.1| ATP synthase F0, B subunit [Streptomyces violaceusniger Tu 4113]
          Length = 187

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 16/152 (10%), Positives = 59/152 (38%), Gaps = 2/152 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++  I    +    +P+ +   L+   + I   + +A   + +++ +L  Y+ + + 
Sbjct: 25  IGLIAFAIVFFFLAKKLLPN-INRVLEERREAIEGGMEKAEATQAEAQQVLEDYRAQLAD 83

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   + +A + L   +   
Sbjct: 84  ARHEAARLRQEAQEQGAALIAEMRAEGQRQREEVIAAGHAQIEADRKQAAQTLRQDVGRL 143

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
           + ++   I+ + + +    S   ++ +  +++
Sbjct: 144 ATDLAGRIVGESLEDVARQSRTIDRFLDELEA 175


>gi|303237187|ref|ZP_07323757.1| ATP synthase F0, B subunit [Prevotella disiens FB035-09AN]
 gi|302482574|gb|EFL45599.1| ATP synthase F0, B subunit [Prevotella disiens FB035-09AN]
          Length = 170

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 70/153 (45%), Gaps = 2/153 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  +I  VIV+    P ++++ ++   + I D + +A+   +K  NI  + +    
Sbjct: 12  FWMTLVFLIVAVIVIKFGFP-VIINMVNERKEYIDDSLRKAKEANQKLSNIQKEGESVMQ 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+   ++  A      +  +      + SA  + + + +I   K  A   +  ++A+
Sbjct: 71  QAREQQALLLKEATATRDAIVGKAQDKAHEESARIIAEAKTEIEAEKQNAFNDIRGQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQS 158
            SV++  +I+  ++ ++D    +  K + ++ S
Sbjct: 131 ISVKVAEQILRGQLADNDKQMELIGKLLDNVSS 163


>gi|296134377|ref|YP_003641624.1| ATP synthase F0, B subunit [Thermincola sp. JR]
 gi|296032955|gb|ADG83723.1| ATP synthase F0, B subunit [Thermincola potens JR]
          Length = 168

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +I L I+  L +   +L  LD     I D I  A   + ++E +  +Y+ + ++
Sbjct: 16  WQIVNFLILLFILNKL-LYKPMLQMLDDRKKSIEDAINSAETAKAEAEALRKEYETRLAE 74

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E ++II  A    + + +E   N ++ +   ++  +++I   K  A   L  ++A  
Sbjct: 75  AKKEAQDIIAKATKLGEEMKKEIVANAQEEANKAIRKAQEEIAREKDAAVAALRDEVATL 134

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +V    +++ + ++ + +  + +  +  +    
Sbjct: 135 AVMAAGKVLGKAISVEDHEKLVKDFVQEVGGLK 167


>gi|295107522|emb|CBL05065.1| ATP synthase F0 subcomplex B subunit [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 194

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 64/154 (41%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  + + I L IV+         + L      I+D + ++   R +SE +L +Y+ +
Sbjct: 37  AEFIPMLVIFILLWIVLAKLGWPKFEAMLSKRETMIKDALEKSEEARIESERVLEEYRVQ 96

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  + +  +I+  AK   +    +     +  +   +      I   K  A   L + +
Sbjct: 97  LADAKAQAAQIVADAKQTGEAAKADITAKAQSEATDMIAKARTAIEAEKKAAIAELQSSV 156

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           AD SV +   +I + +++  +  + E+ ++   S
Sbjct: 157 ADTSVAVAARLIGEDLSESEHRKMIERYVNEAGS 190


>gi|239990751|ref|ZP_04711415.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 11379]
 gi|291447764|ref|ZP_06587154.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 15998]
 gi|291350711|gb|EFE77615.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 15998]
          Length = 178

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 62/156 (39%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +   I   +     +P  +   LD   + I   I +A   + +++++L QYK + ++
Sbjct: 22  IGLICFSIVFFVFYKKLLP-AINKALDERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +  ++ +E     ++     +     +I   +  A   L   +   
Sbjct: 81  ARHEAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKL 140

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S   ++ +  +++  + 
Sbjct: 141 ATDLAGKLVGESLQDHARQSGTVDRFLDELEAKAEA 176


>gi|229164257|ref|ZP_04292190.1| ATP synthase B chain [Bacillus cereus R309803]
 gi|228619197|gb|EEK76090.1| ATP synthase B chain [Bacillus cereus R309803]
          Length = 168

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|163942997|ref|YP_001647881.1| F0F1 ATP synthase subunit B [Bacillus weihenstephanensis KBAB4]
 gi|229014479|ref|ZP_04171597.1| ATP synthase B chain [Bacillus mycoides DSM 2048]
 gi|229064960|ref|ZP_04200258.1| ATP synthase B chain [Bacillus cereus AH603]
 gi|229136128|ref|ZP_04264881.1| ATP synthase B chain [Bacillus cereus BDRD-ST196]
 gi|229170017|ref|ZP_04297709.1| ATP synthase B chain [Bacillus cereus AH621]
 gi|226741306|sp|A9VSA7|ATPF_BACWK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|163865194|gb|ABY46253.1| ATP synthase F0, B subunit [Bacillus weihenstephanensis KBAB4]
 gi|228613442|gb|EEK70575.1| ATP synthase B chain [Bacillus cereus AH621]
 gi|228647287|gb|EEL03369.1| ATP synthase B chain [Bacillus cereus BDRD-ST196]
 gi|228716261|gb|EEL67973.1| ATP synthase B chain [Bacillus cereus AH603]
 gi|228746829|gb|EEL96714.1| ATP synthase B chain [Bacillus mycoides DSM 2048]
          Length = 168

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 62/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKTSAVQEIQREKEQAIAALQEQVASLSVHIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|116250702|ref|YP_766540.1| F0F1 ATP synthase subunit B [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226694452|sp|Q1MKS9|ATPF_RHIL3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|115255350|emb|CAK06425.1| putative ATP synthase sub unit b [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 162

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 47/159 (29%), Positives = 93/159 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
             D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L++Y
Sbjct: 3   FLDATFFAFVGLVLFLALVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLVEY 62

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   ++EA + + 
Sbjct: 63  QRKRKEAEAEAAHIVAAAEREAEMLTAEAMKKTEEFVANRTALSEQKIKQAEVEAMKAVR 122

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +   D ++     +++++ +  V S +F   +  +++  
Sbjct: 123 SAAVDLAIAAAETVLAKRADAKVQSELFGNAVGQVKTRL 161


>gi|328885068|emb|CCA58307.1| ATP synthase B chain [Streptomyces venezuelae ATCC 10712]
          Length = 181

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 19/160 (11%), Positives = 64/160 (40%), Gaps = 2/160 (1%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           DE  +  ++ +I    +    +P+ +   L+   + I   I +A   + +++++L QYK 
Sbjct: 21  DELVIGLIAFVIVFGFLAKKLLPN-INKVLEQRREAIEGGIEKAESAQIEAQSVLEQYKA 79

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + ++   E   +   A  +   + +E     ++     +     +I   +  A   L   
Sbjct: 80  QLAEARHEAARLRQEATEQGTAIIQEMKAEGQRQREEIIAAGHTQIEADRKAASASLRQD 139

Query: 124 IADFSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           +   + ++  +++ + + +    S   ++ +  ++   + 
Sbjct: 140 VGKLATDLAGKLVGESLEDVARQSRTIDRFLDELEEKAEA 179


>gi|226952194|ref|ZP_03822658.1| membrane-bound ATP synthase, F0 sector, subunit b [Acinetobacter
           sp. ATCC 27244]
 gi|294648867|ref|ZP_06726323.1| ATP synthase F0 subunit B [Acinetobacter haemolyticus ATCC 19194]
 gi|226837032|gb|EEH69415.1| membrane-bound ATP synthase, F0 sector, subunit b [Acinetobacter
           sp. ATCC 27244]
 gi|292825258|gb|EFF84005.1| ATP synthase F0 subunit B [Acinetobacter haemolyticus ATCC 19194]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   L++ +     KI D +  A + +    +   Q
Sbjct: 1   MNINLTLIGQAIAFAVFVAFCMKFVWPPLINAISERQRKIADGLNAAEKAKADLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K +    + +  ++I  A  RA  L EE             +  ++ +      A+  L
Sbjct: 61  VKAEIDAAKAQAAQLIEQANRRAAQLVEEARTQAAAEGERIRQQAKETVDQDINAAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I++Q+++ + ++++  +  + +
Sbjct: 121 RQQVAALAVDGAEKILNQQVDAEAHNAMLTQLAAKL 156


>gi|148543698|ref|YP_001271068.1| ATP synthase F0, B subunit [Lactobacillus reuteri DSM 20016]
 gi|184153108|ref|YP_001841449.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194468261|ref|ZP_03074247.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227363323|ref|ZP_03847452.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227544497|ref|ZP_03974546.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300909315|ref|ZP_07126776.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|325682069|ref|ZP_08161587.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
 gi|226741494|sp|A5VIQ7|ATPF_LACRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741495|sp|B2G687|ATPF_LACRJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148530732|gb|ABQ82731.1| ATP synthase F0 subcomplex B subunit [Lactobacillus reuteri DSM
           20016]
 gi|154705566|gb|ABS84209.1| ATP synthase F0 B subunit [Lactobacillus reuteri]
 gi|183224452|dbj|BAG24969.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194453114|gb|EDX42012.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227071630|gb|EEI09924.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227185520|gb|EEI65591.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300893180|gb|EFK86539.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|324978713|gb|EGC15662.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
          Length = 172

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 63/146 (43%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           +   I L+++V       +   +   ADKI +DI  A R RE +E +  + + +     +
Sbjct: 22  IVTFIILMLLVKHFAWKPVTDMMKKRADKIANDIDNAARSRESAEKMAAKRQAELQSSRQ 81

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  EI+  AK   +    +  +  ++ +    +  ++     + +A       +A+ S+E
Sbjct: 82  EAAEIVSNAKKSGETQRAQIVETAQKDAQALKQQAQKDAEQARRDALNSAKDDVANLSIE 141

Query: 131 IVREIISQKMNDDVNSSIFEKTISSI 156
           I  ++I +++  D    + +  I  +
Sbjct: 142 IASKLIQKELKADDQKELIDSYIEGL 167


>gi|114632|sp|P12989|ATPF_VIBAL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|581814|emb|CAA34177.1| unnamed protein product [Vibrio alginolyticus]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMKAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASDQLKEAKRTATEIIEQANKRKSQILDEAREEAQAERQKILAQAEAELEAERNRARDDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156


>gi|313816318|gb|EFS54032.1| ATP synthase F0, B subunit [Propionibacterium acnes HL059PA1]
          Length = 184

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V + L++ L  ++   +        +   + I+  I  A R + +++  L +Y+ + + 
Sbjct: 20  IVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLAS 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I   AK +   +  E   N ++ +    +    +I   + +A R + A+I   
Sbjct: 80  TRDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRAEIGGL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSI 156
           +  +   I+ + + +D    +  ++ +SS+
Sbjct: 140 ATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|71909719|ref|YP_287306.1| ATP synthase F0, subunit B [Dechloromonas aromatica RCB]
 gi|123626241|sp|Q477Z5|ATPF_DECAR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71849340|gb|AAZ48836.1| ATP synthase F0, subunit B [Dechloromonas aromatica RCB]
          Length = 156

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         + +    +   L   +     +I + +  A R + + E    +
Sbjct: 1   MNINATLIGQAIWFALFIWITMKYVWPPLQKAMADRQAQIAEGLAAAERGKHEQELAAKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   + +E++ + +  A+ RA+ + EE     +  +   +   + +I      AK+ L
Sbjct: 61  SADALREAKEKSADFVAQAEKRAQQIVEEAKGTAKIEADKVVAGAKAEIEQEVERAKQQL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A+ +V    +I+ +++N   ++ +       +
Sbjct: 121 RERVAELAVAGAEKILRKEINASAHADMLAALKQDL 156


>gi|229175983|ref|ZP_04303479.1| ATP synthase B chain [Bacillus cereus MM3]
 gi|228607476|gb|EEK64802.1| ATP synthase B chain [Bacillus cereus MM3]
          Length = 168

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|120609071|ref|YP_968749.1| F0F1 ATP synthase subunit B [Acidovorax citrulli AAC00-1]
 gi|226694413|sp|A1TJ37|ATPF_ACIAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120587535|gb|ABM30975.1| ATP synthase F0, B subunit [Acidovorax citrulli AAC00-1]
          Length = 156

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   + + LV+     +   +   LD  A KI + +  A R + +   +  +
Sbjct: 1   MSINATLFVQAIVFLILVLFTMKFVWPPIAKALDERAQKIAEGLAAADRAKSELVAVNQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + + ++   ET   +  A+ RA+ + EE      +     +     +     ++A+  L
Sbjct: 61  VETELAQTRNETASRLADAERRAQAIIEEAKARATEEGNKIVAAARAEAEQQTIQAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL 156


>gi|332969723|gb|EGK08737.1| ATP synthase F0 sector subunit B [Kingella kingae ATCC 23330]
          Length = 156

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 62/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  + +   LV      +   +   LD  ADKI + +  A R +   E    +
Sbjct: 1   MNLNATLIAQIIVFFILVGFTMKYVWPPIAKALDERADKIAEGLAAAERGKSDFEQAEKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++   +  E++  A+ RA  + E+        +A      +  +      A+  L
Sbjct: 61  VAELLTEGRTQVAEMVANAEKRAAQIVEDAKVQAATEAARIAAQAKADVEQETNRAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+    I+ +++N+  ++ +       +
Sbjct: 121 REQVATLAVKGAEAILRREVNESQHAQMLSALKQEL 156


>gi|329962156|ref|ZP_08300165.1| ATP synthase F0, B subunit [Bacteroides fluxus YIT 12057]
 gi|328530561|gb|EGF57428.1| ATP synthase F0, B subunit [Bacteroides fluxus YIT 12057]
          Length = 168

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 22/154 (14%), Positives = 63/154 (40%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++ + ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITNMVEGRKTYIDQSMEVAREANAQLAKLKEEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  +     +   L ++ ++I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMHERDKIIVEARKQAAASAQKELDEVRKQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSC 159
            SV+I  +++ + +++      + ++ +  + + 
Sbjct: 131 LSVDIAEKVLRKNLDEKHEQMEMIDRMLDEVLAA 164


>gi|327443492|gb|EGE90146.1| ATP synthase F0, B subunit [Propionibacterium acnes HL013PA2]
          Length = 184

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V + L++ L  ++   +        +   + I+  I  A R + +++  L +Y+ + + 
Sbjct: 20  IVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLAS 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I   AK +   +      N ++ +    +    +I   + +A R + A+I   
Sbjct: 80  ARDEAAQIRDDAKSQGAQIIAVMRANAQEEADRITERANAQIQAERDQAVREVRAEIGGL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSI 156
           +  +   I+ + + +D    +  ++ +SS+
Sbjct: 140 ATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|104773791|ref|YP_618771.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513797|ref|YP_812703.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122275433|sp|Q04BA7|ATPF_LACDB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122397274|sp|Q1GAW9|ATPF_LACDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|103422872|emb|CAI97534.1| H+ transporting ATPase / ATP synthase, B subunit [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116093112|gb|ABJ58265.1| ATP synthase F0 subcomplex B subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|325125455|gb|ADY84785.1| H+-transporting ATP synthase chain B [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
          Length = 168

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 61/152 (40%), Gaps = 1/152 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    +   I L+  V       +   ++    K+ DD+ +A   R+K+E +  + +   
Sbjct: 17  TLWYLIVFSILLLA-VKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAETLANEREAAL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
               +E  +I+  AK  A+   ++        ++   +  +      + +A      ++A
Sbjct: 76  KNSRQEATQILSDAKSNAQKTGKQIVSEAMAEASAIREKAKADAAQAETDALNEAREEVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           D SV I  ++I++ ++      + ++ I  + 
Sbjct: 136 DLSVTIAEKVIAKNLSAADQKDLVDQFIKGLN 167


>gi|254454347|ref|ZP_05067784.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
 gi|198268753|gb|EDY93023.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
          Length = 190

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 79/157 (50%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           +   +V ++ IIF+ +++  ++P +L   LD  A+ I+ DI EA+ LRE+++ +L  Y+ 
Sbjct: 33  NTDLIVLIAFIIFIGVLLKYKVPGMLTGLLDKRAEGIKSDIDEAKALREEAQTLLASYER 92

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           K  +V+ +   I+  AK  A +  E+  ++I+      L   E +I   K  A R +  +
Sbjct: 93  KQREVQAQADRIVANAKEEATLAGEQAKEDIKSSIVRRLAAAEDQIASAKASAIREVRNQ 152

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
               +V   +++I+ +      + + +  I+ + +  
Sbjct: 153 AVKVAVAAAQDVIAAQTTPADANKLIDDAIAEVGAKL 189


>gi|160895865|ref|YP_001561447.1| F0F1 ATP synthase subunit B [Delftia acidovorans SPH-1]
 gi|226741431|sp|A9BPU3|ATPF_DELAS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|160361449|gb|ABX33062.1| ATP synthase F0, B subunit [Delftia acidovorans SPH-1]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   + + LV+     +   +   LD  A KI D +  A + +        +
Sbjct: 1   MSINATLFVQAIVFLILVLFTMKFVWPPIAKALDERALKIADGLAAADKAKTDLAAANKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ ++   ET   +  A+ RA+ + EE      +     +     +     ++A+  L
Sbjct: 61  VEQELAQTRNETASRLADAERRAQAIIEEAKARASEEGNKIVAAARAEAEQQTVQAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ ++++  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILRKEVDAGVHADLLNRLKTEL 156


>gi|153806527|ref|ZP_01959195.1| hypothetical protein BACCAC_00791 [Bacteroides caccae ATCC 43185]
 gi|149131204|gb|EDM22410.1| hypothetical protein BACCAC_00791 [Bacteroides caccae ATCC 43185]
          Length = 167

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 62/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F++  I  VI+     P I++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFVAFGIVFVILAKYGFP-IIIRMVEDRKVYIDQSLEVAREANAQLSKLKQEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  + Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILKEAMEERDKIVHEARKQAEIAAQKELDAVRQQIQVEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + +    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKSLQDKEAQMGMIDRMLDEV 161


>gi|225024613|ref|ZP_03713805.1| hypothetical protein EIKCOROL_01490 [Eikenella corrodens ATCC
           23834]
 gi|224942627|gb|EEG23836.1| hypothetical protein EIKCOROL_01490 [Eikenella corrodens ATCC
           23834]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 62/149 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ +   ++ + +   LV      +   +   LD  A KI + +  A R +   E    +
Sbjct: 1   MNINSALIIQIIVFCLLVWFTVKFVWPPIAKALDERASKIAEGLAAAERGKSDFEQAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E  ++  ++  EII  A+ RA  + E+  +     +A      +  +      A+  L
Sbjct: 61  VAELMAEGRDQVAEIITNAEKRASQIVEDAKKQASDEAARVAAQAKADVEQEVNRAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIF 149
             ++A  +V+   +I+  ++N D ++ + 
Sbjct: 121 REQVAALAVKGAEQILCSEINADKHAQLL 149


>gi|163803601|ref|ZP_02197467.1| F0F1 ATP synthase subunit B [Vibrio sp. AND4]
 gi|159172595|gb|EDP57453.1| F0F1 ATP synthase subunit B [Vibrio sp. AND4]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASDQLKEAKRTATEIIDQANKRKSQILDEAREEAQAERQNILAQAEAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERTIDKDAQKDILDNITAKL 156


>gi|299146009|ref|ZP_07039077.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_23]
 gi|298516500|gb|EFI40381.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_23]
          Length = 167

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F+S  I  VI+     P +++  ++     I   +  AR    +   +  +     +
Sbjct: 12  FWMFLSFGIVFVILAKYGFP-VIIKIVEGRKTYIDQSLEVAREANAQLSKLKEEGDALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + +    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKSLEDKEAQMGMIDRMLDEV 161


>gi|149188275|ref|ZP_01866569.1| hypothetical ATP synthase B chain [Vibrio shilonii AK1]
 gi|148837864|gb|EDL54807.1| hypothetical ATP synthase B chain [Vibrio shilonii AK1]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L      +  V +    +   L++ LD   D+I   I       ++ E     
Sbjct: 1   MNLNATMLGQAISFVIFVWLCMKYVWPPLVTLLDERRDEIATGIKNTAAAAKELELAKAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +   ++  E+ + II   + R   L EE  +  ++  A  + + + ++   K + ++ L
Sbjct: 61  GESIVAEAREKAQSIIELGQQRQNQLVEEAAELAQKEKAKIIAEGKAEVESEKSKVRQEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            +++AD  +E   ++I + ++   N  + E  IS +
Sbjct: 121 KSEMADLVIESASKLIRKNLDSKSNRELVEHMISEM 156


>gi|257095880|ref|YP_003169521.1| ATP synthase F0 subunit B [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257048404|gb|ACV37592.1| ATP synthase F0, B subunit [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 58/156 (37%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T           + +    +   L   +      I D +    R + + E    +
Sbjct: 1   MNINATLFGEAIWFGVFIWITMKYVWPPLQKAMADRQKLIADGLAAGERAKHELELAGKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +     + ++ E+I AA+ RA  + EE     +  +   +   + +I     +A+  L
Sbjct: 61  SADALRDAKAKSAELITAAEKRAAQMVEEAKLTAKVEADKVVASAKAEIAQQVEQARAEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++AD +V     I+ ++++   +S +       +
Sbjct: 121 RGRLADLAVAGAERILKREVDAKAHSEMLVALKQEL 156


>gi|148252426|ref|YP_001237011.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
 gi|226741346|sp|A5EAB1|ATPF_BRASB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146404599|gb|ABQ33105.1| ATP synthase subunit B, membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
          Length = 163

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 40/154 (25%), Positives = 79/154 (51%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D    V ++ +I + +  YL +   +L  LD  A++IR+++ EA+RL++++  +L  YK 
Sbjct: 6   DPETWVAIAFVILMGLFAYLGVHRTVLKALDHRAERIRNELEEAKRLKQEAAKVLADYKA 65

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
           + +  E E  EI+ +AK  A+ +A +    +E   A   K  E KI   + +A   + + 
Sbjct: 66  RRASAEREAEEIVTSAKAEAERIAADAKAKMEDFVARRTKAAESKIALAEAQALADVRSA 125

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            AD +V+    ++SQ +   +   +  K I+ + 
Sbjct: 126 AADAAVQAAATVLSQSVKGSLGEDLVAKGIAEVG 159


>gi|163761010|ref|ZP_02168088.1| F0F1 ATP synthase subunit B [Hoeflea phototrophica DFL-43]
 gi|162281791|gb|EDQ32084.1| F0F1 ATP synthase subunit B [Hoeflea phototrophica DFL-43]
          Length = 159

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 90/158 (56%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D +F   + LIIFL I+ Y+++P+++ S LD  AD+IR+++ +A++LRE+++ +L +Y+
Sbjct: 1   MDASFWALVGLIIFLGIMAYIKVPAMMGSALDKRADQIRNELEQAKKLREEAQQLLAEYQ 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E E   I+ AA+  A IL +E     E+  +      EQKI   + +A   + A
Sbjct: 61  RKRKEAEAEAAGILSAAEKEAAILRDEAKAKTEEYVSRRTAMAEQKIQQAEADAINEVRA 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              D +V     +I +K++   + ++F+ ++  +++  
Sbjct: 121 AAVDLAVVAAENLIGKKVDSKASDALFKASLGDLKTRL 158


>gi|153834317|ref|ZP_01986984.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
 gi|148869325|gb|EDL68339.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASDQLKEAKRTATEIIDQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156


>gi|238023069|ref|ZP_04603495.1| hypothetical protein GCWU000324_02993 [Kingella oralis ATCC 51147]
 gi|237865452|gb|EEP66592.1| hypothetical protein GCWU000324_02993 [Kingella oralis ATCC 51147]
          Length = 166

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 62/155 (40%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           + + T +  + + + L +     +   +   LD  ADKI + +  A R +   E    + 
Sbjct: 12  NLNATLIAEVIVFLLLCLFTVKFVWPPIAKALDERADKIAEGLAAAERGKSDFEQAEKKV 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
            E  ++   +  EI+  A+ RA  + E+        +A   +  +         A+  L 
Sbjct: 72  AELLTEGRNQVSEIVANAEKRAAQIVEDAKAQAITEAASITEQAKTNAEQEINRAREALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++A  +V+    I+ +++++  ++ +       +
Sbjct: 132 EQVAALAVKGAESILRREVDEKQHAQMLGALKQEL 166


>gi|22537022|ref|NP_687873.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae 2603V/R]
 gi|25010932|ref|NP_735327.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae NEM316]
 gi|76788233|ref|YP_329604.1| F0F1 ATP synthase subunit B [Streptococcus agalactiae A909]
 gi|76799296|ref|ZP_00781463.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|77406457|ref|ZP_00783513.1| ATP synthase F0, B subunit [Streptococcus agalactiae H36B]
 gi|77407986|ref|ZP_00784736.1| ATP synthase F0, B subunit [Streptococcus agalactiae COH1]
 gi|77410700|ref|ZP_00787059.1| ATP synthase F0, B subunit [Streptococcus agalactiae CJB111]
 gi|77414097|ref|ZP_00790265.1| ATP synthase F0, B subunit [Streptococcus agalactiae 515]
 gi|81744393|sp|Q8E076|ATPF_STRA5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81744548|sp|Q8E5V2|ATPF_STRA3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123601926|sp|Q3K1J9|ATPF_STRA1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|22533879|gb|AAM99745.1|AE014231_3 ATP synthase F0, B subunit [Streptococcus agalactiae 2603V/R]
 gi|23095311|emb|CAD46521.1| H+-transporting ATP synthase b chain [Streptococcus agalactiae
           NEM316]
 gi|76563290|gb|ABA45874.1| ATP synthase F0, B subunit [Streptococcus agalactiae A909]
 gi|76585356|gb|EAO61947.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|77159849|gb|EAO70992.1| ATP synthase F0, B subunit [Streptococcus agalactiae 515]
 gi|77163236|gb|EAO74188.1| ATP synthase F0, B subunit [Streptococcus agalactiae CJB111]
 gi|77173444|gb|EAO76563.1| ATP synthase F0, B subunit [Streptococcus agalactiae COH1]
 gi|77174926|gb|EAO77739.1| ATP synthase F0, B subunit [Streptococcus agalactiae H36B]
          Length = 165

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S  + E  
Sbjct: 20  VLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSNAKTEAN 79

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK       ++     +  +    +   Q I   K EA   +  ++AD +V +  
Sbjct: 80  QIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADLTVLLAE 139

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           +I+   ++ +  S++ +  I  +   
Sbjct: 140 KIMVSNLDKEAQSNLIDSYIKKLGDA 165


>gi|268315887|ref|YP_003289606.1| ATP synthase F0, B subunit [Rhodothermus marinus DSM 4252]
 gi|262333421|gb|ACY47218.1| ATP synthase F0, B subunit [Rhodothermus marinus DSM 4252]
          Length = 171

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/139 (18%), Positives = 55/139 (39%)

Query: 22  YLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKH 81
           Y      +L  L    + I   +  A R   ++  I  + +    + E+E + I+  A+ 
Sbjct: 32  YKFAWKPILQALKEREESIDTSLRRAERALAEARQIQAENERIRREAEQEAQRILREARE 91

Query: 82  RAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMN 141
            A+ L +E  Q               +I   K  A   L A +AD +++   +I+ + ++
Sbjct: 92  EAERLRQEELQKTRVQIQQMQAQARAEIEREKQGALDELRAVVADLAIQAAEKILRESLD 151

Query: 142 DDVNSSIFEKTISSIQSCH 160
            D    + E+ + S+ +  
Sbjct: 152 ADRQRRLVERFLESLPASK 170


>gi|254361681|ref|ZP_04977818.1| H(+)-transporting two-sector ATPase, F(1) beta subunit [Mannheimia
           haemolytica PHL213]
 gi|153093203|gb|EDN74214.1| H(+)-transporting two-sector ATPase, F(1) beta subunit [Mannheimia
           haemolytica PHL213]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   L+  ++     I   +  A + +++  +    
Sbjct: 1   MNLNATLIGQLIAFALFVAFCMKFVWPPLIRVIEERQANIASALASAEKAKQEQADSKAA 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +EE + II  A  R   + E      E      ++    ++   +   +  L
Sbjct: 61  ADQEILRAKEEAQNIIDLATKRRNEILESVQAEAEVERQRIIEQGYAEVESERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  ++    +I+ + ++   N+ I +K ++ +
Sbjct: 121 RQKVAALAIAGAEKIVGRSVDAAANNDIIDKLVAEL 156


>gi|330815042|ref|YP_004358747.1| ATP synthase F0, B subunit [Burkholderia gladioli BSR3]
 gi|327367435|gb|AEA58791.1| ATP synthase F0, B subunit [Burkholderia gladioli BSR3]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 70/156 (44%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T    M + + L       +   L++ LD  A KI D +  A + + +       
Sbjct: 1   MNLNATLFAQMVVFLILAWFTMKFVWPPLINALDERAKKIADGLAAAEKGKAELAAAHKA 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++ ++   + ++ I  A+ RA  +A+E   N +  +A  +   +       ++A+ LL
Sbjct: 61  ADQELAQARTDGQQRIADAEKRAIAVADEIKANAQAEAARIVAQAKADAEQQIVKARELL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A +A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 121 RADVATLAVKGAEQILKREVDQAAHAELLNQLKAEL 156


>gi|297570963|ref|YP_003696737.1| ATP synthase F0 subunit beta [Arcanobacterium haemolyticum DSM
           20595]
 gi|296931310|gb|ADH92118.1| ATP synthase F0, B subunit [Arcanobacterium haemolyticum DSM 20595]
          Length = 186

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/153 (13%), Positives = 58/153 (37%), Gaps = 2/153 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +I +   +Y       +S LD  A+KI + +  A   R +         E+   
Sbjct: 27  WGTVAFLI-VATAIYKFAWPAFMSTLDERAEKIENGLKAADIARAEITEERADLDEQIRN 85

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              +  +I   A   AK +  +        +   +   + +I      A+R L + +   
Sbjct: 86  AHRDAEQIREKATANAKSIVSDAQAQARTEAGQIIDTAQLRIVADTDAARRTLRSDVGAL 145

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           + E+   I+ + + + ++   + ++ +  +++ 
Sbjct: 146 ATELASRIVGESLTDVELAKRVTDRFLDELEAS 178


>gi|111225284|ref|YP_716078.1| F0F1 ATP synthase subunit B [Frankia alni ACN14a]
 gi|122953769|sp|Q0RDB0|ATPF_FRAAA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|111152816|emb|CAJ64560.1| ATP synthase B chain (Subunit I) [Frankia alni ACN14a]
          Length = 198

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 15/156 (9%), Positives = 64/156 (41%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  ++  + +    +   P  +        ++I   I  A   + +++ +L QY+ + +
Sbjct: 30  LIGTLAFGLLVAFFFWKIRPQ-IARTYAQRTERIEGGIARAEAAQREAQALLEQYRAQLT 88

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E   I   A    + + EE   + ++  A   +  + ++   + +    +  ++  
Sbjct: 89  EARAEAARIRDDAHTEGRQIVEELRASAQREIAEIKERADAQLAADRAQIVAQVRREVGV 148

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            ++++  +I+  ++ +    + + +  I+++ +  +
Sbjct: 149 IAIDLASKIVGYQVESTATQARLVDDFIAALDNSAE 184


>gi|152977496|ref|YP_001377013.1| F0F1 ATP synthase subunit B [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|226741304|sp|A7GV60|ATPF_BACCN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|152026248|gb|ABS24018.1| ATP synthase F0, B subunit [Bacillus cytotoxicus NVH 391-98]
          Length = 168

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 65/151 (43%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            + + + L++++       L+  +    + +  +I  A +   +++ ++ + +E   +  
Sbjct: 18  TLVVFLILLVMLRKFAWGPLMGIMKEREEHVASEIDAAEKNHAEAKKLVEEQREMLKQSR 77

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E +E+I  AK +A+   +      ++ +        Q+I   K +A   L  ++A  SV
Sbjct: 78  VEAQELIERAKKQAEEQKDGIIAAAKEEAESIKTSAVQEIQREKEQAIATLQEQVASLSV 137

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           +I  ++I +++ ++    +    I  +    
Sbjct: 138 QIASKVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|253997698|ref|YP_003049762.1| F0F1 ATP synthase subunit B [Methylotenera mobilis JLW8]
 gi|253984377|gb|ACT49235.1| ATP synthase F0, B subunit [Methylotenera mobilis JLW8]
          Length = 156

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 65/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +        L+      +   LL  ++    +I D +  A+  R   E    +
Sbjct: 1   MNINFTLIAQAIAFAVLIWFTVKFVWPPLLKAIETRQKEIADGLAAAQEGRSALEVAAKK 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +   ++ +++  EII  A+ R   + EE   N +      L   + +I      AK  L
Sbjct: 61  SEVTLAEAKQKASEIIAQAEKRGSQIVEEAKGNAKVEGDRILAGAKAEIDQEVNRAKEGL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A+++  ++    +I+ ++++ + +S +  K  + +
Sbjct: 121 RAQVSALAIAGAEKILRKEIDANAHSEMLSKLAAEL 156


>gi|225851924|ref|YP_002732157.1| F0F1 ATP synthase subunit B' [Brucella melitensis ATCC 23457]
 gi|256044106|ref|ZP_05447017.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112904|ref|ZP_05453820.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 3 str. Ether]
 gi|256264564|ref|ZP_05467096.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|260563465|ref|ZP_05833951.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|265990518|ref|ZP_06103075.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994346|ref|ZP_06106903.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|226741364|sp|Q8YFH7|ATPF_BRUME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|2984782|gb|AAC08030.1| ATP synthase subunit B' [Brucella melitensis]
 gi|225640289|gb|ACO00203.1| ATP synthase B' chain [Brucella melitensis ATCC 23457]
 gi|260153481|gb|EEW88573.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|262765459|gb|EEZ11248.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001302|gb|EEZ13877.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094929|gb|EEZ18637.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|326408423|gb|ADZ65488.1| F0F1 ATP synthase subunit B' [Brucella melitensis M28]
 gi|326538137|gb|ADZ86352.1| ATP synthase B' chain [Brucella melitensis M5-90]
          Length = 208

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 67/144 (46%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   ++   D+I  D+ +A RL++ ++N +  Y+++ +
Sbjct: 59  LWLAITFGLFYLFLSRVVLPR-IGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELA 117

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I  AA+ + K  A+    + E +    LK+ E++I  +K +A   +     +
Sbjct: 118 QARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEE 177

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
               IV +++    +    S   +
Sbjct: 178 TMATIVEQLLGLTADKASVSEAVK 201


>gi|23016150|ref|ZP_00055909.1| COG0711: F0F1-type ATP synthase, subunit b [Magnetospirillum
           magnetotacticum MS-1]
          Length = 178

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 74/152 (48%), Gaps = 1/152 (0%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F V ++  I +V + +  +   + + LDA + KI+  + EA +LRE+++ +L  Y+ K
Sbjct: 23  PHFWVDVAF-ILVVALAFKPVSRAIAAALDARSAKIKSRLDEAHKLREEAQEMLATYQRK 81

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
                +E  EII  AK  A+ LA++  +++E       +    +I   + +A R +    
Sbjct: 82  QRDAMKEAEEIIAHAKAEAERLAKQAAKDLEASMKRREQMAMDRIAQAEAQAVREVQNLA 141

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            D ++   +++I + ++     ++ +  I  +
Sbjct: 142 VDVAIGAAQKVIGESLSAAQTGALLDNAIKDL 173


>gi|91226234|ref|ZP_01261074.1| F0F1 ATP synthase subunit B [Vibrio alginolyticus 12G01]
 gi|91189245|gb|EAS75524.1| F0F1 ATP synthase subunit B [Vibrio alginolyticus 12G01]
          Length = 156

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASDQLKEAKRTATEIIEQANKRKSQILDEAREEAQAERQKILAQAEAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERSIDKDAQKDILDNITAKL 156


>gi|30023341|ref|NP_834972.1| F0F1 ATP synthase subunit B [Bacillus cereus ATCC 14579]
 gi|218235641|ref|YP_002370085.1| F0F1 ATP synthase subunit B [Bacillus cereus B4264]
 gi|229050980|ref|ZP_04194529.1| ATP synthase B chain [Bacillus cereus AH676]
 gi|229112723|ref|ZP_04242256.1| ATP synthase B chain [Bacillus cereus Rock1-15]
 gi|229130559|ref|ZP_04259515.1| ATP synthase B chain [Bacillus cereus BDRD-Cer4]
 gi|229147850|ref|ZP_04276191.1| ATP synthase B chain [Bacillus cereus BDRD-ST24]
 gi|229153473|ref|ZP_04281651.1| ATP synthase B chain [Bacillus cereus m1550]
 gi|81433043|sp|Q814V8|ATPF_BACCR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741302|sp|B7HFK6|ATPF_BACC4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29898902|gb|AAP12173.1| ATP synthase B chain [Bacillus cereus ATCC 14579]
 gi|218163598|gb|ACK63590.1| ATP synthase F0, B subunit [Bacillus cereus B4264]
 gi|228630077|gb|EEK86728.1| ATP synthase B chain [Bacillus cereus m1550]
 gi|228635500|gb|EEK91989.1| ATP synthase B chain [Bacillus cereus BDRD-ST24]
 gi|228652898|gb|EEL08780.1| ATP synthase B chain [Bacillus cereus BDRD-Cer4]
 gi|228670704|gb|EEL26015.1| ATP synthase B chain [Bacillus cereus Rock1-15]
 gi|228722357|gb|EEL73753.1| ATP synthase B chain [Bacillus cereus AH676]
          Length = 168

 Score = 77.5 bits (189), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|264676468|ref|YP_003276374.1| ATP synthase F0 B subunit [Comamonas testosteroni CNB-2]
 gi|299531210|ref|ZP_07044621.1| F0F1 ATP synthase subunit B [Comamonas testosteroni S44]
 gi|262206980|gb|ACY31078.1| ATP synthase F0, B subunit [Comamonas testosteroni CNB-2]
 gi|298720793|gb|EFI61739.1| F0F1 ATP synthase subunit B [Comamonas testosteroni S44]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   + + LV+     +   +   LD  A KI D +  A + + +   +  +
Sbjct: 1   MSINATLFVQAIVFLILVLFTMKLVWPPIAKALDERAQKIADGLAAADKAKTELTAVNKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ ++   ET   +  A+ RA+ + EE      +     +     +     + A+  L
Sbjct: 61  VEQELAQTRNETASRLADAERRAQAIIEEAKARATEEGNKIVAAARAEADQQAIAAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  +++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILKKEVNAGIHADLLNRLKTEL 156


>gi|313123403|ref|YP_004033662.1| ATP synthase subunit b [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312279966|gb|ADQ60685.1| ATP synthase subunit b [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
          Length = 168

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    +   I L+  V       +   ++    K+ DD+ +A   R+K+E +  + +   
Sbjct: 17  TLWYLIVFSILLLA-VKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAEILANEREAAL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
               +E  +I+  AK  A+   ++     +  ++   +  +      K +A      ++A
Sbjct: 76  KNSRQEATQILSVAKSNAQKTGKQIVSEAKAEASAIRERAKADAAQAKSDALNEARNEVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           D SV I  ++I++ ++      + ++ I  + 
Sbjct: 136 DLSVTIAEKVIAKNLSAADQKDLVDQFIKGLN 167


>gi|303325901|ref|ZP_07356344.1| putative ATP synthase F0, B subunit [Desulfovibrio sp. 3_1_syn3]
 gi|302863817|gb|EFL86748.1| putative ATP synthase F0, B subunit [Desulfovibrio sp. 3_1_syn3]
          Length = 191

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 22/149 (14%), Positives = 60/149 (40%), Gaps = 1/149 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ +IF  I+ Y  +  +   F       IRD + +    R K+   L   + + ++
Sbjct: 41  WRVLNFVIFAGILWYF-VGGLAKKFFKGRRQLIRDTLDDLEERRAKAREHLAAVEARIAR 99

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
           ++EE + I+  ++ +A+ L +   +   + +   ++                + A +AD 
Sbjct: 100 LDEERKAILEESRVQAENLKQGIMEEARRQAEQIVEQARLTAENEGRSVLAEVRAALADE 159

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSI 156
            V    + +  K+ D  +  +   +++ +
Sbjct: 160 IVGAAEKALRDKLGDGEHDKLIANSLNKV 188


>gi|218711027|ref|YP_002418648.1| F0F1 ATP synthase subunit B [Vibrio splendidus LGP32]
 gi|218324046|emb|CAV20408.1| ATP synthase B chain [Vibrio splendidus LGP32]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   ++  ++    KI D +  A R  +        
Sbjct: 1   MNMNATLLGQAIAFSLFVWFCMKYVWPPIMQAIEERQKKIADGLVAAERAAKDLNLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             E+  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L
Sbjct: 61  ASEQMKEAKRTATEVIDQANKRKAQIIDEAREEAQAERQKILAQAEAEIEAERTRARDDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  ++    +I+ + ++ DV+  +     + +
Sbjct: 121 RKQVATLAIAGAEKILERTIDKDVHDDLLNNITAKL 156


>gi|293603076|ref|ZP_06685510.1| ATP synthase F0 sector subunit B [Achromobacter piechaudii ATCC
           43553]
 gi|292818470|gb|EFF77517.1| ATP synthase F0 sector subunit B [Achromobacter piechaudii ATCC
           43553]
          Length = 176

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 57/155 (36%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           + + T +  M +   L       +   L   +D    KI D +  A + +        + 
Sbjct: 22  NLNATIIFQMLVFFVLGWFTMKFVWPPLTKAMDERRQKIADGLAAAEKGKADLAQAQARV 81

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
               +  + E    I+ A+ +A  L E+  +  E   A  +    Q        A+  L 
Sbjct: 82  SLIEASAKSENHARIIEAEKQAASLIEQARREAEAERARIVAQAAQDAAQEVQRARDALR 141

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             +A  +V+   +I+ ++++   ++ +  +  + +
Sbjct: 142 DDVAALAVKGAEQILKREVDARAHAELLNQLRAQL 176


>gi|47569804|ref|ZP_00240475.1| ATP synthase F0, B subunit [Bacillus cereus G9241]
 gi|206970328|ref|ZP_03231281.1| ATP synthase F0, B subunit [Bacillus cereus AH1134]
 gi|228924045|ref|ZP_04087321.1| ATP synthase B chain [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
 gi|228955556|ref|ZP_04117559.1| ATP synthase B chain [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228988534|ref|ZP_04148621.1| ATP synthase B chain [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|229026748|ref|ZP_04183081.1| ATP synthase B chain [Bacillus cereus AH1272]
 gi|229033941|ref|ZP_04188895.1| ATP synthase B chain [Bacillus cereus AH1271]
 gi|229072776|ref|ZP_04205975.1| ATP synthase B chain [Bacillus cereus F65185]
 gi|229082523|ref|ZP_04214986.1| ATP synthase B chain [Bacillus cereus Rock4-2]
 gi|229158871|ref|ZP_04286928.1| ATP synthase B chain [Bacillus cereus ATCC 4342]
 gi|229181557|ref|ZP_04308883.1| ATP synthase B chain [Bacillus cereus 172560W]
 gi|229193561|ref|ZP_04320505.1| ATP synthase B chain [Bacillus cereus ATCC 10876]
 gi|47553546|gb|EAL11926.1| ATP synthase F0, B subunit [Bacillus cereus G9241]
 gi|206734905|gb|EDZ52074.1| ATP synthase F0, B subunit [Bacillus cereus AH1134]
 gi|228589866|gb|EEK47741.1| ATP synthase B chain [Bacillus cereus ATCC 10876]
 gi|228601925|gb|EEK59420.1| ATP synthase B chain [Bacillus cereus 172560W]
 gi|228624482|gb|EEK81252.1| ATP synthase B chain [Bacillus cereus ATCC 4342]
 gi|228700955|gb|EEL53478.1| ATP synthase B chain [Bacillus cereus Rock4-2]
 gi|228710267|gb|EEL62242.1| ATP synthase B chain [Bacillus cereus F65185]
 gi|228728367|gb|EEL79389.1| ATP synthase B chain [Bacillus cereus AH1271]
 gi|228734543|gb|EEL85204.1| ATP synthase B chain [Bacillus cereus AH1272]
 gi|228771151|gb|EEM19630.1| ATP synthase B chain [Bacillus thuringiensis serovar tochigiensis
           BGSC 4Y1]
 gi|228804118|gb|EEM50734.1| ATP synthase B chain [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228835535|gb|EEM80900.1| ATP synthase B chain [Bacillus thuringiensis serovar huazhongensis
           BGSC 4BD1]
          Length = 168

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|169826596|ref|YP_001696754.1| ATP synthase B chain [Lysinibacillus sphaericus C3-41]
 gi|226741517|sp|B1HM52|ATPF_LYSSC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|168991084|gb|ACA38624.1| ATP synthase B chain [Lysinibacillus sphaericus C3-41]
          Length = 173

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 67/153 (43%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +++ + L+ ++       L+  +    + +  +I  A + R++S   L + K    +
Sbjct: 21  IATLAIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKESHQFLEEQKSLLKE 80

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E + I+  AK + ++  +E        +    +   ++I   K +A   +  ++   
Sbjct: 81  ARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVRDEVVSL 140

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           SV    +++S+++++  N ++ E+TI+      
Sbjct: 141 SVLAASKVLSKEISEADNRALIEETIAKAGEAR 173


>gi|156972761|ref|YP_001443667.1| F0F1 ATP synthase subunit B [Vibrio harveyi ATCC BAA-1116]
 gi|226694377|sp|A7N0Y5|ATPF1_VIBHB RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|156524355|gb|ABU69441.1| hypothetical protein VIBHAR_00426 [Vibrio harveyi ATCC BAA-1116]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASDQMKEAKRTATEIIDQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERTIDKDAQKDILDNITAKL 156


>gi|114322020|ref|YP_743703.1| F0F1 ATP synthase subunit B [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228414|gb|ABI58213.1| ATP synthase F0, B subunit [Alkalilimnicola ehrlichii MLHE-1]
          Length = 146

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 17/143 (11%), Positives = 53/143 (37%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
               V      +   + + +     +I D +    R +++ +    +  +   +  E+  
Sbjct: 4   FALFVWFTMKYVWPPIQTAMADRQKQIADGLAAGERGQKELDQAKSEVDKMLREAREQAS 63

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           ++I  A  R   L E+  +   Q +   L     +I     +A+  L  ++ + +V    
Sbjct: 64  QVIAQANKRQSELVEQAREEARQEAERVLAQARSEIDTEISQARDALRKEVVNLAVAGSS 123

Query: 134 EIISQKMNDDVNSSIFEKTISSI 156
            I+ ++++   +  + +  +  +
Sbjct: 124 RILKREIDAKAHKDLIDDLVKQL 146


>gi|108760214|ref|YP_628675.1| ATP synthase F0 subunit B [Myxococcus xanthus DK 1622]
 gi|108464094|gb|ABF89279.1| ATP synthase F0, B subunit [Myxococcus xanthus DK 1622]
          Length = 172

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I   +V+  +    +LS ++    +I   I  A+R R ++E +L   K   +
Sbjct: 9   FWTLVTFVI-AAVVLKWKAWGPILSLVEEREKQIASSIESAKRERAEAEKLLADQKTAIA 67

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E  E++       +   EE      + +        ++I   K +A   + +   D
Sbjct: 68  EARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKLSARREIDEQKAKAIAEVRSMAVD 127

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            ++E+  ++IS++M+D    ++ E+ +  +
Sbjct: 128 LAMEVAGKLISERMDDSKQRALAEQFVQGL 157


>gi|110633055|ref|YP_673263.1| F0F1 ATP synthase subunit B' [Mesorhizobium sp. BNC1]
 gi|123058180|sp|Q11KH7|ATPF1_MESSB RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|110284039|gb|ABG62098.1| H+-transporting two-sector ATPase, B/B' subunit [Chelativorans sp.
           BNC1]
          Length = 193

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 69/144 (47%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   L+  +D+I  D+ +A R++E ++  +  Y+++ +
Sbjct: 46  LWLAITFGLFYLFLKRVVLPR-IAGILEVRSDRIAQDLDQAARMKEDADAAVAAYEQELA 104

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  ++   I   A+  AK  A    + +E      LK+ E +I  +K  A   +     +
Sbjct: 105 EARKKAAAIAQEARDTAKAEAAAERRKVESGLDSKLKEAEARIALIKDTALSDVGTIAEE 164

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV+E++  K++    S+  +
Sbjct: 165 TAAAIVQELVGGKVDKASLSAAVK 188


>gi|304391257|ref|ZP_07373201.1| ATP synthase B' chain [Ahrensia sp. R2A130]
 gi|303296613|gb|EFL90969.1| ATP synthase B' chain [Ahrensia sp. R2A130]
          Length = 174

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + +S  +F  I+  + +P  +   L+  + +I  D+ EA RL+++S+  +  Y++  +
Sbjct: 28  LWLVLSFGLFYYIMSRVVLPR-ISGILETRSGRIAQDLDEANRLKDESDAAIAAYEQDLA 86

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             +    +I   A+   K  A+     +E      + D E +I  +K +A   + +   +
Sbjct: 87  TAKTNAHKIAQEARDAGKAEADVKRAEVEADMTARVADAEARIAKIKSDAMSDVGSIATE 146

Query: 127 FSVEIVREIISQKMNDDVNSSIFEK 151
            +  +V +++  K+     +     
Sbjct: 147 TAETLVSQLLGSKVTKAEVAKAVSN 171


>gi|261491747|ref|ZP_05988327.1| F0F1 ATP synthase subunit B [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261495503|ref|ZP_05991950.1| F0F1 ATP synthase subunit B [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261308837|gb|EEY10093.1| F0F1 ATP synthase subunit B [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312586|gb|EEY13709.1| F0F1 ATP synthase subunit B [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 60/156 (38%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   L+  ++     I   +  A + +++  +    
Sbjct: 1   MNLNATLIGQLIAFALFVAFCMKFVWPPLIRAIEERQANIASALASAEKAKQEQADSKAA 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +EE + II  A  R   + E      E      ++    ++   +   +  L
Sbjct: 61  ADQEILRAKEEAQNIIDLATKRRNEILESVQAEAEVERQRIIEQGYAEVESERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  ++    +I+ + ++   N+ I +K ++ +
Sbjct: 121 RQKVAALAIAGAEKIVGRSVDTAANNDIIDKLVAEL 156


>gi|228961573|ref|ZP_04123182.1| ATP synthase B chain [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228798055|gb|EEM45059.1| ATP synthase B chain [Bacillus thuringiensis serovar pakistani str.
           T13001]
          Length = 168

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQALDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|197132338|gb|ACH47687.1| ATP synthase CF0 subunit I [Erodium chrysanthum]
          Length = 184

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/151 (13%), Positives = 59/151 (39%), Gaps = 1/151 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++L + L ++++     +L   LD    +I + I  +  LR  +   L +   +  KV+ 
Sbjct: 32  INLSVVLGVLIFFG-KGVLNDLLDNRKQRIVNTIRNSEELRGGAIEELEKAHARLRKVKT 90

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           +  +  +    RA+    +      +    +     + I + +  A   +   +   ++E
Sbjct: 91  DMEQFRVNEYSRAERKRADLITAAYKQLEQFENFKNESILFEQQRAINQVRQWVFQEALE 150

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              +I+++ +N +++       I    S  +
Sbjct: 151 GALQILNRSLNTELHLRTISANIGLFGSLKE 181


>gi|311113391|ref|YP_003984613.1| ATP synthase F0 sector subunit B [Rothia dentocariosa ATCC 17931]
 gi|310944885|gb|ADP41179.1| ATP synthase F0 sector subunit B [Rothia dentocariosa ATCC 17931]
          Length = 185

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 61/155 (39%), Gaps = 2/155 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +  +I   IV    +P           + I   + +A + + ++     +Y ++   
Sbjct: 26  ITVVGFVILYFIVHKYVVP-AFEKIYQDRKEAIEGGLAKAEKAQAEAAAAREEYNQQLEN 84

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E ++I   A+   + +     +     +     + ++ I   +L A   L  ++   
Sbjct: 85  ARLEAQKIREEARTEGESIIAAARERATVEAQRITDNAQKTIEAERLAASVSLRHEVGTL 144

Query: 128 SVEIVREIISQKMNDDVNS-SIFEKTISSIQSCHQ 161
           +  +  +I+ + ++DD  S  + ++ ++ +++  Q
Sbjct: 145 ATTLAGKIVGEALDDDERSARVVDRFLADLETEQQ 179


>gi|50083465|ref|YP_044975.1| F0F1 ATP synthase subunit B [Acinetobacter sp. ADP1]
 gi|81393962|sp|Q6FFK4|ATPF_ACIAD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|49529441|emb|CAG67153.1| membrane-bound ATP synthase, F0 sector, subunit b [Acinetobacter
           sp. ADP1]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   L++ +     KI D +  A + +    +   Q
Sbjct: 1   MNINLTLIGQAIAFAIFVAFCMKFVWPPLINAISERQRKIADGLNAAEKAKADLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K++    + +  ++I  A  RA  L EE             +  ++ +      A+  L
Sbjct: 61  VKQELDAAKAQAAQLIEQANRRAAQLIEEARTQATAEGERIRQQSKETVDQEINAAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I++Q+++   ++++ E+  + +
Sbjct: 121 RQQVAALAVDGAEKILNQQVDQQAHAAMLEQLAAKL 156


>gi|325684410|gb|EGD26578.1| ATP synthase F0 sector subunit B [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 168

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 63/152 (41%), Gaps = 1/152 (0%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           T    +   I L+  V       +   ++    K+ DD+ +A   R+K+E +  + +   
Sbjct: 17  TLWYLIVFSILLLA-VKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAEILANEREAAL 75

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
               +E  +I+  AK  A+ + ++     +  ++   +  +      K +A      ++A
Sbjct: 76  KNSRQEATQILSVAKSNAQKIGKQIVSEAKAEASAIRERAKADAAQAKTDALNEARNEVA 135

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           D SV I  ++I++ ++      + ++ I  + 
Sbjct: 136 DLSVTIAEKVIAKNLSAADQKDLVDQFIKGLN 167


>gi|33151288|ref|NP_872641.1| F0F1 ATP synthase subunit B [Haemophilus ducreyi 35000HP]
 gi|81713090|sp|Q7VPP4|ATPF_HAEDU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|33147508|gb|AAP95030.1| ATP synthase B chain [Haemophilus ducreyi 35000HP]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 24/156 (15%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   L+  ++     I + +  A + +++  +  + 
Sbjct: 1   MNLNATLIGQLIAFALFVAFCMKYVWPPLIKAIEERQANIANALSSAEKAKQEQADSKVL 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++  K +EE ++II  A  R   + E    + E      ++    +I   +   +  L
Sbjct: 61  AEQEIIKAKEEAQKIIDLATKRRNEILESVQADAEVERQRIIEQGHAEIDSERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +V     I+ + ++   N+ I +K ++ +
Sbjct: 121 RQKVAALAVAGAERIVGRSVDTAANNDIIDKLVAEL 156


>gi|76800063|ref|ZP_00781968.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
 gi|76584627|gb|EAO61436.1| ATP synthase F0, B subunit [Streptococcus agalactiae 18RS21]
          Length = 165

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S  + E  
Sbjct: 20  VLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSNAKTEAN 79

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK       ++     +  +    +   Q I   K EA   +  ++AD +V +  
Sbjct: 80  QIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADLTVLLAE 139

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           +I+   ++ +  S++ +  I  +   
Sbjct: 140 KIMVSNLDKEAQSNLIDSYIXKLGDA 165


>gi|330718992|ref|ZP_08313592.1| F0F1-type ATP synthase, subunit b [Leuconostoc fallax KCTC 3537]
          Length = 168

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 67/153 (43%), Gaps = 1/153 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++ ++ + ++        L++ LD  ADKI  D+  A   R+++E +  + + + +
Sbjct: 16  LFVLIAFLLLMWVLSK-VAYGPLMNILDQRADKISSDLDGAETARQQAEELASKRQGELA 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E  +++  AK  A+  ++         +       E +   +K +A       +A 
Sbjct: 75  NARNEATKVVADAKASAQKQSDVLVSQASDRAQAINSQAEVEAQKLKDDAISSAKNDVAA 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
            SV I  +++ ++++ +   ++ +  IS ++  
Sbjct: 135 LSVAIASKLMQKELSLNDQQALIDAYISDLEKS 167


>gi|29346126|ref|NP_809629.1| ATP synthase subunit B [Bacteroides thetaiotaomicron VPI-5482]
 gi|253568450|ref|ZP_04845861.1| ATP synthase B subunit [Bacteroides sp. 1_1_6]
 gi|298385491|ref|ZP_06995049.1| ATP synthase F0, B subunit [Bacteroides sp. 1_1_14]
 gi|81740940|sp|Q8A9U9|ATPF_BACTN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29338020|gb|AAO75823.1| ATP synthase B subunit [Bacteroides thetaiotaomicron VPI-5482]
 gi|251842523|gb|EES70603.1| ATP synthase B subunit [Bacteroides sp. 1_1_6]
 gi|298261632|gb|EFI04498.1| ATP synthase F0, B subunit [Bacteroides sp. 1_1_14]
          Length = 167

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 65/151 (43%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F +F++  +  VI+     P I++  ++     I   +  AR    +  ++  + +   +
Sbjct: 12  FWMFVAFGVVFVILAKYGFP-IIIKMVEGRKTYIDQSLEVAREANAQLAHLKEEGEALVA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A      +  E  +  E  +   L  ++Q+I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILKEAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            SV+I  +++ + + + +    + ++ +  +
Sbjct: 131 LSVDIAEKVLRKNLQDKESQMGMIDRMLDEV 161


>gi|86742392|ref|YP_482792.1| F0F1 ATP synthase subunit B [Frankia sp. CcI3]
 gi|123723516|sp|Q2J6M9|ATPF_FRASC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86569254|gb|ABD13063.1| ATP synthase F0 subcomplex B subunit [Frankia sp. CcI3]
          Length = 196

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 16/156 (10%), Positives = 63/156 (40%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
            +  +S  + +    +   P  +        ++I   +  A   + +++ +L QY+ + +
Sbjct: 29  LIGTLSFALLVAFFFWKIRPQ-IARTYAQRTERIEGGLARAEAAQREAQALLEQYRAQLA 87

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E   I   A    + + EE     ++  A      + ++   + +    +  ++ +
Sbjct: 88  EARTEAARIREEAHSEGRQITEELRAAAQREIAEIKARADAQLAADRAQIVAQVRREVGE 147

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            +V++  +I+  ++ +    + + +  I+++ +  +
Sbjct: 148 IAVDLASKIVGFQLESSATQNRLIDDFIAALDNSAE 183


>gi|294501864|ref|YP_003565564.1| ATP synthase F0 subunit B [Bacillus megaterium QM B1551]
 gi|114616|sp|P20601|ATPF_BACMQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|142557|gb|AAA82522.1| ATP synthase b subunit [Bacillus megaterium]
 gi|294351801|gb|ADE72130.1| ATP synthase F0, B subunit [Bacillus megaterium QM B1551]
          Length = 172

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 65/151 (43%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
               +  +I L ++        ++  +    + I  +I EA +  E+++ ++ + +E   
Sbjct: 20  LFQLVMFLILLALLQKF-AFGPVMGIMKKREEHIAGEIDEAEKQNEEAKKLVEEQREILK 78

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +E + ++  A+  A+   EE      + S       +Q+I   K +A   L  ++A 
Sbjct: 79  QSRQEVQVMMENARKSAEDKKEEIVAAAREESERLKAAAKQEIEQQKDQAVAALREQVAS 138

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            SV I  ++I +++++     +  + I  + 
Sbjct: 139 LSVLIASKVIEKELSEQDQEKLIHEYIQEVG 169


>gi|229076524|ref|ZP_04209484.1| ATP synthase B chain [Bacillus cereus Rock4-18]
 gi|229099742|ref|ZP_04230667.1| ATP synthase B chain [Bacillus cereus Rock3-29]
 gi|229105902|ref|ZP_04236526.1| ATP synthase B chain [Bacillus cereus Rock3-28]
 gi|229118805|ref|ZP_04248154.1| ATP synthase B chain [Bacillus cereus Rock1-3]
 gi|228664606|gb|EEL20099.1| ATP synthase B chain [Bacillus cereus Rock1-3]
 gi|228677476|gb|EEL31729.1| ATP synthase B chain [Bacillus cereus Rock3-28]
 gi|228683631|gb|EEL37584.1| ATP synthase B chain [Bacillus cereus Rock3-29]
 gi|228706557|gb|EEL58770.1| ATP synthase B chain [Bacillus cereus Rock4-18]
          Length = 168

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 62/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + +  +I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTSEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|218679067|ref|ZP_03526964.1| F0F1 ATP synthase subunit B [Rhizobium etli CIAT 894]
          Length = 157

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 89/152 (58%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
           H D TF  F+ L++FL +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y
Sbjct: 5   HLDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEY 64

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           + K  + E E   I+ AA+  A++L  E  +  E+  A      EQKI   + EA + + 
Sbjct: 65  QRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVANRTALSEQKIKQAEAEAMKAVR 124

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSIFEKTI 153
           +   D ++     +++++ +  V S +F   I
Sbjct: 125 SAAVDLAIAAAETVLAKQADGKVQSELFGNAI 156


>gi|50842723|ref|YP_055950.1| F0F1 ATP synthase subunit B [Propionibacterium acnes KPA171202]
 gi|289425215|ref|ZP_06426992.1| ATP synthase F0, B subunit [Propionibacterium acnes SK187]
 gi|289428508|ref|ZP_06430192.1| ATP synthase F0, B subunit [Propionibacterium acnes J165]
 gi|81611638|sp|Q6A8C3|ATPF_PROAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|50840325|gb|AAT82992.1| ATP synthase B chain [Propionibacterium acnes KPA171202]
 gi|289154193|gb|EFD02881.1| ATP synthase F0, B subunit [Propionibacterium acnes SK187]
 gi|289158202|gb|EFD06421.1| ATP synthase F0, B subunit [Propionibacterium acnes J165]
 gi|313764225|gb|EFS35589.1| ATP synthase F0, B subunit [Propionibacterium acnes HL013PA1]
 gi|313791917|gb|EFS40018.1| ATP synthase F0, B subunit [Propionibacterium acnes HL110PA1]
 gi|313801601|gb|EFS42841.1| ATP synthase F0, B subunit [Propionibacterium acnes HL110PA2]
 gi|313807744|gb|EFS46231.1| ATP synthase F0, B subunit [Propionibacterium acnes HL087PA2]
 gi|313812720|gb|EFS50434.1| ATP synthase F0, B subunit [Propionibacterium acnes HL025PA1]
 gi|313818781|gb|EFS56495.1| ATP synthase F0, B subunit [Propionibacterium acnes HL046PA2]
 gi|313820553|gb|EFS58267.1| ATP synthase F0, B subunit [Propionibacterium acnes HL036PA1]
 gi|313822642|gb|EFS60356.1| ATP synthase F0, B subunit [Propionibacterium acnes HL036PA2]
 gi|313825425|gb|EFS63139.1| ATP synthase F0, B subunit [Propionibacterium acnes HL063PA1]
 gi|313827388|gb|EFS65102.1| ATP synthase F0, B subunit [Propionibacterium acnes HL063PA2]
 gi|313838314|gb|EFS76028.1| ATP synthase F0, B subunit [Propionibacterium acnes HL086PA1]
 gi|314915703|gb|EFS79534.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA4]
 gi|314917928|gb|EFS81759.1| ATP synthase F0, B subunit [Propionibacterium acnes HL050PA1]
 gi|314920311|gb|EFS84142.1| ATP synthase F0, B subunit [Propionibacterium acnes HL050PA3]
 gi|314924918|gb|EFS88749.1| ATP synthase F0, B subunit [Propionibacterium acnes HL036PA3]
 gi|314931531|gb|EFS95362.1| ATP synthase F0, B subunit [Propionibacterium acnes HL067PA1]
 gi|314955542|gb|EFS99945.1| ATP synthase F0, B subunit [Propionibacterium acnes HL027PA1]
 gi|314957916|gb|EFT02019.1| ATP synthase F0, B subunit [Propionibacterium acnes HL002PA1]
 gi|314960557|gb|EFT04659.1| ATP synthase F0, B subunit [Propionibacterium acnes HL002PA2]
 gi|314962573|gb|EFT06673.1| ATP synthase F0, B subunit [Propionibacterium acnes HL082PA1]
 gi|314967564|gb|EFT11663.1| ATP synthase F0, B subunit [Propionibacterium acnes HL037PA1]
 gi|314978728|gb|EFT22822.1| ATP synthase F0, B subunit [Propionibacterium acnes HL072PA2]
 gi|314987896|gb|EFT31987.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA2]
 gi|314989707|gb|EFT33798.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA3]
 gi|315077787|gb|EFT49838.1| ATP synthase F0, B subunit [Propionibacterium acnes HL053PA2]
 gi|315080414|gb|EFT52390.1| ATP synthase F0, B subunit [Propionibacterium acnes HL078PA1]
 gi|315084743|gb|EFT56719.1| ATP synthase F0, B subunit [Propionibacterium acnes HL027PA2]
 gi|315085427|gb|EFT57403.1| ATP synthase F0, B subunit [Propionibacterium acnes HL002PA3]
 gi|315088515|gb|EFT60491.1| ATP synthase F0, B subunit [Propionibacterium acnes HL072PA1]
 gi|315098762|gb|EFT70738.1| ATP synthase F0, B subunit [Propionibacterium acnes HL059PA2]
 gi|315101468|gb|EFT73444.1| ATP synthase F0, B subunit [Propionibacterium acnes HL046PA1]
 gi|315105841|gb|EFT77817.1| ATP synthase F0, B subunit [Propionibacterium acnes HL030PA1]
 gi|315108760|gb|EFT80736.1| ATP synthase F0, B subunit [Propionibacterium acnes HL030PA2]
 gi|327331716|gb|EGE73453.1| ATP synthase F0, B subunit [Propionibacterium acnes HL096PA3]
 gi|327450554|gb|EGE97208.1| ATP synthase F0, B subunit [Propionibacterium acnes HL087PA3]
 gi|327453364|gb|EGF00019.1| ATP synthase F0, B subunit [Propionibacterium acnes HL092PA1]
 gi|327454107|gb|EGF00762.1| ATP synthase F0, B subunit [Propionibacterium acnes HL083PA2]
 gi|328753190|gb|EGF66806.1| ATP synthase F0, B subunit [Propionibacterium acnes HL025PA2]
 gi|328753971|gb|EGF67587.1| ATP synthase F0, B subunit [Propionibacterium acnes HL087PA1]
 gi|328754704|gb|EGF68320.1| ATP synthase F0, B subunit [Propionibacterium acnes HL020PA1]
 gi|332675647|gb|AEE72463.1| ATP synthase subunit b [Propionibacterium acnes 266]
          Length = 184

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V + L++ L  ++   +        +   + I+  I  A R + +++  L +Y+ + + 
Sbjct: 20  IVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLAS 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I   AK +   +  E   N ++ +    +    +I   + +A R + A+I   
Sbjct: 80  ARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRAEIGGL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSI 156
           +  +   I+ + + +D    +  ++ +SS+
Sbjct: 140 ATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|327329865|gb|EGE71619.1| ATP synthase F0, B subunit [Propionibacterium acnes HL097PA1]
          Length = 184

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +V + L++ L  ++   +        +   + I+  I  A R + +++  L +Y+ + + 
Sbjct: 20  IVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLAS 79

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
             +E  +I   AK +   +  E   N ++ +    +    +I   + +A R + A+I   
Sbjct: 80  ARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQTERDQAVREVRAEIGGL 139

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSI 156
           +  +   I+ + + +D    +  ++ +SS+
Sbjct: 140 ATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|239944297|ref|ZP_04696234.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 15998]
          Length = 175

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 62/156 (39%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +   I   +     +P  +   LD   + I   I +A   + +++++L QYK + ++
Sbjct: 19  IGLICFSIVFFVFYKKLLP-AINKALDERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 77

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +  ++ +E     ++     +     +I   +  A   L   +   
Sbjct: 78  ARHEAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKL 137

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S   ++ +  +++  + 
Sbjct: 138 ATDLAGKLVGESLQDHARQSGTVDRFLDELEAKAEA 173


>gi|153809941|ref|ZP_01962609.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174]
 gi|149834119|gb|EDM89199.1| hypothetical protein RUMOBE_00322 [Ruminococcus obeum ATCC 29174]
          Length = 167

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 72/155 (46%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +  +   V ++   +   +   L+    K   +I +A + +E++E +  +Y++ 
Sbjct: 12  WNFIATICNLFIQVYLIKRFLFKPVNEMLEKRRAKADAEIQDAVKAKEEAEVMKAEYEKN 71

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + +E+  +I+L A+  A + +EE  +          +  E+ I   + +A   +  +I
Sbjct: 72  MQEAKEKANDIVLTAQKTAAVQSEEMLKEASSQVTAMKEKAEKDIAQERRKAVNEIKGEI 131

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +VEI  ++I +++N++ ++ +    I ++   
Sbjct: 132 GGMAVEIAGKVIEREINEEDHTKLINDFIENVGEA 166


>gi|146318830|ref|YP_001198542.1| F0F1-type ATP synthase subunit B [Streptococcus suis 05ZYH33]
 gi|146321039|ref|YP_001200750.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223932792|ref|ZP_03624789.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|253751916|ref|YP_003025057.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|253753739|ref|YP_003026880.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|253755383|ref|YP_003028523.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|330832981|ref|YP_004401806.1| F0F1-type ATP synthase subunit b [Streptococcus suis ST3]
 gi|226696181|sp|A4W1W1|ATPF_STRS2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696183|sp|A4VVK3|ATPF_STRSY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145689636|gb|ABP90142.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 05ZYH33]
 gi|145691845|gb|ABP92350.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223898501|gb|EEF64865.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|251816205|emb|CAZ51832.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|251817847|emb|CAZ55600.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|251819985|emb|CAR46135.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|292558491|gb|ADE31492.1| ATP synthase F0, subunit B [Streptococcus suis GZ1]
 gi|319758277|gb|ADV70219.1| F0F1-type ATP synthase, subunit b [Streptococcus suis JS14]
 gi|329307204|gb|AEB81620.1| F0F1-type ATP synthase, subunit b [Streptococcus suis ST3]
          Length = 168

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 28/151 (18%), Positives = 74/151 (49%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F++  +    L+I++ +     +    +  A+KI +DI  A      + N++ Q +++  
Sbjct: 16  FILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANLVQQREDELV 75

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   E+++II  A  RAK+  +   +  +       +  + +I   K EA+  L  ++A+
Sbjct: 76  QGRIESQKIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQENLRVQVAE 135

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +V++  +II + ++   +S++ ++ +  + 
Sbjct: 136 LAVDLASKIILEDLDQQAHSNLIDRYLDKLG 166


>gi|261367329|ref|ZP_05980212.1| ATP synthase F0, B subunit [Subdoligranulum variabile DSM 15176]
 gi|282570087|gb|EFB75622.1| ATP synthase F0, B subunit [Subdoligranulum variabile DSM 15176]
          Length = 168

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 65/155 (41%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            T L     ++    V+   +   +   +D    +I +   EA   ++K+ ++  +Y+  
Sbjct: 13  WTALFTFCNMLITFAVLRHFLFKPVKRMIDDRQQEIDNMYAEAADAKQKAADLEKEYQAH 72

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
              ++ E  +++  A  RA+   EE        +       E ++   + +A   L  +I
Sbjct: 73  LQSIKAEQDDMLREATTRAQKREEEIVNAARAEAQALRNAAEAEMAQERKKAVNDLKNEI 132

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +VEI  +++ +++N   + ++ ++ I ++   
Sbjct: 133 GGIAVEIASKVVEREINTADHQALIDEFIRNVGDA 167


>gi|220927390|ref|YP_002502692.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951997|gb|ACL62389.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 187

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/145 (17%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             V ++  +   ++  + IP  +   L     ++  D+ EA R++  ++     Y     
Sbjct: 39  LWVAITFGLLYYLMSRVAIPR-ITGLLHERQMRLAGDLDEAARMKTDADAARESYARSLK 97

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + +++ + I  A +      AE   +++E   A  L + E +I    + A   +    AD
Sbjct: 98  EAQDKAKGIAQATRDSLAAEAETRRKSLEADLAAKLAESEAQIRSRTVSAMSNVREVAAD 157

Query: 127 FSVEIVREIISQKMNDDVNSSIFEK 151
            +  IV  +I Q  +     + +++
Sbjct: 158 AATAIVERLIGQTPDRAAVEAAYDR 182


>gi|291560275|emb|CBL39075.1| ATP synthase, F0 subunit b [butyrate-producing bacterium SSC/2]
          Length = 160

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 68/155 (43%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D   +  +  I+   +++   +   +   ++     I  D+ +A + + ++E I  +Y+
Sbjct: 5   LDWGIIWPIVNIVVFYLLLRKFLFGPVSEVMEKRKKMISSDLDDAAQTKAEAEEIKQEYE 64

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +  ++ ++E  +I+  A+ RAK   +      ++  AL  ++  + I   K +    L  
Sbjct: 65  KNLAQAKDEAGQIVSDARTRAKNEYQNKMDQTKEEIALMRENARKDIEAEKQKTIAGLQT 124

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           +IA  ++    +++ ++ ND  N  + +  +    
Sbjct: 125 EIAGIALMAASKVVEKEANDKGNEKLLDDFLKEAG 159


>gi|332702723|ref|ZP_08422811.1| ATP synthase subunit b [Desulfovibrio africanus str. Walvis Bay]
 gi|332552872|gb|EGJ49916.1| ATP synthase subunit b [Desulfovibrio africanus str. Walvis Bay]
          Length = 191

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 65/150 (43%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           FL  +   I +V +++      +  F      +I+ ++ +    R+++E  L + ++  S
Sbjct: 39  FLFRVVNFILVVAIIWKFAGKQIKEFFKGRQYQIKTELEDLDARRKQAEVKLKEVEKSIS 98

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
            +E E + I+   + + + L      + ++ +       E  +      A   L A++AD
Sbjct: 99  NIETEKKTILDDYRKQGEALKASIVADAQRKAENIKAQAETAVSQEVKLATERLRAEVAD 158

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             VE   +++ +K++D     + +  ++ +
Sbjct: 159 MVVEAAEKMLKEKLSDKKQQQLVDDYVTKV 188


>gi|288957579|ref|YP_003447920.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
 gi|288909887|dbj|BAI71376.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
          Length = 216

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 58/149 (38%), Gaps = 1/149 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++  +   ++    +P  +   L+A  ++I  D+ +A +L+E++E IL Q ++  +
Sbjct: 66  FWLALTFGVLYHLMSKKALPR-VAEVLEARQERISRDLAKAAQLKEEAEAILAQVEKSLA 124

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E + +I       +   +     +    A  L+  E  I   K +A   + A+   
Sbjct: 125 GARAEAQGVIAQVSAEIEANNQARQGQLNADIAERLRSAEASIATAKDQALANIRAESTG 184

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISS 155
              +I   +    ++     +     +  
Sbjct: 185 IVRDIAGRLAGVDVDPAQADAAVAAVLEE 213


>gi|300024394|ref|YP_003757005.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526215|gb|ADJ24684.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 187

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/144 (15%), Positives = 63/144 (43%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + ++ +  L ++  + +P  +   L+   D+I+ D+  A RL+++++  L  Y++  +
Sbjct: 40  FWLVLTFVALLFVMSRIALPR-VGDVLEERRDRIKRDLESAARLKDETDAALANYEKALA 98

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
                   I    + +     E     ++   A+ L+D E +I   K +A   +     +
Sbjct: 99  DARSNASGIAKETREKLAAETEAERHRVDAQIAVKLQDAEARISTTKSKAVSAIGEVATE 158

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  +V ++I   ++ +    + +
Sbjct: 159 TARAVVSKLIGHDVSPEDVKKVLQ 182


>gi|319784763|ref|YP_004144239.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170651|gb|ADV14189.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 199

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 66/144 (45%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   +D   D+I  D+ +A RL+ +++  +  Y+++ +
Sbjct: 53  LWLAITFGLFYLFLKRVVMPR-VGGIIDVRNDRITQDLDQAARLKGEADAAVAAYEQELA 111

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + + +   I   A   AK  A+   + +E      L + E +I  +K  A + + +   D
Sbjct: 112 EAKTKANAIGQQANDAAKAEADTARKKVEAALDAKLGEAEARISSIKANAMKEVGSIAED 171

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV  ++  K +    ++  +
Sbjct: 172 TASAIVEALVGGKASKAEIAAAVK 195


>gi|8708912|gb|AAF78803.1| Fo ATP synthase B chain [Bradyrhizobium japonicum]
          Length = 169

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 62/122 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M FD    V ++ +I +V+  YL +    ++ LD  A +I+ ++ +A RL++++  +L  
Sbjct: 10  MFFDPETWVAIAFVILMVVFGYLGVFKSAMTALDHRAARIKAELDDATRLKQEAAKVLAD 69

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YK + +  E E  +II  AK  A+ +A E    +E   A   K  E KI   + +A   +
Sbjct: 70  YKARSATAEREAADIIANAKVEAERIATEAKAKMEDFVARRTKTAESKIALAEAQAVADV 129

Query: 121 YA 122
            A
Sbjct: 130 RA 131


>gi|260460367|ref|ZP_05808619.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259034012|gb|EEW35271.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 199

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 66/144 (45%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   +D   D+I  D+ +A +L+ +++  +  Y+++ +
Sbjct: 53  LWLAITFGLFYLFLKRVVVPR-VGGIIDVRNDRISQDLDQAAKLKGEADAAVAAYEQELA 111

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + ++    I   A   AK  A+   + IE      L + E +I  +K  A + + +   D
Sbjct: 112 EAKKNANSIGQQAADAAKAEADTARKKIEAALDEKLGEAEARISSIKANAMKEVGSIAED 171

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV  ++  K +    ++  +
Sbjct: 172 TASAIVEALVGGKASKAEIAAAVK 195


>gi|21223729|ref|NP_629508.1| F0F1 ATP synthase subunit B [Streptomyces coelicolor A3(2)]
 gi|256785178|ref|ZP_05523609.1| F0F1 ATP synthase subunit B [Streptomyces lividans TK24]
 gi|81785262|sp|Q9K4D7|ATPF_STRCO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|8568791|emb|CAB94540.1| ATP synthase B chain [Streptomyces coelicolor A3(2)]
          Length = 184

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 61/151 (40%), Gaps = 2/151 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    +P+ +   L+   + I   I +A   + +++++L QYK + ++
Sbjct: 25  IGLIAFVIVFGFLAKKLLPN-INKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 83

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     +I   +  A   L   +   
Sbjct: 84  ARHEAARLRQEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIQADRKAAASALRQDVGKL 143

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQ 157
           + E+  +++ + + +    S + ++ +  + 
Sbjct: 144 ATELAGKLVGESLEDHARQSRVIDRFLDELD 174


>gi|30265332|ref|NP_847709.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Ames]
 gi|47530871|ref|YP_022220.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49188145|ref|YP_031398.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Sterne]
 gi|49481651|ref|YP_039301.1| F0F1 ATP synthase subunit B [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52140253|ref|YP_086578.1| F0F1 ATP synthase subunit B [Bacillus cereus E33L]
 gi|65317286|ref|ZP_00390245.1| COG0711: F0F1-type ATP synthase, subunit b [Bacillus anthracis str.
           A2012]
 gi|118480348|ref|YP_897499.1| F0F1 ATP synthase subunit B [Bacillus thuringiensis str. Al Hakam]
 gi|165873329|ref|ZP_02217932.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0488]
 gi|167636373|ref|ZP_02394673.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0442]
 gi|167642058|ref|ZP_02400284.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0193]
 gi|170689700|ref|ZP_02880877.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0465]
 gi|170709432|ref|ZP_02899840.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0389]
 gi|177656025|ref|ZP_02937132.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0174]
 gi|190569415|ref|ZP_03022299.1| ATP synthase F0, B subunit [Bacillus anthracis Tsiankovskii-I]
 gi|196036316|ref|ZP_03103714.1| ATP synthase F0, B subunit [Bacillus cereus W]
 gi|196039504|ref|ZP_03106809.1| ATP synthase F0, B subunit [Bacillus cereus NVH0597-99]
 gi|196045683|ref|ZP_03112913.1| ATP synthase F0, B subunit [Bacillus cereus 03BB108]
 gi|218906486|ref|YP_002454320.1| ATP synthase F0, B subunit [Bacillus cereus AH820]
 gi|225867286|ref|YP_002752664.1| ATP synthase F0, B subunit [Bacillus cereus 03BB102]
 gi|227818072|ref|YP_002818081.1| ATP synthase F0, B subunit [Bacillus anthracis str. CDC 684]
 gi|228917918|ref|ZP_04081454.1| ATP synthase B chain [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228930316|ref|ZP_04093320.1| ATP synthase B chain [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228936594|ref|ZP_04099388.1| ATP synthase B chain [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228949030|ref|ZP_04111302.1| ATP synthase B chain [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|229094419|ref|ZP_04225491.1| ATP synthase B chain [Bacillus cereus Rock3-42]
 gi|229124813|ref|ZP_04253991.1| ATP synthase B chain [Bacillus cereus 95/8201]
 gi|229187535|ref|ZP_04314675.1| ATP synthase B chain [Bacillus cereus BGSC 6E1]
 gi|229601736|ref|YP_002869524.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0248]
 gi|254686268|ref|ZP_05150127.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. CNEVA-9066]
 gi|254724264|ref|ZP_05186048.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. A1055]
 gi|254735237|ref|ZP_05192946.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Western North
           America USA6153]
 gi|254744441|ref|ZP_05202121.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Kruger B]
 gi|254755745|ref|ZP_05207778.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Vollum]
 gi|254759522|ref|ZP_05211547.1| F0F1 ATP synthase subunit B [Bacillus anthracis str. Australia 94]
 gi|300117820|ref|ZP_07055587.1| F0F1 ATP synthase subunit B [Bacillus cereus SJ1]
 gi|301056777|ref|YP_003794988.1| ATP synthase subunit B [Bacillus anthracis CI]
 gi|81394187|sp|Q6HAX5|ATPF_BACHK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81685355|sp|Q630T9|ATPF_BACCZ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81714851|sp|Q81JZ1|ATPF_BACAN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741299|sp|A0RL99|ATPF_BACAH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741300|sp|B7JGN4|ATPF_BACC0 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|30260010|gb|AAP29195.1| ATP synthase F0, B subunit [Bacillus anthracis str. Ames]
 gi|47506019|gb|AAT34695.1| ATP synthase F0, B subunit [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49182072|gb|AAT57448.1| ATP synthase F0, B subunit [Bacillus anthracis str. Sterne]
 gi|49333207|gb|AAT63853.1| ATP synthase F0, subunit B [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51973722|gb|AAU15272.1| ATP synthase F0, subunit B [Bacillus cereus E33L]
 gi|118419573|gb|ABK87992.1| ATP synthase F0 subcomplex B subunit [Bacillus thuringiensis str.
           Al Hakam]
 gi|164710926|gb|EDR16500.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0488]
 gi|167509976|gb|EDR85396.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0193]
 gi|167528207|gb|EDR90989.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0442]
 gi|170125665|gb|EDS94584.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0389]
 gi|170666342|gb|EDT17128.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0465]
 gi|172079880|gb|EDT64989.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0174]
 gi|190559470|gb|EDV13471.1| ATP synthase F0, B subunit [Bacillus anthracis Tsiankovskii-I]
 gi|195991108|gb|EDX55078.1| ATP synthase F0, B subunit [Bacillus cereus W]
 gi|196023514|gb|EDX62191.1| ATP synthase F0, B subunit [Bacillus cereus 03BB108]
 gi|196029664|gb|EDX68266.1| ATP synthase F0, B subunit [Bacillus cereus NVH0597-99]
 gi|218536921|gb|ACK89319.1| ATP synthase F0, B subunit [Bacillus cereus AH820]
 gi|225790776|gb|ACO30993.1| ATP synthase F0, B subunit [Bacillus cereus 03BB102]
 gi|227007381|gb|ACP17124.1| ATP synthase F0, B subunit [Bacillus anthracis str. CDC 684]
 gi|228595902|gb|EEK53582.1| ATP synthase B chain [Bacillus cereus BGSC 6E1]
 gi|228658604|gb|EEL14266.1| ATP synthase B chain [Bacillus cereus 95/8201]
 gi|228688956|gb|EEL42783.1| ATP synthase B chain [Bacillus cereus Rock3-42]
 gi|228810603|gb|EEM56952.1| ATP synthase B chain [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228823029|gb|EEM68867.1| ATP synthase B chain [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|228829302|gb|EEM74935.1| ATP synthase B chain [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228841715|gb|EEM86826.1| ATP synthase B chain [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|229266144|gb|ACQ47781.1| ATP synthase F0, B subunit [Bacillus anthracis str. A0248]
 gi|298724684|gb|EFI65359.1| F0F1 ATP synthase subunit B [Bacillus cereus SJ1]
 gi|300378946|gb|ADK07850.1| ATP synthase subunit B [Bacillus cereus biovar anthracis str. CI]
          Length = 168

 Score = 77.1 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVANEIDAAERNNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|328465137|gb|EGF36405.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 1816]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 63/147 (42%), Gaps = 1/147 (0%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQY 61
            F + F    +  I L +++ +     L+  +    + I  +I  A   R ++E +L + 
Sbjct: 13  TFGDAFFTLFAFAILL-VLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAEQ 71

Query: 62  KEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLY 121
           K    +   E++ +I  AK   +   EE  +   + S    ++ +  I   K +A   L 
Sbjct: 72  KSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISALR 131

Query: 122 AKIADFSVEIVREIISQKMNDDVNSSI 148
            ++   SV I  ++I + +++  N ++
Sbjct: 132 EQVGSLSVLIASKVIEKNLDEKNNLTL 158


>gi|332527639|ref|ZP_08403685.1| F0F1 ATP synthase subunit B [Rubrivivax benzoatilyticus JA2]
 gi|332112042|gb|EGJ12018.1| F0F1 ATP synthase subunit B [Rubrivivax benzoatilyticus JA2]
          Length = 156

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 68/156 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T ++ M + + LV      +   ++  LD  A KI D +  A + +        +
Sbjct: 1   MSINATLIIQMIVFLILVGFTMKFVWPPIVKALDERAAKIADGLSAADKAKSDLAAANQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ S    + ++ +  A+  A+ + EE      +  A  +     +     ++A+  L
Sbjct: 61  VEQQLSAARNDAQKRLADAERLAQQMIEEAKGRATEEGAKIIAAARAEAEQEAVKAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAGLAVKGAEQILRREVNPGVHAELLSRLKAEL 156


>gi|290580099|ref|YP_003484491.1| FoF1 membrane-bound proton-translocating ATPase b subunit
           [Streptococcus mutans NN2025]
 gi|1773262|gb|AAD13379.1| ATPase, b subunit [Streptococcus mutans]
 gi|254996998|dbj|BAH87599.1| FoF1 membrane-bound proton-translocating ATPase b subunit
           [Streptococcus mutans NN2025]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 62/146 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L+++V     S L +      +KI  DI +A   R+ ++ +  + + + ++ ++E  
Sbjct: 20  FILLLLLVKKFAWSQLAAIFKTREEKIAKDIDDAENSRQNAQVLENKRQVELNQAKDEAA 79

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK   K    +      + +        Q I   K EA   + A +AD SV +  
Sbjct: 80  QIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKAEALSSVKADVADLSVLLAE 139

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           +I+++ ++      + +  +  +   
Sbjct: 140 KIMAKNLDKTAQGDLIDSYLDKLGDA 165


>gi|228911148|ref|ZP_04074954.1| ATP synthase B chain [Bacillus thuringiensis IBL 200]
 gi|228848511|gb|EEM93359.1| ATP synthase B chain [Bacillus thuringiensis IBL 200]
          Length = 168

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLILLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|121607472|ref|YP_995279.1| F0F1 ATP synthase subunit B [Verminephrobacter eiseniae EF01-2]
 gi|226737876|sp|A1WF54|ATPF_VEREI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|121552112|gb|ABM56261.1| ATP synthase F0, B subunit [Verminephrobacter eiseniae EF01-2]
          Length = 156

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   + + LV      +   +   LD  A KI D +  A R + +      +
Sbjct: 1   MSINATLFVQAIVFLILVWFTMQFVWPPIAKALDERAQKIADGLAAADRAKSELSAANQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ S+   ET   +  A+ RA+ + EE      +     +     +     ++A+  L
Sbjct: 61  VEKELSQARNETAARLADAERRAQAIIEEAKARATEEGNKLVAAARAEAEQQMVQAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
            A++A  +V+   +I+ ++++  V++ +  +  + +
Sbjct: 121 RAQVAVLAVKGAEQILRKEVDAGVHAGLLRRLQTEL 156


>gi|69215356|gb|AAZ03830.1| ATP synthase CF0 B chain [Ginkgo biloba]
          Length = 189

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 67/163 (41%), Gaps = 8/163 (4%)

Query: 10  FMSLIIFLVIVVYLR----IPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            ++L + L +++Y         IL + LD    KI + I  +  L + + + L + + + 
Sbjct: 31  LINLSVVLGVLIYFGKGVCAGCILSNLLDNRKQKILNTIRNSEELCKGATDQLEKARTRL 90

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +VE    EI +    + +   E+      +          + +H+ +  A   +  +++
Sbjct: 91  REVERRAGEIRVNGYSQIEREKEDLINAAYENLERLEDPKNETVHFEQQRAIDQVRQQVS 150

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTE 168
             ++      ++ ++N +++      +I  +++      NTT+
Sbjct: 151 RQALRRALGTLNSRLNSELHLRTINHSIGLLRAMR----NTTD 189


>gi|303231202|ref|ZP_07317940.1| ATP synthase F0, B subunit [Veillonella atypica ACS-049-V-Sch6]
 gi|302514109|gb|EFL56113.1| ATP synthase F0, B subunit [Veillonella atypica ACS-049-V-Sch6]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 64/149 (42%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  I + I+        L+S +    ++I  D+ +A+  R ++E     Y  + +   
Sbjct: 13  MLNFFILVWILARF-AYKPLVSMMQERKERIAKDLADAQVARNEAEQFKADYAAQIANAR 71

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E ++I+  A  +A+    E      +      +   Q I   +  A   L  ++   SV
Sbjct: 72  QEAQQIVEKAVQQAEATTREQLAAAREQIEREKERARQDIVNERDRAMNNLRNEVISLSV 131

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +++++ M+ + N+ + E  I+ + S
Sbjct: 132 AMATKVVAKDMDSETNTKLIEDAIAKLDS 160


>gi|282859100|ref|ZP_06268231.1| ATP synthase F0, B subunit [Prevotella bivia JCVIHMP010]
 gi|282588130|gb|EFB93304.1| ATP synthase F0, B subunit [Prevotella bivia JCVIHMP010]
          Length = 169

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 59/154 (38%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  +I   I+     P ++L       + I   I +A+   EK  NI  + +    
Sbjct: 12  FWMTLVFLIVFFILRKWGFP-VILKMSSDRKEYIDGSIRKAKEAHEKLANIQKESESILQ 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+   I+  A    + +  +      + +A  + D +  I   K  A R +  ++ +
Sbjct: 71  EAREKQALILKEATTTRETIVSQAQDKAREEAARLVADAKIAIENEKQNALREIRNQMTE 130

Query: 127 FSVEIVREIISQKMNDDV-NSSIFEKTISSIQSC 159
            S+ I  +I+  K++          + +  + S 
Sbjct: 131 LSINISEKILRDKLSSSDVQMDYINRLLDDVSSS 164


>gi|116490719|ref|YP_810263.1| F0F1-type ATP synthase, subunit b [Oenococcus oeni PSU-1]
 gi|122277097|sp|Q04G24|ATPF_OENOB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116091444|gb|ABJ56598.1| ATP synthase F0 subcomplex B subunit [Oenococcus oeni PSU-1]
          Length = 176

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/158 (14%), Positives = 68/158 (43%)

Query: 4   DETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKE 63
           D + +  +   I L+ ++       +   +DA A++I DD+  A + + +++ +      
Sbjct: 11  DGSAIFVLLTFILLMFILKKLAWGPITKIMDARANQINDDLDSAAKSKNEAKKLQTVADT 70

Query: 64  KHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAK 123
              + + +   ++  A+  ++  +++     +  +    +  +     +K +A      +
Sbjct: 71  NLKESQSQATALMENARKSSEEQSKKIVDLAQAHADSINRQAQIDARQIKDDALDSAKDE 130

Query: 124 IADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
           IAD SV I   II +++    + ++ +  IS ++   +
Sbjct: 131 IADLSVSIASRIIGKEITASKHKALIDDFISELEKQQE 168


>gi|293391126|ref|ZP_06635460.1| ATP synthase F0, B subunit [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951660|gb|EFE01779.1| ATP synthase F0, B subunit [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 156

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 68/156 (43%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +      V      +   ++  ++    +I + +      +++  +    
Sbjct: 1   MNLNATLIGQLISFALFVWFCMKFVWPPIIKAIETRQSQIANALASTEAAKKEQADTKAL 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++ SK + + +EI+ AA  R   + +E     E++ A  ++    ++   +   +  L
Sbjct: 61  VEQEISKAKIQAQEILDAANKRRNEVLDEVKNEAEELKAKIIEQGYAEVEAERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  +V    +I+ + +++  N+ I +K ++ +
Sbjct: 121 RVKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL 156


>gi|13476165|ref|NP_107735.1| F0F1 ATP synthase subunit B' [Mesorhizobium loti MAFF303099]
 gi|81776792|sp|Q986D2|ATPF1_RHILO RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|14026925|dbj|BAB53521.1| FoF1 ATP synthase, subunit B [Mesorhizobium loti MAFF303099]
          Length = 193

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 66/144 (45%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F + +  + +P  +   +D   D+I  D+ +A +L+ +++  +  Y+++ +
Sbjct: 47  LWLAITFGLFYLFLKKVAMPR-IGGIIDVRNDRISQDLDQASKLKGEADAAVAAYEQELA 105

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + ++    I   A   AK  AE   + IE      L + E +I  +K  A + + +   D
Sbjct: 106 EAKKNASSIGQQAADAAKAEAETARKKIEAALDEKLGEAEARISSIKANAMKEVGSIAED 165

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            +  IV  ++  K +    ++  +
Sbjct: 166 TASAIVEALVGGKASKAEIAAAVK 189


>gi|91983978|ref|YP_567062.1| ATP synthase CF0 B subunit [Vitis vinifera]
 gi|122242809|sp|Q0ZJ34|ATPF_VITVI RecName: Full=ATP synthase subunit b, chloroplastic; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I
 gi|91701636|gb|ABE47520.1| ATP synthase CF0 subunit I [Vitis vinifera]
          Length = 185

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 58/155 (37%), Gaps = 1/155 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++L + L ++++     +L   LD    +I + I  +  LRE +   L + + +  KVE 
Sbjct: 32  INLSVVLGVLIFFG-KGVLSDLLDNRKQRILNTIRNSEELREGAIEQLEKARARLRKVEM 90

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           E  +  +      +        +             + IH+ +  A   +  ++   +++
Sbjct: 91  EADQYRVNGYSEIEREKLNLINSTYNTLEQLENYKNETIHFEQQRAINQVRQRVLQQALQ 150

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKN 165
                I+  +N +++       I    S  ++  N
Sbjct: 151 GALGTINSCLNKELHLRTISANIGMFGSMKEIRNN 185


>gi|28899847|ref|NP_799452.1| F0F1 ATP synthase subunit B [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838481|ref|ZP_01991148.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus AQ3810]
 gi|260876526|ref|ZP_05888881.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus AN-5034]
 gi|260897417|ref|ZP_05905913.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus Peru-466]
 gi|38502968|sp|Q87KA4|ATPF_VIBPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28808099|dbj|BAC61336.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748104|gb|EDM58963.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus AQ3810]
 gi|308087882|gb|EFO37577.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus Peru-466]
 gi|308090417|gb|EFO40112.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus AN-5034]
 gi|328471198|gb|EGF42100.1| F0F1 ATP synthase subunit B [Vibrio parahaemolyticus 10329]
          Length = 156

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V      +   L+  ++    KI D +  A R  +  +     
Sbjct: 1   MNINATLLGQAISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    EII  A  R   + +E  +  +      L   E ++   +  A+  L
Sbjct: 61  ASDQLKEAKRTATEIIEQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I+ + ++ D    I +   + +
Sbjct: 121 RKQVATLAVAGAEKILERTIDKDAQKDILDNITAKL 156


>gi|323148816|ref|YP_004221909.1| ATP synthase CF0 subunit I [Erodium carvifolium]
 gi|316926280|gb|ADU58133.1| ATP synthase CF0 subunit I [Erodium carvifolium]
          Length = 184

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 57/151 (37%), Gaps = 1/151 (0%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++L + L ++++     +L   LD    +I + I  +  LR  +   L +   +  KV+ 
Sbjct: 32  INLSVVLGVLIFFG-KGVLKDLLDNRKQRILNTIRNSEELRAGAVEQLEKAHARLRKVKT 90

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           +  +  +     A+        +  +          + I + +  +   +  ++   +++
Sbjct: 91  DVDQFRVNEYSEAERKRSNLITSAYRQLEQSENSKNESIRFEQQRSINQVRQRVCQQALQ 150

Query: 131 IVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
              EI++  +N +++       I    S  +
Sbjct: 151 GALEILNSSLNKELHLRTISANIGLFGSMKE 181


>gi|295707212|ref|YP_003600287.1| ATP synthase F0 subunit B [Bacillus megaterium DSM 319]
 gi|294804871|gb|ADF41937.1| ATP synthase F0, B subunit [Bacillus megaterium DSM 319]
          Length = 172

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 66/148 (44%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            + + + L+ ++       ++  +    + I  +I EA +  E+++ ++ + +E   +  
Sbjct: 22  QLVMFLILLALLQKFAFGPVMGIMKKREEHIAGEIDEAEKQNEEAKKLVEEQREILKQSR 81

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E + ++  A+  A+   EE      + S       +Q+I   K +A   L  ++A  SV
Sbjct: 82  QEVQVMMENARKSAEDKKEEIIAAAREESERLKAAAKQEIEQQKDQAVAALREQVASLSV 141

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQ 157
            I  ++I +++++     +  + I  + 
Sbjct: 142 LIASKVIEKELSEQDQEKLIHEYIQEVG 169


>gi|253681112|ref|ZP_04861915.1| ATP synthase F0, B subunit [Clostridium botulinum D str. 1873]
 gi|253562961|gb|EES92407.1| ATP synthase F0, B subunit [Clostridium botulinum D str. 1873]
          Length = 159

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 81/151 (53%), Gaps = 1/151 (0%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              ++ ++ L I+ Y  +   +   +D    +I +DI +A+  +EK++ + +  ++++  
Sbjct: 10  WTIINFVVLLGILSYF-LFKPVNLVIDRRNSEIENDINQAKTDKEKAKELRIANEKEYKA 68

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            ++E + I+   K +A+ +++E   +  + + L ++  +++I   + +A+  +  K  + 
Sbjct: 69  AKKEGKTIVENYKVKAENVSQEIISDAHKEAELIIQRAKKEIQREREKAEDEVKNKTIEL 128

Query: 128 SVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++E+ ++ + + +++ V+  + +  IS + +
Sbjct: 129 ALELSKKALERSIDEKVHRELIDNFISKVGN 159


>gi|82754615|gb|ABB90029.1| ATP synthase CF0 B chain [Solanum tuberosum]
          Length = 184

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 21/162 (12%), Positives = 61/162 (37%), Gaps = 3/162 (1%)

Query: 3   FDETFLVF--MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           F+  FL    ++L + L ++++     +L   LD    +I + I  +  LR  +   L +
Sbjct: 22  FNTDFLATNPINLSVVLGVLIFFG-KGVLSDLLDNRKQRILNTIRNSEELRGGAIEQLEK 80

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            + +  KVE E  +  +      +        +  +          + I + +  A   +
Sbjct: 81  ARSRLRKVETEAEQFRVNGYSEIEREKLNLINSTYKTLEQLENYKNETIQFEQQRAINQV 140

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
             ++   ++      ++  +N++++       I  + +  ++
Sbjct: 141 RQRVFQQALRGALGTLNSCLNNELHLRTISANIGMLGTMKEI 182


>gi|302869582|ref|YP_003838219.1| ATP synthase F0 subunit B [Micromonospora aurantiaca ATCC 27029]
 gi|315503956|ref|YP_004082843.1| ATP synthase f0, b subunit [Micromonospora sp. L5]
 gi|302572441|gb|ADL48643.1| ATP synthase F0, B subunit [Micromonospora aurantiaca ATCC 27029]
 gi|315410575|gb|ADU08692.1| ATP synthase F0, B subunit [Micromonospora sp. L5]
          Length = 179

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 20/150 (13%), Positives = 65/150 (43%), Gaps = 2/150 (1%)

Query: 11  MSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEE 70
           ++ I+   +++    P +      A  D I   I  A   + ++  +L QY+ + ++   
Sbjct: 28  IAFIVLCFVLMKFVFPRM-EQTFQARVDAIEGGIKRAEAAQAEANQLLEQYRAQLAEART 86

Query: 71  ETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVE 130
           +  +I   A+  A+ + ++      + S   +   ++++   +    R L  ++   +V+
Sbjct: 87  DAAKIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLAAERATIVRELRTEVGTIAVD 146

Query: 131 IVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           +  +I+ + + ++       ++ +S ++S 
Sbjct: 147 LASKIVGESLADEARRKGTVDRFLSGLEST 176


>gi|281420261|ref|ZP_06251260.1| ATP synthase F0, B subunit [Prevotella copri DSM 18205]
 gi|281405756|gb|EFB36436.1| ATP synthase F0, B subunit [Prevotella copri DSM 18205]
          Length = 166

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +  II  +I+     P+I+   ++     I D + +A    EK  NI  + +    
Sbjct: 12  FWMTLVFIIVFIILWKAGFPAII-KMVNERKAFIDDSLKKAHEANEKLANIQKEGESILQ 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  E+   ++  A      + E+      +  A  L D +++I   K  A R +  ++A+
Sbjct: 71  EAREKQAALLKEAAETRDAIVEKAQDKAREEGARLLSDAKKQIETEKQNAIREIRGQVAE 130

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQ 161
            SV+I  +++  K+ +D     +  + +  + S ++
Sbjct: 131 LSVQIAEKVLKAKLSDDKAQMDMINRLLDEVSSDNK 166


>gi|269798592|ref|YP_003312492.1| ATP synthase F0 subunit beta [Veillonella parvula DSM 2008]
 gi|269095221|gb|ACZ25212.1| ATP synthase F0, B subunit [Veillonella parvula DSM 2008]
          Length = 165

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 59/149 (39%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  I + ++        LL+ +    ++I  D+  A + R ++E     Y  + S   
Sbjct: 13  MLNFFILVWLLARF-AYKPLLAMMTERKERIAKDLEAAEQARAETEKFKADYAAQISNAR 71

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E ++I+  A   A+    E      +          Q I   +  A   L  ++   SV
Sbjct: 72  VEAQQIVEKAIQEAENTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNEVVSLSV 131

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +++++ MN + N+ + E  I  + S
Sbjct: 132 AMAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|221633215|ref|YP_002522440.1| ATP synthase F0 subunit B [Thermomicrobium roseum DSM 5159]
 gi|221155512|gb|ACM04639.1| ATP synthase F0, B subunit [Thermomicrobium roseum DSM 5159]
          Length = 165

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/152 (15%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++ ++FL +     +   +   +D   ++IR+ +  A R++ +      + +E  ++  
Sbjct: 15  LIAFLLFLAVFWRFAL-GPITRMIDQRQERIREGLEAAERMKRELAETQARNEEILAEAR 73

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E + I+ +A+  A+ L     +  +Q +   ++  ++ I   +      L  ++AD ++
Sbjct: 74  REAQRIVASARESAEQLIARAREEAQQQAQQLIQQAQEAIEAERQRVWAELRREVADLAI 133

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQ 161
                II Q+++ D + ++ E+ ++ +    +
Sbjct: 134 LAATRIIRQELDRDRHLALIEQALAELDGARR 165


>gi|220913087|ref|YP_002488396.1| ATP synthase F0 subunit beta [Arthrobacter chlorophenolicus A6]
 gi|219859965|gb|ACL40307.1| ATP synthase F0, B subunit [Arthrobacter chlorophenolicus A6]
          Length = 184

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 62/151 (41%), Gaps = 2/151 (1%)

Query: 9   VFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKV 68
           V +   I + IVV   +P +        A+ I   I +A + + ++   L +YK++ +  
Sbjct: 28  VLVGFAILMFIVVKFVVP-MFEKTFAERAEAIEGGIAKAEKAQAEASAALEEYKQQLTDA 86

Query: 69  EEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFS 128
             E   I   A+     +  +  +     SA        +I   +  A   L +++   +
Sbjct: 87  RTEANRIREEARAEGAQILADLKEKAAAESARITAQAHAQIESERQAAVVSLRSEVGTLA 146

Query: 129 VEIVREIISQKMNDDVNS-SIFEKTISSIQS 158
             +   I+ + +NDD  S  + ++ ++ +++
Sbjct: 147 TTLAGRIVGESLNDDDRSARVVDRFLADLET 177


>gi|10039448|dbj|BAB13356.1| H+-ATPase b subunit [Brevibacterium flavum]
          Length = 188

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 66/158 (41%), Gaps = 2/158 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +  +I L++   L +P      L    D+I+  I  A   + +++  L +Y  + ++
Sbjct: 32  WSLIPFLIILIVFWKLVLP-KFQEVLTEREDRIKGGIQRAEAAQVEAKAALEKYNAQLAE 90

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  EI   A+ R K +  E      + S   ++   +++   + +    L  ++   
Sbjct: 91  ARTEAAEIREQARERGKQIEAELKDKANEESNRIIESGSKQLLAQREQVVNELRREMGQN 150

Query: 128 SVEIVREIISQKMNDDVNSS-IFEKTISSIQSCHQMDK 164
           S+ +   ++  +++D+V  S   ++ ++ + +     K
Sbjct: 151 SINLAEHLLGDQLSDNVKRSGTIDRFLADLDTVAPNGK 188


>gi|262374653|ref|ZP_06067926.1| ATP synthase F0, B subunit [Acinetobacter junii SH205]
 gi|262310443|gb|EEY91534.1| ATP synthase F0, B subunit [Acinetobacter junii SH205]
          Length = 156

 Score = 76.8 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 61/156 (39%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +         V      +   L++ +     KI D +  A + +    +   Q
Sbjct: 1   MNINLTLIGQAIAFAMFVAFCMKFVWPPLINAISERQRKIADGLNAAEKAKADLADAQAQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K +    + +  ++I  A  RA  L EE             +  ++ +      A+  L
Sbjct: 61  VKAELDAAKAQAAQLIEQANRRAAQLVEEARTQAAAEGERIRQQAKETVDQDINAAREEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +I++Q+++ + ++++  +  + +
Sbjct: 121 RQQVAALAVAGAEKILNQQVDAEAHNAMLTQLAAKL 156


>gi|42784479|ref|NP_981726.1| F0F1 ATP synthase subunit B [Bacillus cereus ATCC 10987]
 gi|206976874|ref|ZP_03237776.1| ATP synthase F0, B subunit [Bacillus cereus H3081.97]
 gi|217962798|ref|YP_002341376.1| F0F1 ATP synthase subunit B [Bacillus cereus AH187]
 gi|222098780|ref|YP_002532838.1| f0f1 ATP synthase subunit b [Bacillus cereus Q1]
 gi|229142051|ref|ZP_04270576.1| ATP synthase B chain [Bacillus cereus BDRD-ST26]
 gi|229199433|ref|ZP_04326096.1| ATP synthase B chain [Bacillus cereus m1293]
 gi|81699585|sp|Q72XE4|ATPF_BACC1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741303|sp|B7HY69|ATPF_BACC7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|42740411|gb|AAS44334.1| ATP synthase F0, B subunit [Bacillus cereus ATCC 10987]
 gi|206744840|gb|EDZ56245.1| ATP synthase F0, B subunit [Bacillus cereus H3081.97]
 gi|217063785|gb|ACJ78035.1| ATP synthase F0, B subunit [Bacillus cereus AH187]
 gi|221242839|gb|ACM15549.1| ATP synthase F0, B subunit [Bacillus cereus Q1]
 gi|228584009|gb|EEK42164.1| ATP synthase B chain [Bacillus cereus m1293]
 gi|228641340|gb|EEK97646.1| ATP synthase B chain [Bacillus cereus BDRD-ST26]
          Length = 168

 Score = 76.8 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLLLLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDAIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|270296888|ref|ZP_06203087.1| ATP synthase F0, B subunit [Bacteroides sp. D20]
 gi|317479136|ref|ZP_07938276.1| ATP synthase B/B' CF(0) [Bacteroides sp. 4_1_36]
 gi|270272875|gb|EFA18738.1| ATP synthase F0, B subunit [Bacteroides sp. D20]
 gi|316904708|gb|EFV26522.1| ATP synthase B/B' CF(0) [Bacteroides sp. 4_1_36]
          Length = 168

 Score = 76.8 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  AR    +   +  + +   +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEGRKTYIDQSLEVAREANAQLSKLKEESEALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  +  E  +   L +++++I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMHERDKIIVEARKQAEAAAQKELDEVKKQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSCHQ 161
            SV+I  +II + +++      + ++ +  + +  +
Sbjct: 131 LSVDIAEKIIRKNLDEKHEQMEMIDRMLDEVLAASK 166


>gi|167768298|ref|ZP_02440351.1| hypothetical protein CLOSS21_02854 [Clostridium sp. SS2/1]
 gi|167709822|gb|EDS20401.1| hypothetical protein CLOSS21_02854 [Clostridium sp. SS2/1]
          Length = 160

 Score = 76.8 bits (187), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 68/155 (43%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            D   +  +  I+   +++   +   +   ++     I  D+ +A + + ++E I  +Y+
Sbjct: 5   LDWGIIWPIVNIVVFYLLLRKFLFGPVSEVMEKRKKMISSDLDDAAQTKAEAEEIKQEYE 64

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +  ++ ++E  +I+  A+ RAK   +      ++  AL  ++  + I   K +    L  
Sbjct: 65  KNLAQAKDEAGQIVSDARTRAKNEYQNKMDQTKEEIALMRENARKDIEAEKQKTIAGLQT 124

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           +IA  ++    +++ ++ ND  N  + +  +    
Sbjct: 125 EIAGIALMATSKVVEKEANDKGNEKLLDDFLKEAG 159


>gi|295109099|emb|CBL23052.1| ATP synthase F0 subcomplex B subunit [Ruminococcus obeum A2-162]
          Length = 167

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 71/155 (45%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
             F+  +  +   V ++   +   +   LD    K   +I +A + +E+++ +  +Y++ 
Sbjct: 12  WNFIATICNLFIQVYLIKRFLFKPINEMLDKRKAKADAEIQDAVKAKEEAQAMKAEYEKN 71

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
             + +E   EI++ A+  A + +EE  +          +  E+ I   K +A   +  +I
Sbjct: 72  MQEAKERANEIVMTAQKTAAVQSEEMLKEASSQVTAMKEKAEKDIAQEKRKAVNEIKGEI 131

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +VEI  ++I +++N++ ++ +    I ++   
Sbjct: 132 GGMAVEIAGKVIEREINEEDHTKLINDFIENVGEA 166


>gi|87311754|ref|ZP_01093869.1| probable protein ATP synthase B chain [Blastopirellula marina DSM
           3645]
 gi|87285538|gb|EAQ77457.1| probable protein ATP synthase B chain [Blastopirellula marina DSM
           3645]
          Length = 245

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 12  SLIIFLVI--VVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
           + +IFL +  ++ +     +++ LD+    +   + EA+++   +E  L +Y +K +  +
Sbjct: 95  NFLIFLGLAALLTIFAWKPIVAALDSREAAMDGKLAEAQKMFAAAEARLAEYNQKLADAQ 154

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E ++        A+    +   + +       K  +Q+I   K  A   L  +  + ++
Sbjct: 155 QEIQKSREQIMKEAEEKRLQILADAQAAGNAERKRAQQEIEAAKTAAISDLTKQSVNLAI 214

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
           ++  +I  Q++  + +  +   T++ + S
Sbjct: 215 DLASKITRQQLTPEDHQHLINDTLAQLPS 243


>gi|145596146|ref|YP_001160443.1| ATP synthase F0, B subunit [Salinispora tropica CNB-440]
 gi|226694473|sp|A4XAW6|ATPF_SALTO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145305483|gb|ABP56065.1| ATP synthase F0, B subunit [Salinispora tropica CNB-440]
          Length = 175

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/151 (12%), Positives = 68/151 (45%), Gaps = 2/151 (1%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  + + +++   +P +  +   A  D I   +  A   + ++  +L QY+ + ++V 
Sbjct: 23  TIAFALLVFVLLKFVMPRM-ETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVR 81

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
            E   I   A+  A+ + ++      + S   +   ++++   +    R L  ++   +V
Sbjct: 82  TEAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERTTIVRELRTEVGTLAV 141

Query: 130 EIVREIISQKM-NDDVNSSIFEKTISSIQSC 159
           ++  +I+ + + ++   +   ++ ++ ++S 
Sbjct: 142 DLAGKIVGESLADEARRAGTVDRFLNGLESA 172


>gi|332671306|ref|YP_004454314.1| ATP synthase F0 subunit B [Cellulomonas fimi ATCC 484]
 gi|332340344|gb|AEE46927.1| ATP synthase F0, B subunit [Cellulomonas fimi ATCC 484]
          Length = 197

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/151 (14%), Positives = 58/151 (38%), Gaps = 2/151 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   + L+I + I  Y        + LD    KI   + +A   + ++   L +Y ++  
Sbjct: 34  FWSSVVLLI-IAIAFYKYALPKFQAILDERTAKIEGGLAKAETAQAEAAAALAEYHQQLQ 92

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               E   I   A+     +  +      + +A   +   ++I   + +A   L   +  
Sbjct: 93  DARTEAARIREDARAEGGQIVADLRAKASEEAARITETAHRQIEAERQQAAVQLTQDVGT 152

Query: 127 FSVEIVREIISQKM-NDDVNSSIFEKTISSI 156
            + E+  +I+ + + ++   S + ++ +  +
Sbjct: 153 LATELASKIVGEALEDEVRQSRVVDRFLDEL 183


>gi|325292102|ref|YP_004277966.1| ATP synthase B' chain [Agrobacterium sp. H13-3]
 gi|325059955|gb|ADY63646.1| ATP synthase B' chain [Agrobacterium sp. H13-3]
          Length = 213

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 65/140 (46%), Gaps = 1/140 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
             + ++  +F +++  + +P  +   L+    +I  D+ EA RL+ +++  +  Y+++ +
Sbjct: 63  LWLAITFGLFYLLMQKVIVPR-VGGILENRHGRIAQDLDEAARLKSEADAAVETYEKELA 121

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
               +   I  AA+  AK  A+     IE   A  L   E++I  ++ +A   + A   +
Sbjct: 122 AARAKASSIGSAARDAAKAKADADRVAIEAGLAEKLAAAEKRIAGIRDQAFADVGAIAEE 181

Query: 127 FSVEIVREIISQKMNDDVNS 146
            +  IV +++  K+ D    
Sbjct: 182 TATAIVDQLVGAKVKDADVK 201


>gi|257452845|ref|ZP_05618144.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp.
           3_1_5R]
 gi|257466790|ref|ZP_05631101.1| ATP synthase B chain, sodium ion specific [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 168

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/151 (15%), Positives = 67/151 (44%), Gaps = 1/151 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++  I + +       + +   L     KI  ++  A   +E+++    Q +    
Sbjct: 16  FWQIINFFILVFVFNKYF-KTPIQRILTERKKKITSELHSATLSKEEAKVSAKQAETALK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +  +E  EI+  A++RA+ +  E   +        L++  +++  +K +A+R L+ ++  
Sbjct: 75  EARDEAHEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKAKARRDLHQEVTS 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
            +VE+  +++ + ++    + + +  I  + 
Sbjct: 135 LAVELAEKLMKKNIDKQTATDLIDDFIERVG 165


>gi|49475211|ref|YP_033252.1| F0F1 ATP synthase subunit B' [Bartonella henselae str. Houston-1]
 gi|81696227|sp|Q6G5L0|ATPF1_BARHE RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|49238016|emb|CAF27222.1| ATP synthase B chain [Bartonella henselae str. Houston-1]
          Length = 188

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/144 (18%), Positives = 72/144 (50%), Gaps = 1/144 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +F + +  + +P  +   ++   D+I  D+ +A R++++++ ++  Y+ K +
Sbjct: 42  FWLAISFGLFYLFISRVIVPR-IGGVIETRRDRIASDLDQAMRMKQEADIVVETYERKLA 100

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           +   +   I   A    K   E   + IE      L D E++I  ++ +A + + +   +
Sbjct: 101 QARSQAHVIAQTASEEIKQKVELERKEIEANLEKKLTDAEKQIAKIRDKAMKSVGSIAEE 160

Query: 127 FSVEIVREIISQKMNDDVNSSIFE 150
            ++EIV+++I  +++ +   S  +
Sbjct: 161 VALEIVKKLIDVEVSKESVRSAVK 184


>gi|319744886|gb|EFV97220.1| ATP synthase F0 sector subunit B [Streptococcus agalactiae ATCC
           13813]
          Length = 165

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 62/146 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
           ++ L I++       +    +A   KI +DI  A + R+++E    + +E+ S  + E  
Sbjct: 20  VLLLFILIKTFAWKQITGIFEAREQKIANDIDTAEQARQQAEAFATKREEELSNAKTEAN 79

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK       ++     +  +    +   Q I   K EA   +  ++AD +V +  
Sbjct: 80  QIIDNAKETGLAKGDQIISEAKTEADRLKEKAHQDIAQNKAEALADVKGEVADLTVLLAE 139

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           +I+   ++ +  S++    I  +   
Sbjct: 140 KIMVSNLDKEAQSNLINSYIKKLGDA 165


>gi|77166524|ref|YP_345049.1| F0F1 ATP synthase subunit B [Nitrosococcus oceani ATCC 19707]
 gi|123593194|sp|Q3J6M7|ATPF_NITOC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|76884838|gb|ABA59519.1| ATP synthase F0 subcomplex B subunit [Nitrosococcus oceani ATCC
           19707]
          Length = 156

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 66/156 (42%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+   T +  M     LV  V   +   L + ++    ++ D +  A R + + E    +
Sbjct: 1   MNVTVTLIGQMVAFGILVWFVNRFLWGPLTNLMEERKKRVADGLAAAERGKHERELAEKR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            KE   + +E+  EII  A+ RA  + EE  +  +            +I      A+  L
Sbjct: 61  AKETLHEAKEKAAEIITQAQKRAGEIIEEAKEAAQAEGERLKVSANAEIQQEMNRAREDL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++   +V    +I+ +++++  N ++ ++ ++ I
Sbjct: 121 RGQVVSIAVAGASKILKRELDEKANEALVKELVAQI 156


>gi|90426284|ref|YP_534654.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
 gi|122474863|sp|Q20X01|ATPF_RHOPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|90108298|gb|ABD90335.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
          Length = 164

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 41/156 (26%), Positives = 76/156 (48%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
               V ++ +I + +  Y  +   +L  LD   D+I+ ++ EA RL+E++  +L +YK +
Sbjct: 8   PETWVAVAFVILMGVFAYFGVHRTVLKSLDNRRDRIKAELDEAARLKEEAAALLAEYKAR 67

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +  E E +EII  AK  A+ +A E    +E   A   K  E KI   + +A   + +  
Sbjct: 68  RASAEREAQEIIAGAKDEAERIAAEAKAKLEDFVARRTKTAEGKIALAEAQAVADVRSAA 127

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           A+ +V     I+SQ +   V   + ++ I  ++S  
Sbjct: 128 ANAAVAAASTILSQSVKGQVAEGLLQRGIEEVRSKL 163


>gi|209966768|ref|YP_002299683.1| ATP synthase F0, B subunit [Rhodospirillum centenum SW]
 gi|226694398|sp|B6IX47|ATPF2_RHOCS RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|209960234|gb|ACJ00871.1| ATP synthase F0, B subunit [Rhodospirillum centenum SW]
          Length = 160

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 73/160 (45%), Gaps = 1/160 (0%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + TF V ++ ++F+  V  +   + +   LD  A++IR++I +A++LRE ++  L Q
Sbjct: 1   MLQNPTFWVLVAFVLFVAAVWRIAA-NTIGKALDDRAERIREEIEQAQKLREDAQAALAQ 59

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+ K     +E   II AA+  A  +      ++E           +KI   + +A + +
Sbjct: 60  YQRKQRDALKEAENIIAAAREEADRIRRRAATDLEASLRRREAQAMEKIAQAEAQAVQQV 119

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
                D +V     I+ Q M+   +  +    I+ + +  
Sbjct: 120 RDLAVDIAVAATERILVQNMDATRDEVLVGNAIAELPAKL 159


>gi|315122435|ref|YP_004062924.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495837|gb|ADR52436.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 161

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 86/160 (53%), Positives = 131/160 (81%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           MHFDETFLVF SL+ F+++++YLR+P+ +L FLDA AD+IRD++FEARRLRE++EN+L+Q
Sbjct: 1   MHFDETFLVFTSLVAFILLLIYLRVPAKVLYFLDARADRIRDELFEARRLREEAENVLVQ 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           YKEK+SK+  + REII+ A+ +AK++ ++ C+NIE++S L+L+++++ IH M+LEAKRL 
Sbjct: 61  YKEKYSKIGTDVREIIVVAEQKAKLIKDDNCKNIEKLSDLHLENVKRTIHCMELEAKRLF 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           Y K+A FS+E  +EIISQK++DD++  IF+  I  I+   
Sbjct: 121 YIKLAYFSIEYAKEIISQKIDDDISCHIFQDAIREIEQYK 160


>gi|160890318|ref|ZP_02071321.1| hypothetical protein BACUNI_02759 [Bacteroides uniformis ATCC 8492]
 gi|156860050|gb|EDO53481.1| hypothetical protein BACUNI_02759 [Bacteroides uniformis ATCC 8492]
          Length = 168

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 65/154 (42%), Gaps = 2/154 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  +  V++     P ++   ++     I   +  AR    +   +  + +   +
Sbjct: 12  FWMLLSFGVVFVVLAKYGFP-VITKMVEGRKTYIDQSLEVAREANAQLSKLKEESEALIA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
              +E   I+  A H    +  E  +  E  +   L +++++I   K EA R +  ++A 
Sbjct: 71  AANKEQGRILREAMHERDKIIVEARKQAEAAAQKELDEVKKQIQQEKEEAIRDIRRQVAV 130

Query: 127 FSVEIVREIISQKMNDD-VNSSIFEKTISSIQSC 159
            SV+I  +II + +++      + ++ +  + + 
Sbjct: 131 LSVDIAEKIIRKNLDEKHEQMEMIDRMLDEVLAA 164


>gi|231608|sp|P21904|ATPF_PROMO RecName: Full=ATP synthase subunit b, sodium ion specific; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I; AltName: Full=F-type ATPase
           subunit b; Short=F-ATPase subunit b
 gi|581457|emb|CAA37913.1| unnamed protein product [Propionigenium modestum]
          Length = 168

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 70/154 (45%), Gaps = 1/154 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F   ++ +I +           +   LDA  +KI +D+ +A   +E +     + +    
Sbjct: 16  FWQIINFLILMFFF-KKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIVK 74

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
             + E  E++L A+ +A    E   +         LK  E +I  MK +A++ L  ++ D
Sbjct: 75  SAKTEANEMLLRAEKKADERKETILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVTD 134

Query: 127 FSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
            +V++  ++I++K++  + +++ ++ I  +    
Sbjct: 135 LAVKLAEKMINEKVDAKIGANLLDQFIGEVGEEK 168


>gi|330447288|ref|ZP_08310938.1| ATP synthase F0, B subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491479|dbj|GAA05435.1| ATP synthase F0, B subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 156

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 57/156 (36%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T L         V+     +   ++  ++    KI D +  A R  +  +     
Sbjct: 1   MNMNATLLGQAIAFFAFVVFCMKYVWPPIMEAIEERQKKIADGLAAADRAAKDLDLAQAN 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             ++  + +    E+I  A  R   + +E     +      L     +I   +  A+  L
Sbjct: 61  ASDQLKEAKRAASELIEQANKRKAQIIDEAKAEAQTEREKILAQGMAEIEAERNRARDEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V    +II + ++ D  + I  K  + +
Sbjct: 121 RKQVATLAVIGAEKIIERSIDADAQADILNKVTAEL 156


>gi|290969219|ref|ZP_06560744.1| ATP synthase F0, B subunit [Megasphaera genomosp. type_1 str. 28L]
 gi|290780725|gb|EFD93328.1| ATP synthase F0, B subunit [Megasphaera genomosp. type_1 str. 28L]
          Length = 164

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 63/154 (40%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T ++     I LV+++       LL  ++    +I  D+ EA + + ++  +   Y+
Sbjct: 4   INGTLILQFVNFIVLVLILAKFAYKPLLKVMEERRQRIAADLDEAAKAKTEAAQLKADYE 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +        +EI+  A   A   A+     + +  A   +  + +I   +  A + +  
Sbjct: 64  AQLRDARARAQEIVDKAVKAADREAQVQLDAVREQIAREKEIAQAEITNEREAALKQMRQ 123

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++   S+ +  +++ + MND  N  +    +  +
Sbjct: 124 EVVTLSMAVAEKLLHKNMNDAQNEKLVADYLDQL 157


>gi|52426405|ref|YP_089542.1| F0F1 ATP synthase subunit B [Mannheimia succiniciproducens MBEL55E]
 gi|81691271|sp|Q65Q03|ATPF_MANSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|52308457|gb|AAU38957.1| AtpF protein [Mannheimia succiniciproducens MBEL55E]
          Length = 156

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/156 (13%), Positives = 63/156 (40%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M+ + T +  +             +   ++  ++     I + +  A + ++   +    
Sbjct: 1   MNLNATLIGQLIAFALFTWFCVKFVWPPIIKAIEERQSSIANALASAEKAKQDQADSQAA 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            +++    +EE ++II  A  R   + EE     E + A  +     ++   +   +  L
Sbjct: 61  VEQEILAAKEEAQKIIDLANKRRNDILEEVKTEAENLKATIIAQGHAEVEAERKRVQEEL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             K+A  ++    +I+ + +++  N+ I +K ++ +
Sbjct: 121 RVKVASLAIAGAEKIVGRTVDEAANNDIIDKLVAEL 156


>gi|291437212|ref|ZP_06576602.1| H(+)-transporting two-sector ATPase chain b protein [Streptomyces
           ghanaensis ATCC 14672]
 gi|291340107|gb|EFE67063.1| H(+)-transporting two-sector ATPase chain b protein [Streptomyces
           ghanaensis ATCC 14672]
          Length = 181

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 18/156 (11%), Positives = 63/156 (40%), Gaps = 2/156 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  ++ +I    +    +P+ +   L+   + I   I +A   + +++++L QYK + ++
Sbjct: 25  IGLLAFVIVFGFLAKKLLPN-INKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAE 83

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E   +   A+ +   L  E     ++     +     ++   +  A   L   I   
Sbjct: 84  ARHEAARLRQEAQEQGAALIAEMRAEGQRQREEIIAAGHTQVEADRKAASAALRQDIGKL 143

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQM 162
           + ++  +++ + + +    S + ++ +  ++   + 
Sbjct: 144 ATDLAGKLVGESLEDHARQSRVIDRFLDQLEEKAEA 179


>gi|218900435|ref|YP_002448846.1| ATP synthase F0, B subunit [Bacillus cereus G9842]
 gi|228903783|ref|ZP_04067900.1| ATP synthase B chain [Bacillus thuringiensis IBL 4222]
 gi|228942456|ref|ZP_04104993.1| ATP synthase B chain [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228968436|ref|ZP_04129426.1| ATP synthase B chain [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228975388|ref|ZP_04135944.1| ATP synthase B chain [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228982025|ref|ZP_04142318.1| ATP synthase B chain [Bacillus thuringiensis Bt407]
 gi|226741301|sp|B7IQW2|ATPF_BACC2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|218545169|gb|ACK97563.1| ATP synthase F0, B subunit [Bacillus cereus G9842]
 gi|228777689|gb|EEM25963.1| ATP synthase B chain [Bacillus thuringiensis Bt407]
 gi|228784370|gb|EEM32393.1| ATP synthase B chain [Bacillus thuringiensis serovar thuringiensis
           str. T01001]
 gi|228791252|gb|EEM38864.1| ATP synthase B chain [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228817198|gb|EEM63286.1| ATP synthase B chain [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228855872|gb|EEN00415.1| ATP synthase B chain [Bacillus thuringiensis IBL 4222]
 gi|326943107|gb|AEA19003.1| F0F1 ATP synthase subunit B [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 168

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A R   +++ ++ + +E   +   E +
Sbjct: 22  FLILLVMLRKFAWGPLMGIMKEREEHVTNEIDAAERSNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQAVDQKDVIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|24379921|ref|NP_721876.1| F0F1 ATP synthase subunit B [Streptococcus mutans UA159]
 gi|26006946|sp|P95785|ATPF_STRMU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24377901|gb|AAN59182.1|AE014985_6 FoF1 membrane-bound proton-translocating ATPase, b subunit
           [Streptococcus mutans UA159]
          Length = 165

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 63/146 (43%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            I L+++V     S L +   A  +KI  DI +A   R+ ++ +  + + + ++ ++E  
Sbjct: 20  FILLLLLVKKFAWSQLAAIFKAREEKIAKDIDDAENSRQNAQVLENKRQVELNQAKDEAA 79

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           +II  AK   K    +      + +        Q I   K EA   + A +AD SV +  
Sbjct: 80  QIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKAEALSSVKADVADLSVLLAE 139

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSC 159
           +I+++ ++      + +  +  +   
Sbjct: 140 KIMAKNLDKTAQGDLIDSYLDKLGDA 165


>gi|254509064|ref|ZP_05121167.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus 16]
 gi|219547997|gb|EED25019.1| ATP synthase F0, B subunit [Vibrio parahaemolyticus 16]
          Length = 154

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 55/154 (35%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T L         V      +   +++ ++    KI D +  A R  +          
Sbjct: 1   MNATLLGQAISFALFVWFCMKYVWPPIMNAIEERQKKIADGLQAAERAEKDLNLAQANAS 60

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  + +    E+I  A  R   + +E  +  +      L   E +I   +  A+  L  
Sbjct: 61  SQMKEAKRTATEVIEQANKRKTQILDEAREEAQAERQKILAQAEAEIEAERNRARDELRK 120

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
           ++A  ++    +I+ + ++ D +  + +   + +
Sbjct: 121 QVATLALAGAEKILERSIDKDAHKDLLDNITAKL 154


>gi|289423308|ref|ZP_06425116.1| ATP synthase F0, B subunit [Peptostreptococcus anaerobius 653-L]
 gi|289156239|gb|EFD04896.1| ATP synthase F0, B subunit [Peptostreptococcus anaerobius 653-L]
          Length = 166

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 66/152 (43%)

Query: 6   TFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
            F   ++  I L  V+   +   +L  +D    +I+  I +  +  E+      +Y+EK 
Sbjct: 12  EFFFTIANTIILFFVLKRLLFKPVLKVIDDRDQEIKKKIDDGNKALEEGLEFKEEYEEKL 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            +++ + +EI+  +K RA   AE+        ++   +     I   + +A   +   I+
Sbjct: 72  DQIKNQGQEILEKSKKRADERAEKIILEARNEASAIKQKASLDIEKERQQAYEDVKGDIS 131

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQ 157
           + ++    ++I + ++ D +  + ++ I  + 
Sbjct: 132 EIAILAASKVIEKDIDTDKHKELIDEFIKEVG 163


>gi|150006930|ref|YP_001301673.1| ATP synthase subunit B [Parabacteroides distasonis ATCC 8503]
 gi|255016048|ref|ZP_05288174.1| ATP synthase B subunit [Bacteroides sp. 2_1_7]
 gi|256842071|ref|ZP_05547576.1| ATP synthase F0, B subunit [Parabacteroides sp. D13]
 gi|262384327|ref|ZP_06077462.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_33B]
 gi|298377355|ref|ZP_06987308.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_19]
 gi|301308755|ref|ZP_07214707.1| ATP synthase F0, B subunit [Bacteroides sp. 20_3]
 gi|226694340|sp|A6L8N7|ATPF_PARD8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149935354|gb|ABR42051.1| ATP synthase B subunit [Parabacteroides distasonis ATCC 8503]
 gi|256736387|gb|EEU49716.1| ATP synthase F0, B subunit [Parabacteroides sp. D13]
 gi|262294030|gb|EEY81963.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_33B]
 gi|298265769|gb|EFI07429.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_19]
 gi|300833279|gb|EFK63897.1| ATP synthase F0, B subunit [Bacteroides sp. 20_3]
          Length = 166

 Score = 76.8 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 73/155 (47%), Gaps = 2/155 (1%)

Query: 7   FLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHS 66
           F + +S  I  VI+     P +++  ++     I + +  AR+  E+  +I  + ++  +
Sbjct: 12  FWMIVSFGIVFVILSKYGFP-VIVKAIEQRKAYIDNSLETARQANERLAHIQAEGEKMLA 70

Query: 67  KVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIAD 126
           + +E+   ++  A    + + EE  +     + L +++  ++I   K +A R + ++IAD
Sbjct: 71  EAKEKQNAVLKEAFAEKERIIEEARKKAVSEAHLQIEEATRRIREEKEKAIREVRSEIAD 130

Query: 127 FSVEIVREIISQKMN-DDVNSSIFEKTISSIQSCH 160
            S+ I  +++ +K+  D     + ++ +  +    
Sbjct: 131 LSIAIAEKVMKEKIGRDKEQQQMIDRLLDEVSFSK 165


>gi|302669536|ref|YP_003829496.1| ATP synthase F0 B subunit AtpF1 [Butyrivibrio proteoclasticus B316]
 gi|302394009|gb|ADL32914.1| ATP synthase F0 B subunit AtpF1 [Butyrivibrio proteoclasticus B316]
          Length = 191

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 71/154 (46%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            TF++ +  +   V ++   +   +   L+   +     I EAR  ++K++++  QY+  
Sbjct: 38  WTFIIQIINLFIQVFLIKKFLFKPINDILEKRRNLADKSIREAREAQDKADSLKEQYESS 97

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +K   E  EI+  A+  A++ A+   Q  EQ +A         I   K +A      +I
Sbjct: 98  LTKAHAEAAEIVSEAQKEAQVKADTIVQEAEQQAAGIKARAAADIEQEKKKAINEAKDEI 157

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
              +++I  +++ +++N+  +  + +  I+ + +
Sbjct: 158 GGLAMDIAGKVVEKEINEADHRKLIDDFINKVGA 191


>gi|300741311|ref|ZP_07071332.1| ATP synthase F0, B subunit [Rothia dentocariosa M567]
 gi|300380496|gb|EFJ77058.1| ATP synthase F0, B subunit [Rothia dentocariosa M567]
          Length = 182

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/155 (12%), Positives = 61/155 (39%), Gaps = 2/155 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
           +  +  +I   IV    +P           + I   + +A + + ++     +Y ++   
Sbjct: 23  ITVVGFVILYFIVHKYVVP-AFEKIYQDRKEAIEGGLAKAEKAQAEAAAAREEYNQQLEN 81

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E ++I   A+   + +     +     +     + ++ I   +L A   L  ++   
Sbjct: 82  ARLEAQKIREEARTEGESIIAAARERATVEAQRITDNAQKTIEAERLAASVSLRHEVGTL 141

Query: 128 SVEIVREIISQKMNDDVNS-SIFEKTISSIQSCHQ 161
           +  +  +I+ + ++DD  S  + ++ ++ +++  Q
Sbjct: 142 ATTLAGKIVGEALDDDERSARVVDRFLADLETEQQ 176


>gi|303230072|ref|ZP_07316844.1| ATP synthase F0, B subunit [Veillonella atypica ACS-134-V-Col7a]
 gi|302515282|gb|EFL57252.1| ATP synthase F0, B subunit [Veillonella atypica ACS-134-V-Col7a]
          Length = 165

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 64/149 (42%), Gaps = 1/149 (0%)

Query: 10  FMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVE 69
            ++  I + I+        L+S +    ++I  D+ +A+  R ++E     Y  + +   
Sbjct: 13  MLNFFILVWILARF-AYKPLVSMMQERKERIAKDLADAQAARNEAEQFKADYAAQIANAR 71

Query: 70  EETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSV 129
           +E ++I+  A  +A+    E      +      +   Q I   +  A   L  ++   SV
Sbjct: 72  QEAQQIVEKAVQQAEATTREQLAAAREQIEREKERARQDIVNERDRAMNNLRNEVISLSV 131

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +  +++++ M+ + N+ + E  I+ + S
Sbjct: 132 AMATKVVAKDMDSETNTKLIEDAIAKLDS 160


>gi|324329257|gb|ADY24517.1| F0F1 ATP synthase subunit B [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 168

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 63/147 (42%)

Query: 14  IIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETR 73
            + L++++       L+  +    + + ++I  A +   +++ ++ + +E   +   E +
Sbjct: 22  FLVLLVMLRKFAWGPLMGIMKEREEHVNNEIDAAEKNNAEAKKLVEEQREMLKQSRVEAQ 81

Query: 74  EIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIVR 133
           E+I  AK +A    +      ++ +        Q+I   K +A   L  ++A  SV+I  
Sbjct: 82  ELIERAKKQADDQKDAIVAAAKEEAESIKASAVQEIQREKEQAIAALQEQVASLSVQIAS 141

Query: 134 EIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++I +++ ++    +    I  +    
Sbjct: 142 KVIEKELKEEDQVKLIRDYIKEVGEAR 168


>gi|291460681|ref|ZP_06600071.1| ATP synthase F0, B subunit [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291416640|gb|EFE90359.1| ATP synthase F0, B subunit [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 167

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 72/155 (46%)

Query: 5   ETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEK 64
            TF+  +  +   + ++   +   +   +    +K   DI  A + RE++E++  +Y++ 
Sbjct: 12  WTFIATILNLFLQLYLIKRFLFKPVQEVIRKRQEKADQDIRAAEKAREEAESVRSEYEKN 71

Query: 65  HSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKI 124
            +    E   II  AK  A+  +E+  +  E+ +       +Q I   + +A   L  +I
Sbjct: 72  MANARAEASSIIDRAKKDAESRSEQLLRAAEEQAKNLKTKADQDIRQERRKALNELKGEI 131

Query: 125 ADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
              +++I  +++ +++++  + S+ E  + +++  
Sbjct: 132 GGIAMDIAGKVVEKEIDEKDHRSLIEDFLKNVEEA 166


>gi|256827617|ref|YP_003151576.1| ATP synthase, F0 subunit b [Cryptobacterium curtum DSM 15641]
 gi|256583760|gb|ACU94894.1| ATP synthase, F0 subunit b [Cryptobacterium curtum DSM 15641]
          Length = 199

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 71/156 (45%), Gaps = 1/156 (0%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            DE   + ++ II  +I+       +    L    + I++ + ++   R++SE +L QYK
Sbjct: 41  MDEFIPMLVAFIILWIILAKFG-WPLFDKMLVKRENTIKESLEKSEEARQESERVLAQYK 99

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++ +    +I+  AK        +     ++ ++  +   +  I   K  A   L  
Sbjct: 100 QELAEAKATAAQIVADAKAAGTAAKADITAQAQREASDMIAKAQVAIDAEKKAAIAELQG 159

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            +AD S+ +  ++I   ++DD + ++ E+ ++   S
Sbjct: 160 SVADVSIAVASKLIGSDLSDDEHRALIERYVNEAGS 195


>gi|227832896|ref|YP_002834603.1| ATP synthase B chain [Corynebacterium aurimucosum ATCC 700975]
 gi|262182615|ref|ZP_06042036.1| ATP synthase B chain [Corynebacterium aurimucosum ATCC 700975]
 gi|227453912|gb|ACP32665.1| ATP synthase B chain [Corynebacterium aurimucosum ATCC 700975]
          Length = 190

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 64/158 (40%), Gaps = 2/158 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSK 67
              +   I L++   L +P      L    D+I   +  A   + +++  L +Y  + + 
Sbjct: 34  WSIIPFTIILIVFWKLVLP-AYNKMLQEREDRIEGGLKRAEAQQAEAKAALEKYNAQLAD 92

Query: 68  VEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
              E  EI   A+ R K++  E  +  E+ S   L   E+++   + +    L + I   
Sbjct: 93  ARAEAAEIREQARERGKLIEAEAKEAAEEESRRILTAGEKQLEASRAQVVSELRSDIGQN 152

Query: 128 SVEIVREIISQKM-NDDVNSSIFEKTISSIQSCHQMDK 164
           S+ +  +++  ++ +    SS  +  +S + +     K
Sbjct: 153 SINLAEKLLGGELSDATKQSSTIDNFLSELDTVAPAGK 190


>gi|220927391|ref|YP_002502693.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951998|gb|ACL62390.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 162

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/162 (24%), Positives = 81/162 (50%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  +  F V ++ ++F  IV       ++L+ LD   +++R ++ EARRLRE++  +L  
Sbjct: 1   MLMEPEFWVAVAFVVFCGIVWKAGGFDLILNGLDHRGERVRRELEEARRLREEAAAVLAD 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
           Y+++ ++ E E   I+  A+  A+  A EG   + +      K  E KI   + +A   +
Sbjct: 61  YQKRRAEAEREAEAIVANAREEAERAAAEGHARLNEFVTRRTKAAEAKIAQAEAQAAAEV 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCHQM 162
            A  A+ +V I   I+ +K+  +    +  +++  I++  + 
Sbjct: 121 RAAAAEAAVRISETILREKVGGEAGQDLIRRSLGDIRTRLRA 162


>gi|147679151|ref|YP_001213366.1| F0F1-type ATP synthase, subunit b [Pelotomaculum thermopropionicum
           SI]
 gi|226694344|sp|A5CYE6|ATPF_PELTS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|146275248|dbj|BAF60997.1| F0F1-type ATP synthase, subunit b [Pelotomaculum thermopropionicum
           SI]
          Length = 162

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/157 (20%), Positives = 68/157 (43%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
           F+ T L  +   I L+I + L     L+  L   ++ I  +I  A + R+++E +   Y+
Sbjct: 4   FNATLLAQIVDFIILLIFLRLVAYKPLMKLLSERSEHIERNIAAAEKERQQAEQLRASYE 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            +  +  E+ +EII  A    +  A +  +N +  +    +    +I   K +A   L  
Sbjct: 64  AEMRRAREQAQEIIQKATKAGEEQALQIIENAKNETVRMKETALAEIEREKQKAMAELRD 123

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSC 159
           ++   S+ +  +II++ M+ ++   I    I      
Sbjct: 124 QVVTLSILVAGKIINRSMSSEIQHEIVRDFIKEAGEL 160


>gi|222085045|ref|YP_002543574.1| ATP synthase F0, B subunit [Agrobacterium radiobacter K84]
 gi|221722493|gb|ACM25649.1| ATP synthase F0, B subunit [Agrobacterium radiobacter K84]
          Length = 163

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 47/158 (29%), Positives = 93/158 (58%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            DETF  F++L++F+ +VVYL++P ++   LD  AD+IR+++ EA+RLRE+++++L +Y+
Sbjct: 5   LDETFFAFVALLLFIGLVVYLKVPGMMAKSLDDRADQIRNELAEAKRLREEAQHLLAEYQ 64

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
            K  + E +   I+ AA+  A++L  E  +  E+  A      EQKI   + +A + + +
Sbjct: 65  RKRKEAEADAANIVAAAEREAEMLTTEARKKTEEFVANRTALSEQKIKQAEADAMKAVRS 124

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
              D ++     ++++K    V S +F   +S +++  
Sbjct: 125 AAVDLAIAAAESVLAKKAGGKVQSELFSNAVSEVKTRL 162


>gi|121534923|ref|ZP_01666742.1| ATP synthase F0, B subunit [Thermosinus carboxydivorans Nor1]
 gi|121306522|gb|EAX47445.1| ATP synthase F0, B subunit [Thermosinus carboxydivorans Nor1]
          Length = 167

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 66/158 (41%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
            + T +  +   + LV ++       L+  L     +I + I  A R R  +E +  +Y+
Sbjct: 4   LNATLIAQIINFLILVAILTKVAYKPLMQALADRQARIAESIAAADRERAAAEELRREYQ 63

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           ++ ++   + + I+  A   A+   E+  +      A  LK+ + +I   +  A   +  
Sbjct: 64  QQLAEARTQAQAIVEKAMKLAEQTKEQILEEARAEHARLLKEAQAEIARERERALAQMKN 123

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQSCH 160
           ++   S+    +II Q +++  N+ + E  I  +    
Sbjct: 124 EVVSLSIAAATKIIGQNLDEKANAKLVEDFIDKLDRQK 161


>gi|121592738|ref|YP_984634.1| F0F1 ATP synthase subunit B [Acidovorax sp. JS42]
 gi|226694423|sp|A1W2T3|ATPF_ACISJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120604818|gb|ABM40558.1| ATP synthase F0, B subunit [Acidovorax sp. JS42]
          Length = 156

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 64/156 (41%)

Query: 1   MHFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ 60
           M  + T  V   + + LV+     +   +   LD  A KI D +  A R + +      +
Sbjct: 1   MSINATLFVQAIVFLILVLFTMKFVWPPITKALDERAQKIADGLAAADRAKTELAAADQR 60

Query: 61  YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
            K++ +    E    +  A+ RA+ + EE            +     +     ++A+  L
Sbjct: 61  VKQELAAASNEIATRLADAERRAQAIIEEAKARANDEGNKIVAAARAEAEQQAIQAREAL 120

Query: 121 YAKIADFSVEIVREIISQKMNDDVNSSIFEKTISSI 156
             ++A  +V+   +I+ +++N  V++ +  +  + +
Sbjct: 121 REQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL 156


>gi|323144396|ref|ZP_08079004.1| ATP synthase F0, B subunit [Succinatimonas hippei YIT 12066]
 gi|322415849|gb|EFY0