RPSBLAST alignment for GI: 254781085 and conserved domain: PRK14472

>gnl|CDD|172947 PRK14472, PRK14472, F0F1 ATP synthase subunit B; Provisional. Length = 175
 Score = 38.6 bits (90), Expect = 8e-04
 Identities = 33/153 (21%), Positives = 74/153 (48%), Gaps = 2/153 (1%)

Query: 8   LVFMSLIIFLVIVVYLRIPSI--LLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           L+F + + F+++++ L+  +   +LS L+     I+  I  A   ++++E IL + +E  
Sbjct: 20  LIFWTAVTFVIVLLILKKIAWGPILSALEEREKGIQSSIDRAHSAKDEAEAILRKNRELL 79

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
           +K + E  +II   K  A+ L  E  +     +   +   +++I   K  A  +L  ++A
Sbjct: 80  AKADAEADKIIREGKEYAEKLRAEITEKAHTEAKKMIASAKEEIEQEKRRALDVLRNEVA 139

Query: 126 DFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           D +V+   +II   ++ D    + +  I  + +
Sbjct: 140 DLAVKGAEKIIRTSLDADKQKKVVDSMIQDLST 172