RPSBLAST alignment for GI: 254781085 and conserved domain: PRK14475

>gnl|CDD|184697 PRK14475, PRK14475, F0F1 ATP synthase subunit B; Provisional. Length = 167
 Score = 61.5 bits (149), Expect = 1e-10
 Identities = 36/135 (26%), Positives = 72/135 (53%), Gaps = 1/135 (0%)

Query: 7   FLVFMSLIIFLVIVVYLRI-PSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH 65
           F V   L+IF  I++ L++ P  L   LDA+A KI+ ++ EA+RLRE+++ +L   K + 
Sbjct: 12  FWVGAGLLIFFGILIALKVLPKALAGALDAYAAKIQAELDEAQRLREEAQALLADVKAER 71

Query: 66  SKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIA 125
            + E +   ++ AAK  A+ +  E  + +E+      +  E+KI   + +A   + A   
Sbjct: 72  EEAERQAAAMLAAAKADARRMEAEAKEKLEEQIKRRAEMAERKIAQAEAQAAADVKAAAV 131

Query: 126 DFSVEIVREIISQKM 140
           D + +    +++ ++
Sbjct: 132 DLAAQAAETVLAARL 146