RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B
[Candidatus Liberibacter asiaticus str. psy62]
         (173 letters)



>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION
           transport, CF(0), stator, transport, acetylation,
           hydrogen ION transport; 2.8A {Bos taurus} (A:)
          Length = 214

 Score = 73.8 bits (181), Expect = 1e-14
 Identities = 17/156 (10%), Positives = 52/156 (33%), Gaps = 5/156 (3%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
                   +S I FLV +V     + +  F D   ++    + E ++   K     +  +
Sbjct: 53  ITPETFSAISTIGFLVYIVKK-YGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDME 111

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +    + ++   +    ++   +  E   +         +K+         +  + ++  
Sbjct: 112 KSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYH----ISVQNMMRQ 167

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
           K  +  +  V + + Q ++         K I+ ++ 
Sbjct: 168 KEQEHMINWVEKRVVQSISAQQEKETIAKCIADLKL 203


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-;
           fatty acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688)
          Length = 258

 Score = 31.8 bits (72), Expect = 0.048
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 10/79 (12%)

Query: 57  ILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEA 116
           IL   +E HS V+  +    L  K+R + L         QI       +E ++  +KLEA
Sbjct: 6   ILTTAREHHSSVKYASP--NLNMKYRKRQLVTR----EAQIK----DWVENELEALKLEA 55

Query: 117 KRLLYAKIADFSVEIVREI 135
           + +      +F +E  REI
Sbjct: 56  EEIPSEDQNEFLLERTREI 74



 Score = 27.2 bits (60), Expect = 1.4
 Identities = 13/83 (15%), Positives = 33/83 (39%), Gaps = 16/83 (19%)

Query: 51  REKSEN------IL-MQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLK 103
           RE   +       L M+Y+++  ++     +I    ++  + L  E  +   +    +L 
Sbjct: 11  REHHSSVKYASPNLNMKYRKR--QLVTREAQIKDWVENELEALKLEAEEIPSEDQNEFLL 68

Query: 104 DLEQKIHYMKLEAKRLLYAKIAD 126
           +  ++IH    EA+     ++  
Sbjct: 69  ERTREIH---NEAES----QLRA 84


>2f3o_A PFLD, PFL2, pyruvate formate-lyase 2; glycerol dehydratase,
           glycyl radical, hyperthermophilic, unknown function;
           HET: PGE; 2.90A {Archaeoglobus fulgidus} (A:)
          Length = 776

 Score = 29.6 bits (66), Expect = 0.25
 Identities = 19/102 (18%), Positives = 41/102 (40%), Gaps = 6/102 (5%)

Query: 21  VYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKH--SKVEEETREIILA 78
           V LRI + L S  +   +++  D  +A+ LRE+   I   ++ K   +       +I+  
Sbjct: 82  VGLRIINELDSLPNRETNRLMVDEEDAKVLREE---IAPYWQRKTIEAFAFPLMPDIMQI 138

Query: 79  AKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLL 120
             +   +        I  ++  Y   L +   +   E++R +
Sbjct: 139 L-YTGSVFVLTEIAGISHVAVNYPYLLRRGFRWFLEESERRI 179


>2ong_A 4S-limonene synthase; monoterpene synthase, monoterpene
           cyclase, geranyl diphosphate, 2 fluorogeranyl
           diphosphate linalyl diphosphate; HET: FPG BTB; 2.70A
           {Mentha spicata} PDB: 2onh_A*
           (A:1-48,A:216-302,A:524-543)
          Length = 155

 Score = 26.3 bits (58), Expect = 2.3
 Identities = 5/54 (9%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 60  QYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMK 113
           ++  + S++    +  +        +L E    ++  + A + ++L++   + +
Sbjct: 28  KHVIRASELVTLVKMELEKETMNPVVL-ELAILDLNIVQAQFQEELKESFRWWR 80


>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1;
          2.45A {Streptomyces toyocaensis} PDB: 2pg8_A*
          (A:1-147,A:238-285,A:403-440)
          Length = 233

 Score = 26.1 bits (57), Expect = 2.7
 Identities = 9/20 (45%), Positives = 13/20 (65%)

Query: 32 FLDAHADKIRDDIFEARRLR 51
          FLD HAD + D + + RR+ 
Sbjct: 62 FLDTHADAVYDRLTDHRRVH 81


>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC,
           cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo
           sapiens} (B:)
          Length = 263

 Score = 25.4 bits (54), Expect = 4.0
 Identities = 9/111 (8%), Positives = 36/111 (32%), Gaps = 3/111 (2%)

Query: 2   HFDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQ- 60
             +  + ++     ++       +    + +L A  +     I+   R  E+   +    
Sbjct: 150 MNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLE 209

Query: 61  --YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKI 109
             + +  S +   T +          IL  +  ++ +      ++ +++ +
Sbjct: 210 KLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL 260


>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA;
           heptameric ring, heptamer, ring, oligomer, RAD51
           polymerization motif; HET: DNA; 2.85A {Pyrococcus
           furiosus} (A:1-95)
          Length = 95

 Score = 24.4 bits (53), Expect = 9.1
 Identities = 11/69 (15%), Positives = 24/69 (34%), Gaps = 3/69 (4%)

Query: 42  DDIFEARRLREKSENILMQYKEK---HSKVEEETREIILAAKHRAKILAEEGCQNIEQIS 98
           +++ E     E       +   K     K+     ++       A+ L E G   +E I+
Sbjct: 4   EEVKEIDEFEELGFEPATEETPKKKKKEKIIRSIEDLPGVGPATAEKLREAGYDTLEAIA 63

Query: 99  ALYLKDLEQ 107
                +L++
Sbjct: 64  VASPIELKE 72


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.322    0.135    0.360 

Gapped
Lambda     K      H
   0.267   0.0504    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,219,172
Number of extensions: 52841
Number of successful extensions: 220
Number of sequences better than 10.0: 1
Number of HSP's gapped: 220
Number of HSP's successfully gapped: 43
Length of query: 173
Length of database: 4,956,049
Length adjustment: 83
Effective length of query: 90
Effective length of database: 2,150,234
Effective search space: 193521060
Effective search space used: 193521060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.0 bits)