RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B
[Candidatus Liberibacter asiaticus str. psy62]
         (173 letters)



>2cly_A ATP synthase B chain, mitochondrial; mitochondrion, ION transport,
           CF(0), stator, transport, acetylation, hydrogen ION
           transport; 2.8A {Bos taurus} SCOP: f.52.1.1
          Length = 214

 Score = 72.6 bits (178), Expect = 4e-14
 Identities = 18/156 (11%), Positives = 51/156 (32%), Gaps = 5/156 (3%)

Query: 3   FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62
                   +S I FLV +V     S+   F D   ++    + E ++   K     +  +
Sbjct: 53  ITPETFSAISTIGFLVYIVKKYGASVG-EFADKLNEQKIAQLEEVKQASIKQIQDAIDME 111

Query: 63  EKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYA 122
           +    + ++   +    ++   +  E   +         +K+       ++   ++    
Sbjct: 112 KSQQALVQKRHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQE 171

Query: 123 KIADFSVEIVREIISQKMNDDVNSSIFEKTISSIQS 158
            + ++  + V + IS             K I+ ++ 
Sbjct: 172 HMINWVEKRVVQSIS----AQQEKETIAKCIADLKL 203


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
            acid synthase, acyl-carrier-protein, beta-ketoacyl
            reductase, beta-ketoacyl synthase, dehydratase; 4.00A
            {Saccharomyces cerevisiae}
          Length = 1688

 Score = 38.3 bits (88), Expect = 0.001
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 18/99 (18%)

Query: 38   DKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQI 97
            DKI       R +    + IL   +E HS V+  +    L  K+R + L     Q     
Sbjct: 1213 DKI------GRSVPAPGKGILTTAREHHSSVKYASPN--LNMKYRKRQLVTREAQ----- 1259

Query: 98   SALYLKD-LEQKIHYMKLEAKRLLYAKIADFSVEIVREI 135
                +KD +E ++  +KLEA+ +      +F +E  REI
Sbjct: 1260 ----IKDWVENELEALKLEAEEIPSEDQNEFLLERTREI 1294


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 34.9 bits (80), Expect = 0.009
 Identities = 27/130 (20%), Positives = 49/130 (37%), Gaps = 28/130 (21%)

Query: 23  LRIPSILLSFLDAHADKIR-------DDIFEARRLREKSENILMQYKEKHSKVEEETREI 75
            R P  L     +H   +           F A +L+E+   IL +  E  +  +E T   
Sbjct: 6   TR-PLTL-----SHG-SLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPA 58

Query: 76  ILAAK---HRAKILAEEGCQNIEQISALYLKDLEQK------IHYMKLEAKRLLYAKIAD 126
            L  K   + + ++        +Q+  L L + E        IH +   A +LL  +  D
Sbjct: 59  ELVGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHAL---AAKLL--QEND 113

Query: 127 FSVEIVREII 136
            ++   +E+I
Sbjct: 114 TTLVKTKELI 123



 Score = 33.8 bits (77), Expect = 0.022
 Identities = 15/64 (23%), Positives = 20/64 (31%), Gaps = 28/64 (43%)

Query: 16  FLVIVVYLRIP--SILLSFLDAHADKIRDDI-------------------FEARRLREKS 54
           FL +      P  S LL    A +D I  D+                   F+   LR  S
Sbjct: 420 FLPVAS----PFHSHLLV--PA-SDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLS 472

Query: 55  ENIL 58
            +I 
Sbjct: 473 GSIS 476


>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic
           vesicle, membrane, Ca structural protein; 7.94A {Bos
           taurus}
          Length = 190

 Score = 34.9 bits (79), Expect = 0.011
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 35  AHADKIRDDIFEARRLREKSENILMQYKEKHSKV-EEETREIILAAKHRAKILAEEGCQN 93
           A AD++  +    R+ RE+    L Q  +  SKV E+E RE    AK   K L E   + 
Sbjct: 75  AQADRLTQEPESIRKWREEQRKRL-QELDAASKVMEQEWRE---KAK---KDLEEWNQRQ 127

Query: 94  IEQISALYLKD-LEQKIHYMKLEA 116
            EQ+    + + +  K  Y + +A
Sbjct: 128 SEQVEKNKINNRIADKAFYQQPDA 151


>3eyw_A C-terminal domain of glutathione-regulated potassium-efflux system
           protein KEFC fused...; KTN, RCK, K+ channel, K+
           transport, K+ efflux; HET: FMN NAD; 2.40A {Escherichia
           coli K12}
          Length = 413

 Score = 27.6 bits (61), Expect = 1.5
 Identities = 13/66 (19%), Positives = 25/66 (37%), Gaps = 7/66 (10%)

Query: 23  LRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHR 82
           L+   + L  L     + R+     RR   +         E+ + VE +T+      K  
Sbjct: 128 LKTGRLALESLGLGPYEARERADVFRRFNIQM-------VEEMAMVENDTKARAAVYKRT 180

Query: 83  AKILAE 88
           + +L+E
Sbjct: 181 SAMLSE 186


>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary
           protein KEFF; potassium channel regulation, domains,
           antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli}
           PDB: 3eyw_A* 3l9x_A*
          Length = 413

 Score = 26.8 bits (59), Expect = 2.5
 Identities = 14/81 (17%), Positives = 25/81 (30%), Gaps = 7/81 (8%)

Query: 23  LRIPSILLSFLDAHADKIRDDIFEARRLREKS-------ENILMQYKEKHSKVEEETREI 75
           L+   + L  L     + R+     RR   +        EN        + +      EI
Sbjct: 128 LKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTSAMLSEI 187

Query: 76  ILAAKHRAKILAEEGCQNIEQ 96
           I   +    ++   G Q  E+
Sbjct: 188 ITEDREHLSLIQRHGWQGTEE 208


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 26.5 bits (57), Expect = 2.9
 Identities = 9/23 (39%), Positives = 12/23 (52%), Gaps = 5/23 (21%)

Query: 106 EQKIHYMKLEAKRLLYAKIADFS 128
           +Q +   KL+A   LY   AD S
Sbjct: 19  KQALK--KLQASLKLY---ADDS 36


>3iyd_C DNA-directed RNA polymerase subunit beta; transcription,
           initiation, class I, activator, RNA polymerase,
           holoenzyme, sigma70, open complex, CAP, CRP,
           CAMP-dependent; HET: DNA CMP; 19.80A {Escherichia coli
           k-12}
          Length = 1342

 Score = 26.6 bits (58), Expect = 3.4
 Identities = 24/153 (15%), Positives = 62/153 (40%), Gaps = 10/153 (6%)

Query: 20  VVYLRIP-------SILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
            +++RI        +I+L  L+   ++I D  FE      +   + M+   +  + E  +
Sbjct: 193 NLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETAS 252

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
            +I    K   +       ++I Q+    +K +E  + Y+   A +++     D S   +
Sbjct: 253 FDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYI---AGKVVAKDYIDESTGEL 309

Query: 133 REIISQKMNDDVNSSIFEKTISSIQSCHQMDKN 165
               + +++ D+ + + +     I++    D +
Sbjct: 310 ICAANMELSLDLLAKLSQSGHKRIETLFTNDLD 342


>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid
           biosynthesis, P-loop kinase, metal- binding, shikimate
           pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis}
           SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A*
           2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A*
           1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A*
           3baf_A*
          Length = 184

 Score = 26.5 bits (57), Expect = 3.8
 Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 102 LKDLEQKIHYMKLEAKRL-LYAKIADFSV--------EIVREIISQ-KMNDDVNSSIFE 150
           L   ++   Y  L AKR  LY ++A   V         +VR I+S+ ++     ++  E
Sbjct: 120 LAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLE 178


>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase,
           hyperthermostable protein; HET: DNA BOG; 1.50A {Thermus
           thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*
          Length = 664

 Score = 26.3 bits (57), Expect = 3.8
 Identities = 19/91 (20%), Positives = 35/91 (38%), Gaps = 8/91 (8%)

Query: 37  ADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQ 96
           AD++ + +  A     +   +   Y  +H    E  R      K    ++  EG +    
Sbjct: 547 ADRVSEAMQRAIEETNRRRALQEAYNLEHGITPETVR------KEVRAVIRPEGYEEAPL 600

Query: 97  ISALYLKDLEQKIHYMKLEAKRLLYAKIADF 127
            + L  +DL ++I   +LE      A+  DF
Sbjct: 601 EADLSGEDLRERIA--ELELAMWQAAEALDF 629


>3ky7_A TRNA (guanine-N(1)-)-methyltransferase; putative tRNA
           (guanine-7-)-methyltransferase, structural genomics,
           infectious diseases; 2.35A {Staphylococcus aureus subsp}
          Length = 269

 Score = 25.9 bits (57), Expect = 5.1
 Identities = 15/60 (25%), Positives = 21/60 (35%), Gaps = 18/60 (30%)

Query: 23  LRIPSILLSFLDAHADKI---------------RDDIFEARRLREKSENILMQYKEKHSK 67
           L +P +LLS    +   I               R D+ E   L    + IL +YK    K
Sbjct: 212 LTVPDVLLS---GNHANIDAWRHEQKLIRTYNKRPDLIEKYPLTNADKQILERYKIGLKK 268


>2aua_A Hypothetical protein; dimer, structural genomics, PSI, protein
           structure initiative, midwest center for structural
           genomics, MCSG; 2.35A {Bacillus cereus} SCOP: d.166.1.6
          Length = 224

 Score = 26.0 bits (57), Expect = 5.3
 Identities = 13/64 (20%), Positives = 24/64 (37%), Gaps = 14/64 (21%)

Query: 26  PSILLSFLDAHADKIRDDIFEARRLRE--------------KSENILMQYKEKHSKVEEE 71
             +++S++D      R+ I E  RL+E              KS    +++K        E
Sbjct: 94  AKVVISYMDQTIRAARETIVEMVRLQEFPEYPSRLSCLYAAKSYEDALKWKALFDSYNRE 153

Query: 72  TREI 75
             +I
Sbjct: 154 VLQI 157


>3lu0_C DNA-directed RNA polymerase subunit beta; E. coli RNA polymerase,
           nucleotidyltransferase, transcription, transferase;
           11.20A {Escherichia coli} PDB: 3iyd_C*
          Length = 1342

 Score = 25.7 bits (56), Expect = 5.5
 Identities = 24/153 (15%), Positives = 62/153 (40%), Gaps = 10/153 (6%)

Query: 20  VVYLRIP-------SILLSFLDAHADKIRDDIFEARRLREKSENILMQYKEKHSKVEEET 72
            +++RI        +I+L  L+   ++I D  FE      +   + M+   +  + E  +
Sbjct: 193 NLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETAS 252

Query: 73  REIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYMKLEAKRLLYAKIADFSVEIV 132
            +I    K   +       ++I Q+    +K +E  + Y+   A +++     D S   +
Sbjct: 253 FDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYI---AGKVVAKDYIDESTGEL 309

Query: 133 REIISQKMNDDVNSSIFEKTISSIQSCHQMDKN 165
               + +++ D+ + + +     I++    D +
Sbjct: 310 ICAANMELSLDLLAKLSQSGHKRIETLFTNDLD 342


>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding
           motif, ATP- binding, nucleotide-binding, transferase;
           HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB:
           3a4l_A* 3a4n_A
          Length = 260

 Score = 25.9 bits (56), Expect = 5.7
 Identities = 7/42 (16%), Positives = 17/42 (40%)

Query: 130 EIVREIISQKMNDDVNSSIFEKTISSIQSCHQMDKNTTETLG 171
           EI +++I +         + E    +     ++DK T + + 
Sbjct: 162 EIAKKLIEKSKEIPKFYVLEENKNKNNNISDKIDKETRKIVS 203


>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics,
           PSI-2, protein structure initiative; 2.00A {Listeria
           monocytogenes}
          Length = 464

 Score = 25.4 bits (54), Expect = 7.2
 Identities = 13/107 (12%), Positives = 38/107 (35%), Gaps = 15/107 (14%)

Query: 59  MQYKEKHSKVEEETREIILAAKH------------RAKIL---AEEGCQNIEQISALYLK 103
           M  ++K  +  +E R +I +A                 I+   A+ G    E+++ +  +
Sbjct: 1   MSLEDKDLRSIQEVRNLIESANKAQKELAAMSQQQIDTIVKAIADAGYGAREKLAKMAHE 60

Query: 104 DLEQKIHYMKLEAKRLLYAKIADFSVEIVREIISQKMNDDVNSSIFE 150
           +    I   K+         + ++  ++    + ++ N+     +  
Sbjct: 61  ETGFGIWQDKVIKNVFASKHVYNYIKDMKTIGMLKEDNEKKVMEVAV 107


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.322    0.135    0.360 

Gapped
Lambda     K      H
   0.267   0.0595    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,414,458
Number of extensions: 65275
Number of successful extensions: 321
Number of sequences better than 10.0: 1
Number of HSP's gapped: 317
Number of HSP's successfully gapped: 63
Length of query: 173
Length of database: 5,693,230
Length adjustment: 86
Effective length of query: 87
Effective length of database: 3,608,246
Effective search space: 313917402
Effective search space used: 313917402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.5 bits)