RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781085|ref|YP_003065498.1| F0F1 ATP synthase subunit B [Candidatus Liberibacter asiaticus str. psy62] (173 letters) >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Length = 254 Score = 26.3 bits (58), Expect = 1.6 Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Query: 36 HADKIRDDIFEARRLREKSENILMQYKEKHSKVEEETREIILAAKHRAKILAEEG 90 H K+ I R++ SE+ L+ ++ E REI + A G Sbjct: 146 HMRKVNAQI---RKVVNMSEDELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGG 197 >d1n08a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 154 Score = 25.0 bits (54), Expect = 4.2 Identities = 13/61 (21%), Positives = 26/61 (42%), Gaps = 3/61 (4%) Query: 3 FDETFLVFMSLIIFLVIVVYLRIPSILLSFLDAHADKIRDDIFEARRLREKSENILMQYK 62 + F I+ ++++ Y+R P + + LD + I DI A ++ YK Sbjct: 92 IERQGEDFYEEIMRVIVLGYIR-PELNYAGLDKLIEDIHTDIRVALNSMDRPSYS--SYK 148 Query: 63 E 63 + Sbjct: 149 K 149 >d1mmsa1 a.4.7.1 (A:71-140) Ribosomal protein L11, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 70 Score = 23.4 bits (51), Expect = 9.6 Identities = 5/21 (23%), Positives = 9/21 (42%) Query: 122 AKIADFSVEIVREIISQKMND 142 + + + + EI KM D Sbjct: 25 KIVGKVTRKQIEEIAKTKMPD 45 >d2vjva1 d.58.57.1 (A:6-130) ISHP608 transposase {Helicobacter pylori [TaxId: 210]} Length = 125 Score = 23.5 bits (50), Expect = 9.7 Identities = 14/52 (26%), Positives = 23/52 (44%) Query: 61 YKEKHSKVEEETREIILAAKHRAKILAEEGCQNIEQISALYLKDLEQKIHYM 112 YK H+ V I+ K+R K+L +++I K+L +I M Sbjct: 2 YKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRVEIIEM 53 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.135 0.360 Gapped Lambda K H 0.267 0.0733 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 613,265 Number of extensions: 28067 Number of successful extensions: 106 Number of sequences better than 10.0: 1 Number of HSP's gapped: 106 Number of HSP's successfully gapped: 25 Length of query: 173 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 94 Effective length of database: 1,322,926 Effective search space: 124355044 Effective search space used: 124355044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.0 bits)