BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781086|ref|YP_003065499.1| F0F1 ATP synthase subunit B'
[Candidatus Liberibacter asiaticus str. psy62]
         (176 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254456391|ref|ZP_05069820.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083393|gb|EDZ60819.1| H+-transporting two-sector ATPase (subunit b) [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 179

 Score =  129 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/170 (27%), Positives = 96/170 (56%), Gaps = 1/170 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
             + +  S   P  +   ++SQ FWL + FGI Y V  + ILP++S+ +E R++ I  + 
Sbjct: 1   MEAFAAESGGMPQLNPEFWVSQIFWLTLTFGILYIVLSKLILPKISNNLETRKSQILENI 60

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E  +  + + E+ +  YEE ++ ++  AK I ++    A +++  +REV +K +  ++S 
Sbjct: 61  EAAEKQREDSETKLKEYEEIISKSKLEAKNIFNQAREKALKDINAKREVLDKQIDEEISK 120

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRD 171
           A+ EI+ + K A +++ +I  E + DL++K +G  V+++ +  I+D    
Sbjct: 121 AEEEINTLCKSAPEKINTIAIETSSDLIQKLIGAEVNNSSISAIVDDLSK 170


>gi|254781086|ref|YP_003065499.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040763|gb|ACT57559.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 176

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 176/176 (100%), Positives = 176/176 (100%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS
Sbjct: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL
Sbjct: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176
           SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF
Sbjct: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176


>gi|71082826|ref|YP_265545.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|123647458|sp|Q4FPE7|ATPF_PELUB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71061939|gb|AAZ20942.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 179

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/176 (26%), Positives = 92/176 (52%), Gaps = 2/176 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
             + +  S   P  +   ++SQ FWL I FGI Y V  + ILP++S+ +E R++ I  + 
Sbjct: 1   MEAFAAESGGMPQLNPEFWVSQIFWLIITFGILYVVLSKLILPKISANLENRKSQILENI 60

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E  +  + E E  I  YE+ +  ++  AK    +      +++  +RE+ EK+L  +++ 
Sbjct: 61  EAAEKQREESEQKIEEYEKIVQSSKNEAKNYFKQAREKVLKDIGVKREILEKELDEEVNK 120

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDR-KRDGIDAF 176
           A+ EI   +  A +++  I  E + DL+++ +G  V+ + +  I++   R  +D +
Sbjct: 121 AEIEIKTFRDNAPEKIKKIAVETSSDLLQELIGAEVNSSSISAIVEDLSRKKMDEY 176


>gi|91762751|ref|ZP_01264716.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718553|gb|EAS85203.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 179

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/176 (25%), Positives = 92/176 (52%), Gaps = 2/176 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
             + +  S   P  +   ++SQ FWL I FGI Y V  + ILP++S+ +E R++ I  + 
Sbjct: 1   MEAFAAESGGMPQLNPEFWVSQIFWLIITFGILYVVLSKLILPKISANLETRKSQILENI 60

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E  +  + E E  I  YE+ +  ++  AK    +      +++  ++E+ EK+L  +++ 
Sbjct: 61  EAAEKQREESEQKIEEYEKIVQSSKNEAKNYFKQAREKVLKDIGVKKEILEKELDEEVNK 120

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDR-KRDGIDAF 176
           A+ EI   +  A +++  I  E + DL+++ +G  V+ + +  I++   R  +D +
Sbjct: 121 AEIEIKTFRDNAPEKIKKIAVETSSDLLQELIGAEVNSSSISAIVEDLSRKKMDEY 176


>gi|239831260|ref|ZP_04679589.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
 gi|239823527|gb|EEQ95095.1| ATP synthase B' chain [Ochrobactrum intermedium LMG 3301]
          Length = 244

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 86/168 (51%), Gaps = 1/168 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 75  AHDAGHGSGVFPPFDSTHYASQLLWLAITFGLFYLFMSRVVLPRIGGVIETRRDRIAQDL 134

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ LA AR  A  I +      +     +R   E  L  KL  
Sbjct: 135 EQAARLKQDADNAIAAYEQELAQARTKAASIAEAAREKGKGEANAERASAEAALEGKLKE 194

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           A+  I  ++ KA  +V +I  E T ++V + LG     A V   +   
Sbjct: 195 AEERIAAIKAKAMNDVGNIAEETTAEIVEQLLGTKADKASVTAAVKAA 242


>gi|298294369|ref|YP_003696308.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
 gi|296930880|gb|ADH91689.1| H+transporting two-sector ATPase B/B' subunit [Starkeya novella DSM
           506]
          Length = 204

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/173 (31%), Positives = 83/173 (47%), Gaps = 1/173 (0%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A   +      FPPFD  TF SQ  WLAI FG  Y +  R  LPR+++I+E R + I+ 
Sbjct: 32  IAVPPAEAHGGGFPPFDVHTFPSQLIWLAIAFGALYLLMSRIALPRIANILEERHDRIAD 91

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D E+    K E E+   +YE++LA AR  A  I  +       + E  R+  E +L  KL
Sbjct: 92  DLEEAGKLKAESEAAAYAYEQALASARNKAHGIATETRDKLAADSEAGRKSLEAELSAKL 151

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           + A+ +I   +  A   V  I  +    +V   +G + +   V+  +D    G
Sbjct: 152 AAAETQIAATKDAAMSNVRGIAVDAAGAIVGNLIGTAPAPQAVEAAVDTAIKG 204


>gi|319784763|ref|YP_004144239.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170651|gb|ADV14189.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 199

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 1/168 (0%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
            +S  ++    FPPFD +TF SQ  WLAI FG+FY    R ++PR+  I++VR + I+ D
Sbjct: 29  GTSVPAEAHGTFPPFDPATFPSQLLWLAITFGLFYLFLKRVVMPRVGGIIDVRNDRITQD 88

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            ++    K E ++ +++YE+ LA A+  A  I  +   AA+   +  R+  E  L  KL 
Sbjct: 89  LDQAARLKGEADAAVAAYEQELAEAKTKANAIGQQANDAAKAEADTARKKVEAALDAKLG 148

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDR 168
            A+  I  ++  A +EV SI  +    +V  L G   S A++   +  
Sbjct: 149 EAEARISSIKANAMKEVGSIAEDTASAIVEALVGGKASKAEIAAAVKS 196


>gi|153007847|ref|YP_001369062.1| F0F1 ATP synthase subunit B' [Ochrobactrum anthropi ATCC 49188]
 gi|226694372|sp|A6WW79|ATPF1_OCHA4 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|151559735|gb|ABS13233.1| H+transporting two-sector ATPase B/B' subunit [Ochrobactrum
           anthropi ATCC 49188]
          Length = 205

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/168 (31%), Positives = 87/168 (51%), Gaps = 1/168 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++ +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 36  ANDAGHGSGVFPPFDSTHYASQILWLAITFGLFYLFMSRVVLPRIGGVIETRRDRIAQDL 95

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ L  AR  A  I +      +   + +R   E  L  KL  
Sbjct: 96  EQAARLKQDADNAIAAYEQELTQARTKAASIAEAAREKGKGEADAERATAEAALERKLKE 155

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           A+  I  ++ KA  +V +I  E T ++V + LG     A V   +   
Sbjct: 156 AEERIAAIKAKAMNDVGNIAEETTAEIVEQLLGTKADKASVTAAVKAS 203


>gi|304391257|ref|ZP_07373201.1| ATP synthase B' chain [Ahrensia sp. R2A130]
 gi|303296613|gb|EFL90969.1| ATP synthase B' chain [Ahrensia sp. R2A130]
          Length = 174

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/169 (33%), Positives = 97/169 (57%), Gaps = 1/169 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++     +  FPPFDTSTF SQ  WL + FG+FY++  R +LPR+S I+E R   I+ D 
Sbjct: 5   TTEPGAAAGVFPPFDTSTFTSQILWLVLSFGLFYYIMSRVVLPRISGILETRSGRIAQDL 64

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           ++ +  K E ++ I++YE+ LA A+ +A +I  +   A +   + +R   E D+  ++++
Sbjct: 65  DEANRLKDESDAAIAAYEQDLATAKTNAHKIAQEARDAGKAEADVKRAEVEADMTARVAD 124

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKR 170
           A+  I  ++  A  +V SI  E  + LV + LG  V+ A+V K +   +
Sbjct: 125 AEARIAKIKSDAMSDVGSIATETAETLVSQLLGSKVTKAEVAKAVSNVK 173


>gi|260460367|ref|ZP_05808619.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
 gi|259034012|gb|EEW35271.1| H+transporting two-sector ATPase B/B' subunit [Mesorhizobium
           opportunistum WSM2075]
          Length = 199

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 89/168 (52%), Gaps = 1/168 (0%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
            +S  ++    FPPFD +TF SQ  WLAI FG+FY    R ++PR+  I++VR + IS D
Sbjct: 29  GTSVPAEAHGTFPPFDPATFPSQLLWLAITFGLFYLFLKRVVVPRVGGIIDVRNDRISQD 88

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            ++    K E ++ +++YE+ LA A+ +A  I  +   AA+   +  R+  E  L  KL 
Sbjct: 89  LDQAAKLKGEADAAVAAYEQELAEAKKNANSIGQQAADAAKAEADTARKKIEAALDEKLG 148

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDR 168
            A+  I  ++  A +EV SI  +    +V  L G   S A++   +  
Sbjct: 149 EAEARISSIKANAMKEVGSIAEDTASAIVEALVGGKASKAEIAAAVKS 196


>gi|118590787|ref|ZP_01548188.1| F0F1 ATP synthase subunit B' [Stappia aggregata IAM 12614]
 gi|118436763|gb|EAV43403.1| F0F1 ATP synthase subunit B' [Stappia aggregata IAM 12614]
          Length = 175

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
            +++  + FPPFD++TF SQ  WLAI FG+FYW+     +PR++ I+E RR+ I+ D  +
Sbjct: 8   PAAEHGAGFPPFDSTTFASQLLWLAITFGVFYWIMKNVAVPRIAGILEDRRDRIAGDISE 67

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            +  K E ++ I++YE++LA AR  A  I  +     + + E +RE  E +L  KL  A+
Sbjct: 68  ANRLKEETDAAIAAYEQALAEARNKAHGIAHETRTKLKADHEARREKVEAELNGKLKEAE 127

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV-SDADVQKILDRKRD 171
            +I   +  A  ++  I GE    LV +L     +  D+ K L    +
Sbjct: 128 AQIAATKTDALSQIGDIAGETASALVEQLIGKAPTKTDLTKALKSAMN 175


>gi|149915444|ref|ZP_01903971.1| ATP synthase F0, B' subunit [Roseobacter sp. AzwK-3b]
 gi|149810733|gb|EDM70574.1| ATP synthase F0, B' subunit [Roseobacter sp. AzwK-3b]
          Length = 181

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 77/165 (46%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +   P      + +Q FWL +   + ++   R  LPR+++++  R+  I++D    + 
Sbjct: 17  GSAVGMPQLCFDWWPNQIFWLTVTLVVIFFFLSRVALPRIAAVLAERQGTITNDLAAAED 76

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K +      +Y ++LA ARA A++II +  A  + +L+      + ++  KL+ ++  I
Sbjct: 77  LKVKAVEAEEAYNKALANARAEAQKIIAQAKAEIQADLDDATAKADAEISAKLAESEKTI 136

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
             +++ A   V  +  +  K+LV  LG S     +   +  K  G
Sbjct: 137 AAIREGAMDSVKEVAKDTAKELVAALGGSADARSITSAVTAKMKG 181


>gi|13476165|ref|NP_107735.1| F0F1 ATP synthase subunit B' [Mesorhizobium loti MAFF303099]
 gi|81776792|sp|Q986D2|ATPF1_RHILO RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|14026925|dbj|BAB53521.1| FoF1 ATP synthase, subunit B [Mesorhizobium loti MAFF303099]
          Length = 193

 Score =  112 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 87/168 (51%), Gaps = 1/168 (0%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
            +   ++    FPPFD +TF SQ  WLAI FG+FY    +  +PR+  I++VR + IS D
Sbjct: 23  GTGVPAEAHGTFPPFDPATFPSQLLWLAITFGLFYLFLKKVAMPRIGGIIDVRNDRISQD 82

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            ++    K E ++ +++YE+ LA A+ +A  I  +   AA+   E  R+  E  L  KL 
Sbjct: 83  LDQASKLKGEADAAVAAYEQELAEAKKNASSIGQQAADAAKAEAETARKKIEAALDEKLG 142

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDR 168
            A+  I  ++  A +EV SI  +    +V  L G   S A++   +  
Sbjct: 143 EAEARISSIKANAMKEVGSIAEDTASAIVEALVGGKASKAEIAAAVKS 190


>gi|300024394|ref|YP_003757005.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526215|gb|ADJ24684.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 187

 Score =  111 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 46/159 (28%), Positives = 76/159 (47%), Gaps = 1/159 (0%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
                P  +   F  Q FWL + F    +V  R  LPR+  ++E RR+ I  D E     
Sbjct: 23  EGGGLPQLNPEHFTGQLFWLVLTFVALLFVMSRIALPRVGDVLEERRDRIKRDLESAARL 82

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K E ++ +++YE++LA AR++A  I  +         E +R   +  +  KL +A+  I 
Sbjct: 83  KDETDAALANYEKALADARSNASGIAKETREKLAAETEAERHRVDAQIAVKLQDAEARIS 142

Query: 129 DMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKIL 166
             + KA   +  +  E  + +V K +G  VS  DV+K+L
Sbjct: 143 TTKSKAVSAIGEVATETARAVVSKLIGHDVSPEDVKKVL 181


>gi|114705288|ref|ZP_01438196.1| ATP synthase subunit B [Fulvimarina pelagi HTCC2506]
 gi|114540073|gb|EAU43193.1| ATP synthase subunit B [Fulvimarina pelagi HTCC2506]
          Length = 199

 Score =  111 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 86/169 (50%), Gaps = 1/169 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           S  +    + FPPF++  F SQ  WLA+ FG+FYWV    ++PR+  I+E RR+ I+ D 
Sbjct: 30  SGGAGGHEAGFPPFNSEYFPSQLLWLAVTFGVFYWVLKNVLVPRVGGILENRRDRIALDM 89

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E  + AK++ +   ++YE+ LA AR  A  I       A    + QRE  E +L  ++  
Sbjct: 90  EAAERAKQDADEAQAAYEQELAEARERAHSIGQDARNDARSEADAQREKLEAELDARIDE 149

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKR 170
           ++  I   +  A  E+  +  +V + ++R +    VS  +V   +   R
Sbjct: 150 SRARIVAAKTAAMGEMNEMATDVAETILRDVVKVDVSRTEVASAVAETR 198


>gi|254713046|ref|ZP_05174857.1| F0F1 ATP synthase subunit B' [Brucella ceti M644/93/1]
 gi|254716601|ref|ZP_05178412.1| F0F1 ATP synthase subunit B' [Brucella ceti M13/05/1]
 gi|261218400|ref|ZP_05932681.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261320751|ref|ZP_05959948.1| ATP synthase subunit B [Brucella ceti M644/93/1]
 gi|260923489|gb|EEX90057.1| ATP synthase subunit B [Brucella ceti M13/05/1]
 gi|261293441|gb|EEX96937.1| ATP synthase subunit B [Brucella ceti M644/93/1]
          Length = 208

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 87/167 (52%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 36  AHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDL 95

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I+ YE+ LA AR+ A  I +      +   + +R   E  L  KL  
Sbjct: 96  EQAARLKQDADNAIADYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKE 155

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           A+  I  ++ KA  +V +I  E T  +V +L   +   A V + +  
Sbjct: 156 AEERIAAIKAKAMSDVGNIAEETTATIVEQLLGLTADKASVSEAVKA 202


>gi|110633055|ref|YP_673263.1| F0F1 ATP synthase subunit B' [Mesorhizobium sp. BNC1]
 gi|123058180|sp|Q11KH7|ATPF1_MESSB RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|110284039|gb|ABG62098.1| H+-transporting two-sector ATPase, B/B' subunit [Chelativorans sp.
           BNC1]
          Length = 193

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/165 (30%), Positives = 82/165 (49%), Gaps = 1/165 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           +       FPPF   T+ SQ  WLAI FG+FY    R +LPR++ I+EVR + I+ D ++
Sbjct: 25  AEGGHEGGFPPFLVETYPSQLLWLAITFGLFYLFLKRVVLPRIAGILEVRSDRIAQDLDQ 84

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
               K + ++ +++YE+ LA AR  A  I  +    A+     +R   E  L  KL  A+
Sbjct: 85  AARMKEDADAAVAAYEQELAEARKKAAAIAQEARDTAKAEAAAERRKVESGLDSKLKEAE 144

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDR 168
             I  ++  A  +V +I  E    +V++L G  V  A +   +  
Sbjct: 145 ARIALIKDTALSDVGTIAEETAAAIVQELVGGKVDKASLSAAVKA 189


>gi|325292102|ref|YP_004277966.1| ATP synthase B' chain [Agrobacterium sp. H13-3]
 gi|325059955|gb|ADY63646.1| ATP synthase B' chain [Agrobacterium sp. H13-3]
          Length = 213

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 59/164 (35%), Positives = 88/164 (53%), Gaps = 1/164 (0%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A  +    S  FPPFD ST+ SQ  WLAI FG+FY +  + I+PR+  I+E R   I+ 
Sbjct: 38  VAHGAEHGASGVFPPFDQSTYASQVLWLAITFGLFYLLMQKVIVPRVGGILENRHGRIAQ 97

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D ++    K E ++ + +YE+ LA ARA A  I      AA+   +  R   E  L  KL
Sbjct: 98  DLDEAARLKSEADAAVETYEKELAAARAKASSIGSAARDAAKAKADADRVAIEAGLAEKL 157

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQ 163
           + A+  I  ++ +A  +V +I  E    +V +L G  V DADV+
Sbjct: 158 AAAEKRIAGIRDQAFADVGAIAEETATAIVDQLVGAKVKDADVK 201


>gi|306842325|ref|ZP_07474984.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
 gi|306845018|ref|ZP_07477599.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306274650|gb|EFM56439.1| F0F1 ATP synthase subunit B' [Brucella sp. BO1]
 gi|306287541|gb|EFM59000.1| F0F1 ATP synthase subunit B' [Brucella sp. BO2]
          Length = 208

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 87/167 (52%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 36  AHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDL 95

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ LA AR+ A  I +      +   + +R   E  L  KL  
Sbjct: 96  EQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKE 155

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           A+  I  ++ KA  +V +I  E T  +V +L       A V + +  
Sbjct: 156 AEERIAAIKAKAMSDVGNIAEETTATIVEQLLGLKADKASVSEAVKA 202


>gi|254718568|ref|ZP_05180379.1| F0F1 ATP synthase subunit B' [Brucella sp. 83/13]
 gi|265983543|ref|ZP_06096278.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306837305|ref|ZP_07470188.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
 gi|264662135|gb|EEZ32396.1| ATP synthase subunit B [Brucella sp. 83/13]
 gi|306407618|gb|EFM63814.1| F0F1 ATP synthase subunit B' [Brucella sp. NF 2653]
          Length = 208

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 87/167 (52%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 36  AHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDL 95

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ LA AR+ A  I +      +   + +R   E  L  KL  
Sbjct: 96  EQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKE 155

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           A+  I  ++ KA  +V +I  E T  +V +L       A V + +  
Sbjct: 156 AEGRIAAIKAKAMSDVGNIAEETTATIVEQLLGLKADKASVSEAVKA 202


>gi|23501288|ref|NP_697415.1| F0F1 ATP synthase subunit B' [Brucella suis 1330]
 gi|62289374|ref|YP_221167.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 1 str. 9-941]
 gi|82699299|ref|YP_413873.1| F0F1 ATP synthase subunit B' [Brucella melitensis biovar Abortus
           2308]
 gi|148559980|ref|YP_001258411.1| F0F1 ATP synthase subunit B' [Brucella ovis ATCC 25840]
 gi|161618360|ref|YP_001592247.1| F0F1 ATP synthase subunit B' [Brucella canis ATCC 23365]
 gi|163842668|ref|YP_001627072.1| F0F1 ATP synthase subunit B' [Brucella suis ATCC 23445]
 gi|189023627|ref|YP_001934395.1| F0F1 ATP synthase subunit B' [Brucella abortus S19]
 gi|225626899|ref|ZP_03784938.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237814861|ref|ZP_04593859.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|254688689|ref|ZP_05151943.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 6 str. 870]
 gi|254693172|ref|ZP_05155000.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 3 str. Tulya]
 gi|254696816|ref|ZP_05158644.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701196|ref|ZP_05163024.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 5 str. 513]
 gi|254703741|ref|ZP_05165569.1| F0F1 ATP synthase subunit B' [Brucella suis bv. 3 str. 686]
 gi|254707879|ref|ZP_05169707.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M163/99/10]
 gi|254709537|ref|ZP_05171348.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis B2/94]
 gi|254729723|ref|ZP_05188301.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 4 str. 292]
 gi|256031031|ref|ZP_05444645.1| F0F1 ATP synthase subunit B' [Brucella pinnipedialis M292/94/1]
 gi|256060523|ref|ZP_05450692.1| F0F1 ATP synthase subunit B' [Brucella neotomae 5K33]
 gi|256159089|ref|ZP_05456915.1| F0F1 ATP synthase subunit B' [Brucella ceti M490/95/1]
 gi|256254434|ref|ZP_05459970.1| F0F1 ATP synthase subunit B' [Brucella ceti B1/94]
 gi|256256936|ref|ZP_05462472.1| F0F1 ATP synthase subunit B' [Brucella abortus bv. 9 str. C68]
 gi|256368840|ref|YP_003106346.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260168163|ref|ZP_05754974.1| F0F1 ATP synthase subunit B' [Brucella sp. F5/99]
 gi|260545873|ref|ZP_05821614.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260567004|ref|ZP_05837474.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260754165|ref|ZP_05866513.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260757385|ref|ZP_05869733.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260761209|ref|ZP_05873552.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883190|ref|ZP_05894804.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|261213412|ref|ZP_05927693.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|261221602|ref|ZP_05935883.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261315370|ref|ZP_05954567.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261317063|ref|ZP_05956260.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261324517|ref|ZP_05963714.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261751733|ref|ZP_05995442.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261754386|ref|ZP_05998095.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|261757621|ref|ZP_06001330.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|265988101|ref|ZP_06100658.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|265997566|ref|ZP_06110123.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|294851767|ref|ZP_06792440.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297247787|ref|ZP_06931505.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
 gi|75505336|sp|Q57EX8|ATPF_BRUAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81753123|sp|Q8G2D9|ATPF1_BRUSU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|123546350|sp|Q2YMC5|ATPF1_BRUA2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694367|sp|B2S9N0|ATPF1_BRUA1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694385|sp|A9M8G0|ATPF1_BRUC2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694387|sp|A5VNW4|ATPF1_BRUO2 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|226694388|sp|B0CK72|ATPF1_BRUSI RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|23347176|gb|AAN29330.1| ATP synthase F0, B subunit, putative [Brucella suis 1330]
 gi|62195506|gb|AAX73806.1| ATP synthase F0, B subunit, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82615400|emb|CAJ10369.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella
           melitensis biovar Abortus 2308]
 gi|148371237|gb|ABQ61216.1| putative ATP synthase F0, B subunit [Brucella ovis ATCC 25840]
 gi|161335171|gb|ABX61476.1| ATP synthase subunit B [Brucella canis ATCC 23365]
 gi|163673391|gb|ABY37502.1| ATP synthase subunit B [Brucella suis ATCC 23445]
 gi|189019199|gb|ACD71921.1| H+-transporting two-sector ATPase, B/B' subunit [Brucella abortus
           S19]
 gi|225618556|gb|EEH15599.1| ATP synthase B' chain [Brucella ceti str. Cudo]
 gi|237789698|gb|EEP63908.1| ATP synthase B' chain [Brucella abortus str. 2308 A]
 gi|255998998|gb|ACU47397.1| ATP synthase subunit B' [Brucella microti CCM 4915]
 gi|260097280|gb|EEW81155.1| H+-transporting two-sector ATPase [Brucella abortus NCTC 8038]
 gi|260156522|gb|EEW91602.1| H+-transporting two-sector ATPase [Brucella suis bv. 4 str. 40]
 gi|260667703|gb|EEX54643.1| ATP synthase subunit B [Brucella abortus bv. 4 str. 292]
 gi|260671641|gb|EEX58462.1| ATP synthase subunit B [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674273|gb|EEX61094.1| ATP synthase subunit B [Brucella abortus bv. 6 str. 870]
 gi|260872718|gb|EEX79787.1| ATP synthase subunit B [Brucella abortus bv. 9 str. C68]
 gi|260915019|gb|EEX81880.1| ATP synthase subunit B [Brucella abortus bv. 3 str. Tulya]
 gi|260920186|gb|EEX86839.1| ATP synthase subunit B [Brucella ceti B1/94]
 gi|261296286|gb|EEX99782.1| ATP synthase subunit B [Brucella pinnipedialis B2/94]
 gi|261300497|gb|EEY03994.1| ATP synthase subunit B [Brucella neotomae 5K33]
 gi|261304396|gb|EEY07893.1| ATP synthase subunit B [Brucella pinnipedialis M163/99/10]
 gi|261737605|gb|EEY25601.1| H+-transporting two-sector ATPase [Brucella sp. F5/99]
 gi|261741486|gb|EEY29412.1| ATP synthase subunit B [Brucella suis bv. 5 str. 513]
 gi|261744139|gb|EEY32065.1| ATP synthase subunit B [Brucella suis bv. 3 str. 686]
 gi|262552034|gb|EEZ08024.1| ATP synthase subunit B [Brucella ceti M490/95/1]
 gi|264660298|gb|EEZ30559.1| ATP synthase subunit B [Brucella pinnipedialis M292/94/1]
 gi|294820356|gb|EFG37355.1| F0F1 ATP synthase subunit B [Brucella sp. NVSL 07-0026]
 gi|297174956|gb|EFH34303.1| F0F1 ATP synthase subunit B [Brucella abortus bv. 5 str. B3196]
          Length = 208

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 53/167 (31%), Positives = 88/167 (52%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 36  AHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDL 95

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ LA AR+ A  I +      +   + +R   E  L  KL  
Sbjct: 96  EQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKE 155

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           A+  I  ++ KA  +V +I  E T  +V +L   +   A V + +  
Sbjct: 156 AEERIAAIKAKAMSDVGNIAEETTATIVEQLLGLTADKASVSEAVKA 202


>gi|254471829|ref|ZP_05085230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062]
 gi|211959031|gb|EEA94230.1| ATP synthase protein, subunit B` [Pseudovibrio sp. JE062]
          Length = 184

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 57/166 (34%), Positives = 89/166 (53%), Gaps = 2/166 (1%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
           +    FPPFD++TF SQ  WL + FG+FYWV  + +LPR+  I+E RR+ I+ D  +   
Sbjct: 19  EDGGSFPPFDSTTFPSQLLWLVLSFGVFYWVMSKVVLPRIGGILEDRRDRIAGDMAEASR 78

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K+E +  I+SYE +LA AR  A  +     +  +   E  R   E+ L  KLS ++  I
Sbjct: 79  LKQETDEAIASYESALADARKKATTMAHDARSKVKAETEGARAAAEEQLAAKLSESEQSI 138

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKL--GFSVSDADVQKILDRKRD 171
             ++ ++   V  I  E T +LV+ L  G + + A+V K +D    
Sbjct: 139 SKIKAESLSHVGEIAAETTGELVKALIGGRAPAKAEVAKAVDAALK 184


>gi|159184432|ref|NP_353741.2| F0F1 ATP synthase subunit B' [Agrobacterium tumefaciens str. C58]
 gi|226698387|sp|Q7D0U9|ATPX_AGRT5 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|159139745|gb|AAK86526.2| ATP synthase B' chain [Agrobacterium tumefaciens str. C58]
          Length = 213

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 86/164 (52%), Gaps = 1/164 (0%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A  +    S  FPPFD ST+ SQ  WLAI FG+FY +  + I+PR+  I+E R   I+ 
Sbjct: 38  VAHGAEHGASGVFPPFDQSTYASQVLWLAITFGLFYLLMQKVIVPRVGGILENRHGRIAQ 97

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D ++    K E ++ + +YE+ LA ARA A  I      AA+   +  R   E  L  KL
Sbjct: 98  DLDEAARLKAEADTAVETYEKELAAARAKASSIGASARDAAKAKADADRAAIEAGLAEKL 157

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQ 163
           + A+  I  ++  A  +V +I  E    +V +L G  V D DV+
Sbjct: 158 AAAEKRIAGIRDHAFADVGAIAEETATAIVDQLVGAKVKDTDVK 201


>gi|227821028|ref|YP_002824998.1| F0F1 ATP synthase subunit B' [Sinorhizobium fredii NGR234]
 gi|227340027|gb|ACP24245.1| FoF1 ATP synthase subunit B [Sinorhizobium fredii NGR234]
          Length = 203

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 90/168 (53%), Gaps = 1/168 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD+S F SQ  WLAI FG+FY +  + I+PR+  I+E R + I+ D 
Sbjct: 33  AHEAEHGSGVFPPFDSSHFASQLLWLAITFGLFYLLMSKVIIPRIGGILEKRHDRIAQDL 92

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           ++    K E ++ I+SYE+ LA ARA    I D     A+      R   E +L  K++ 
Sbjct: 93  DEASRLKGEADAAIASYEQELANARAKGHSIADTAREEAKSKATADRAAVEAELTKKITA 152

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           A+  I D++ KA  +V +I  E    +V++ +G +V+  ++   +   
Sbjct: 153 AETRIADIKSKALADVGAIAEETATAVVKQLIGGNVTKTEIAAAVKAS 200


>gi|262276822|ref|ZP_06054615.1| H+-transporting two-sector ATPase [alpha proteobacterium HIMB114]
 gi|262223925|gb|EEY74384.1| H+-transporting two-sector ATPase [alpha proteobacterium HIMB114]
          Length = 190

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/167 (23%), Positives = 84/167 (50%), Gaps = 2/167 (1%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            S   P  D ++++ Q FWL I FG  Y V  + + PRLS  +E R + +S   ++  + 
Sbjct: 19  ESGGMPQLDPNSWVPQIFWLIITFGGLYIVISKIVFPRLSESIEQRNDYVSDLVDEAKTL 78

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
             + E + + Y+E ++ ++  A+E I           + ++   +K++      A+ EI 
Sbjct: 79  AEKTEKLNNEYKELISNSKKEAQETITNGRKKLNAEFDKKKNELDKNISELTEKAEKEIQ 138

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA 175
             +  + ++V +I  +V+ +L+++L  S++D   Q I+ +K + I  
Sbjct: 139 SFKSNSIKDVQTIASQVSGELLKEL--SLNDEIDQNIIIKKIEDISK 183


>gi|254500907|ref|ZP_05113058.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
 gi|222436978|gb|EEE43657.1| ATP synthase B/B' CF(0) superfamily [Labrenzia alexandrii DFL-11]
          Length = 181

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 91/168 (54%), Gaps = 1/168 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
            + +  + FPPFD +T+ SQ  WLAI FG FYW+     +PR++ I+E R++ I+ D  +
Sbjct: 14  PAEEHGAGFPPFDATTYSSQLLWLAITFGFFYWIMKNVAVPRIAGILEDRKDRIAGDLGE 73

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            +  K E ++ I++YE++LA AR  A  I     A  + + E +RE  E D+  KL  A+
Sbjct: 74  ANRLKDETDAAIAAYEQALAEARNKAHGIASDTRAKLKADQEARREKAEADIAEKLKAAE 133

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV-SDADVQKILDRKRD 171
             I  ++ +A  ++  I G+ T  LV +L     +  D+ K L    +
Sbjct: 134 AHIAGIKTEALSQIGDIAGDTTSALVEQLMGKAPTKTDLTKALKSAMN 181


>gi|225851924|ref|YP_002732157.1| F0F1 ATP synthase subunit B' [Brucella melitensis ATCC 23457]
 gi|256044106|ref|ZP_05447017.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112904|ref|ZP_05453820.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 3 str. Ether]
 gi|256264564|ref|ZP_05467096.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|260563465|ref|ZP_05833951.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|265990518|ref|ZP_06103075.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994346|ref|ZP_06106903.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|226741364|sp|Q8YFH7|ATPF_BRUME RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|2984782|gb|AAC08030.1| ATP synthase subunit B' [Brucella melitensis]
 gi|225640289|gb|ACO00203.1| ATP synthase B' chain [Brucella melitensis ATCC 23457]
 gi|260153481|gb|EEW88573.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. 16M]
 gi|262765459|gb|EEZ11248.1| ATP synthase subunit B [Brucella melitensis bv. 3 str. Ether]
 gi|263001302|gb|EEZ13877.1| ATP synthase subunit B [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094929|gb|EEZ18637.1| ATP synthase subunit B [Brucella melitensis bv. 2 str. 63/9]
 gi|326408423|gb|ADZ65488.1| F0F1 ATP synthase subunit B' [Brucella melitensis M28]
 gi|326538137|gb|ADZ86352.1| ATP synthase B' chain [Brucella melitensis M5-90]
          Length = 208

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 36  AHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDL 95

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ LA AR+ A  I +      +   + +R   E  L  KL  
Sbjct: 96  EQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKE 155

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           A+  I  ++ KA  +V +I  E    +V +L   +   A V + +  
Sbjct: 156 AEERIAAIKAKAMSDVGNIAEETMATIVEQLLGLTADKASVSEAVKA 202


>gi|302039013|ref|YP_003799335.1| ATP synthase F0 subunit B [Candidatus Nitrospira defluvii]
 gi|300607077|emb|CBK43410.1| ATP synthase F0, subunit B [Candidatus Nitrospira defluvii]
          Length = 170

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/164 (22%), Positives = 79/164 (48%), Gaps = 1/164 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P F++  F S  FW  + FGI +++ +++  P L  ++E R   I    ++ +  + E 
Sbjct: 1   MPQFESHFFSSLIFWEVLSFGILFFLLYKYAFPGLLGMLEEREKKIKDSLDQAERHRSEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E  +  YE  LA A   A+ ++ +    A++ +E   +    D      +A  EI+  ++
Sbjct: 61  ERRLKEYEAKLATAAKDAEALLAQAKERAQRLMEENEQRMTADAERIKGDATREIETERR 120

Query: 133 KASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           KA Q++ S   ++   +  K +G ++++ D +++ D   D +  
Sbjct: 121 KAIQDIRSQTTDLAMMVAEKVVGRALTEGDHRRLADEALDALAK 164


>gi|330813670|ref|YP_004357909.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486765|gb|AEA81170.1| H+-transporting two-sector ATPase (subunit b') [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 190

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/171 (25%), Positives = 85/171 (49%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           S++ +      P  D +T+  Q FWL I FG  Y +  + + PRLS  +E R + +S + 
Sbjct: 14  SAAQAAEKVGMPQLDPTTWFPQVFWLLITFGFLYLIVEKIVFPRLSDSIEQRNDHVSDNI 73

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           ++ +S K + E     Y   ++ ++  A+ +I+      + N E +++  +K L  K+  
Sbjct: 74  DEANSIKDQAEKKYQEYLSLISNSKREAQNLINVNKQNLQNNFENKKKEIDKKLEEKMKQ 133

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKRDG 172
              EI+D +K A+ ++ SI  E+ K+LV+ +     ++A    I++     
Sbjct: 134 VSKEIEDFKKSAASKMGSISTEIAKELVKTVSKIDTNNASASSIVEEVSKK 184


>gi|328544976|ref|YP_004305085.1| F0F1 ATP synthase subunit B' [polymorphum gilvum SL003B-26A1]
 gi|326414718|gb|ADZ71781.1| F0F1 ATP synthase subunit B' [Polymorphum gilvum SL003B-26A1]
          Length = 169

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 58/168 (34%), Positives = 91/168 (54%), Gaps = 1/168 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
             ++    FPPFD STF SQ  WLAI FG+FYW+     LPR++ I+E RR+ I+ D  +
Sbjct: 2   PQAEHGVGFPPFDASTFASQLLWLAITFGLFYWIMKNVALPRIAGILEDRRDRIAGDLAE 61

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            D  KR+ +  I++YE++LA ARA A+ I        +   + +RE  E  +  KLS A+
Sbjct: 62  ADRLKRDTDEAIAAYEQALAEARAKARGIAHDTREKLKAENDARREKAEAGIATKLSEAE 121

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRD 171
             I  ++ +A  +V  I  E +  LV   +G + +  D+ K +    +
Sbjct: 122 ARIASIKTEALAQVGEIATETSSALVEALIGKTPTKTDLNKAVKAAME 169


>gi|90420160|ref|ZP_01228068.1| putative ATP synthase F0, subunit B [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335494|gb|EAS49244.1| putative ATP synthase F0, subunit B [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 200

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 82/160 (51%), Gaps = 1/160 (0%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
                FPPF+   F SQ  WLAI FGIFY V  + ILPR++  +E RR+ I+ D E  + 
Sbjct: 36  GEHGGFPPFNAEYFPSQILWLAITFGIFYLVLKKVILPRIAGTLENRRDRIALDLEAAER 95

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K + +   ++YE+ LA AR  A +I      AA  + E +R+  + +L  KL  AQ  I
Sbjct: 96  MKSDSDEAKAAYEQELAEARDRAHKIGHDAREAARSDAEAERQRLDAELDEKLEAAQLRI 155

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKIL 166
             ++ +A ++V  I       ++R +    VS  +V   +
Sbjct: 156 AAVRDEAMKDVGQIAETTADAILRDVIRLEVSREEVASAV 195


>gi|150395674|ref|YP_001326141.1| F0F1 ATP synthase subunit B' [Sinorhizobium medicae WSM419]
 gi|226698822|sp|A6U6M6|ATPX_SINMW RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|150027189|gb|ABR59306.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           medicae WSM419]
          Length = 204

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 56/168 (33%), Positives = 93/168 (55%), Gaps = 1/168 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +      S  FPPFD++ F SQ  WLAI FG+FY +  + I+PR+ SI+E R + I+ D 
Sbjct: 34  AHEGEHGSGVFPPFDSTHFASQLLWLAITFGLFYLLMSKVIIPRIGSILETRHDRIAQDL 93

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           ++    K E ++ I++YE+ LA ARA    I D    AA+   +  R+  E DL  K++ 
Sbjct: 94  DEASRLKGEADAAIAAYEQELAGARAKGHSIADTAREAAKSKAKADRDGVEADLAKKIAA 153

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           A+  I D++ KA  +V +I  E    +V++ +G +V+ +++       
Sbjct: 154 AEARIGDIKSKALADVGAIAEETATAIVKQLIGGTVTKSEIAAAFKAS 201


>gi|89069739|ref|ZP_01157075.1| FoF1 ATP synthase, subunit B [Oceanicola granulosus HTCC2516]
 gi|89044685|gb|EAR50796.1| FoF1 ATP synthase, subunit B [Oceanicola granulosus HTCC2516]
          Length = 231

 Score =  106 bits (265), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/148 (23%), Positives = 74/148 (50%)

Query: 7   SDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMD 66
              ++  P  D STF +Q FWL +     Y+V  R  +PR+ +++  R+  +++D    +
Sbjct: 66  GAEAAGMPQLDFSTFPNQIFWLLVTLFAIYFVVSRIAMPRIGAVLAERQGTVTNDLASAE 125

Query: 67  SAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNE 126
             K   +   ++Y+++LA ARA A  I D+  A+ + +L+ +    ++ +  K + ++  
Sbjct: 126 ELKLRAQEAEAAYDKALADARAEANRIADETRASIQADLDAELARADEQIGAKTAESEAA 185

Query: 127 IDDMQKKASQEVYSIVGEVTKDLVRKLG 154
           I +++  A   V  +  +  K +V   G
Sbjct: 186 IAEIRAGAMDSVRDVATDTAKAIVAAFG 213


>gi|220927390|ref|YP_002502692.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
 gi|219951997|gb|ACL62389.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           nodulans ORS 2060]
          Length = 187

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 45/169 (26%), Positives = 82/169 (48%), Gaps = 1/169 (0%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +    +S+    FPPF +STF +Q  W+AI FG+ Y++  R  +PR++ ++  R+  ++ 
Sbjct: 14  LIHEPASEHGGGFPPFQSSTFAAQILWVAITFGLLYYLMSRVAIPRITGLLHERQMRLAG 73

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D ++    K + ++   SY  SL  A+  AK I      +     E +R+  E DL  KL
Sbjct: 74  DLDEAARMKTDADAARESYARSLKEAQDKAKGIAQATRDSLAAEAETRRKSLEADLAAKL 133

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDR 168
           + ++ +I      A   V  +  +    +V + +G +   A V+   DR
Sbjct: 134 AESEAQIRSRTVSAMSNVREVAADAATAIVERLIGQTPDRAAVEAAYDR 182


>gi|15964590|ref|NP_384943.1| F0F1 ATP synthase subunit B' [Sinorhizobium meliloti 1021]
 gi|307309336|ref|ZP_07588999.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti BL225C]
 gi|307320072|ref|ZP_07599493.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti AK83]
 gi|81635006|sp|Q92RM6|ATPX_RHIME RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|15073768|emb|CAC45409.1| Probable ATP synthase subunit B' transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306894287|gb|EFN25052.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti AK83]
 gi|306900205|gb|EFN30823.1| H+transporting two-sector ATPase B/B' subunit [Sinorhizobium
           meliloti BL225C]
          Length = 204

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   +  FPPFDT+ F SQ  WLAI FG+FY +  + I+PR+  I+E R + I+ D 
Sbjct: 34  AHEADHGAGVFPPFDTTHFASQLLWLAITFGLFYLLMSKVIIPRIGGILETRHDRIAQDL 93

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           ++    K E ++ I++YE+ LA ARA    I D    AA+   +  R+  E  L  K++ 
Sbjct: 94  DEASRLKGEADAAIAAYEQELAGARAKGHSIADTAREAAKAKAKADRDGVEAGLAKKIAA 153

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           A+  I D++ KA  +V +I  E    +V++ +G +V+ A++       
Sbjct: 154 AEARIADIKSKALADVGAIAEETATAVVKQLIGGTVTKAEIAAAFKAS 201


>gi|163744748|ref|ZP_02152108.1| ATP synthase F0, B' subunit [Oceanibulbus indolifex HEL-45]
 gi|161381566|gb|EDQ05975.1| ATP synthase F0, B' subunit [Oceanibulbus indolifex HEL-45]
          Length = 185

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/168 (19%), Positives = 83/168 (49%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           + +  +   P  +   + +Q FWL +     Y++  R  LPR+ +++  R+  I++D   
Sbjct: 18  THAAETPGMPQLNFDHWGNQIFWLILALIATYFILSRVALPRIGAVLAERQGTITNDIAA 77

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            +  K + +   ++Y+++L  ARA A++I+ +  A  + +L+ +    + ++  +++ ++
Sbjct: 78  AEDLKVKAQEAEAAYDQALIDARAEAQQIVAQAKADMQADLDIEMAKADAEIAAQVAESE 137

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
             I +++  A   V ++  +  + LV  LG +     V   +D +  G
Sbjct: 138 KAIAEIRASAMVNVQAVAKDTAEALVAALGGTADATTVDAAVDARMKG 185


>gi|170744959|ref|YP_001773614.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium sp.
           4-46]
 gi|226698381|sp|B0ULY3|ATPX_METS4 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|168199233|gb|ACA21180.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium sp.
           4-46]
          Length = 187

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/169 (27%), Positives = 83/169 (49%), Gaps = 1/169 (0%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +    +S+    FPPF ++TF +Q  WLAI FG+ Y++  R  +PR++ ++  R+  +++
Sbjct: 14  LIHEPASEHGGGFPPFQSTTFAAQILWLAIAFGLLYYLMSRVAVPRIAGLLHDRQARLAA 73

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D ++    K   +S   +YE SL  A+  AK I      +     E +R+  E DL  KL
Sbjct: 74  DLDEASRMKTGADSARGAYERSLKEAQDKAKGIAQATRDSLAAEAETRRKALEADLAAKL 133

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDR 168
           + ++ +I      A   V  +  +    +V + +G S   A V+   DR
Sbjct: 134 AESEAQIRARTATAMGSVREVAADAATAIVERLIGQSPDRAAVEAAYDR 182


>gi|17987827|ref|NP_540461.1| F0F1 ATP synthase subunit B' [Brucella melitensis bv. 1 str. 16M]
 gi|17983555|gb|AAL52725.1| ATP synthase b' chain [Brucella melitensis bv. 1 str. 16M]
          Length = 180

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 87/167 (52%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +  +   S  FPPFD++ + SQ  WLAI FG+FY    R +LPR+  ++E RR+ I+ D 
Sbjct: 8   AHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDL 67

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    K++ ++ I++YE+ LA AR+ A  I +      +   + +R   E  L  KL  
Sbjct: 68  EQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKE 127

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           A+  I  ++ KA  +V +I  E    +V +L   +   A V + +  
Sbjct: 128 AEERIAAIKAKAMSDVGNIAEETMATIVEQLLGLTADKASVSEAVKA 174


>gi|307941610|ref|ZP_07656965.1| ATP synthase B' chain [Roseibium sp. TrichSKD4]
 gi|307775218|gb|EFO34424.1| ATP synthase B' chain [Roseibium sp. TrichSKD4]
          Length = 185

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/168 (32%), Positives = 93/168 (55%), Gaps = 1/168 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
            + +  + FPPFD+ST+ SQ  WLA+ FG+FYW+     +PR++ I+E R++ I+ D  +
Sbjct: 18  PAEEHGAGFPPFDSSTYASQILWLALTFGVFYWIMKNVAVPRIAGILEDRKDRIAGDLAE 77

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            +  K+E +  I++YE++LA ARA A  I  +     +   + +RE  E +L  KL+ A+
Sbjct: 78  ANRLKQETDEAIAAYEQALAEARAKAHGIASETREKLKAEQDARREKAEAELSEKLAQAE 137

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV-SDADVQKILDRKRD 171
             I  ++ +A  ++  I G+ T  LV  L     +  D+ K L    +
Sbjct: 138 KHIAGVKSEALGQIEEIAGDTTSALVEALMGKAPTKTDLTKALKSAMN 185


>gi|222085044|ref|YP_002543573.1| ATP synthase protein [Agrobacterium radiobacter K84]
 gi|221722492|gb|ACM25648.1| ATP synthase protein [Agrobacterium radiobacter K84]
          Length = 197

 Score =  106 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 53/160 (33%), Positives = 82/160 (51%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
            +      +  FPPFD +T+ SQ  WL I F IFY    + ++PR+ SI+E R + I+ D
Sbjct: 23  GAPEQGHHAGVFPPFDHTTYPSQLLWLVITFVIFYLAMQKIVIPRVGSILESRHDRIAQD 82

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            E+    K E ++ +++YE  LA ARA A  I      AA+   E  R+  E  L  KL 
Sbjct: 83  IEEASRLKSEADAAVATYESELAAARAKANTIGATARDAAKAKAEEDRKAIEASLSQKLK 142

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDAD 161
            A+  I +++ KA  +V +I  E    +V +L  +V+   
Sbjct: 143 TAEARIGEIKTKAFADVGAIAEETASAVVEQLVGNVAGKA 182


>gi|119385602|ref|YP_916657.1| F0F1 ATP synthase subunit B' [Paracoccus denitrificans PD1222]
 gi|119376197|gb|ABL70961.1| H+-transporting two-sector ATPase, B/B' subunit [Paracoccus
           denitrificans PD1222]
          Length = 215

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/161 (25%), Positives = 83/161 (51%)

Query: 12  RFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKRE 71
             P  D +TF +Q FWL +I  + YWV  R  LPR+  ++  R+  I+ D    +  K++
Sbjct: 52  GMPQLDFTTFGNQIFWLLVILAVIYWVLSRIALPRIGGVISDRQGAITGDLMAAEEFKQK 111

Query: 72  VESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQ 131
            +   ++Y+++LA ARA A +I+    A  ++ L+      + ++  + + ++  I +++
Sbjct: 112 AKEAEAAYDKALADARAEAGKIVAANKAEIQKELDAAIAHADAEIAARAAESETRIGEIR 171

Query: 132 KKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
             A ++  S+  +VT  LV   G  +  + V   +D++  G
Sbjct: 172 ASAVEDARSVARDVTAALVENFGGKLDQSLVDAAVDQRLKG 212


>gi|288957579|ref|YP_003447920.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
 gi|288909887|dbj|BAI71376.1| F-type H+-transporting ATPase b chain [Azospirillum sp. B510]
          Length = 216

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/147 (29%), Positives = 78/147 (53%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            S   P  + + F +Q FWLA+ FG+ Y +  +  LPR++ ++E R+  IS D  K    
Sbjct: 49  ASGGLPQLNPANFPTQIFWLALTFGVLYHLMSKKALPRVAEVLEARQERISRDLAKAAQL 108

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K E E++++  E+SLA ARA A+ +I +V A  E N + ++     D+  +L +A+  I 
Sbjct: 109 KEEAEAILAQVEKSLAGARAEAQGVIAQVSAEIEANNQARQGQLNADIAERLRSAEASIA 168

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGF 155
             + +A   + +    + +D+  +L  
Sbjct: 169 TAKDQALANIRAESTGIVRDIAGRLAG 195


>gi|39933921|ref|NP_946197.1| H+-transporting two-sector ATPase subunit B/B' [Rhodopseudomonas
           palustris CGA009]
 gi|192289340|ref|YP_001989945.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris TIE-1]
 gi|81698370|sp|Q6NBI4|ATPX_RHOPA RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|226698819|sp|B3QF35|ATPX_RHOPT RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|39647768|emb|CAE26288.1| putative FoF1 ATP synthase, subunit B' [Rhodopseudomonas palustris
           CGA009]
 gi|192283089|gb|ACE99469.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris TIE-1]
          Length = 185

 Score =  104 bits (260), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + +     + FPPF   TF SQ   LAI F   Y +  +  LPR+  ++E R+  I  D 
Sbjct: 15  TEAGGGHKAPFPPFQQETFASQLVSLAIAFVALYLIVSKIALPRVGGVIEERQKTIDGDL 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E +  + +YE  LA ARA A+ I  +         E +R+  E+ L  KL++
Sbjct: 75  AAAQKLKGEADDALKAYEAELADARARAQAIGAETREKLNAQAEAERKTLEQRLAAKLAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
           A+  I   +  A   V +I  +    +V++L G +     V   +D    G
Sbjct: 135 AEKTIATTRTAAMGNVRNIASDAASAIVQQLAGVTPDSKAVDSAVDASLKG 185


>gi|163761009|ref|ZP_02168087.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
 gi|162281790|gb|EDQ32083.1| F0F1 ATP synthase subunit B' [Hoeflea phototrophica DFL-43]
          Length = 203

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 84/143 (58%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD STF SQ  WLAI FG+FY +  R ++PR+  I+E RR+ I+ D ++ +  K E 
Sbjct: 43  FPPFDQSTFASQLLWLAITFGLFYLLMSRVVVPRIGGILEHRRDRIAQDLDEANRLKEEA 102

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ++ I++YE+ LA AR  +  I +     A+   + +R   E +L  K+++A+  I  ++ 
Sbjct: 103 DAAIAAYEQELAEARKKSSAIAEAAREKAKSAADAERAATEAELSAKMADAEKSIAAIKA 162

Query: 133 KASQEVYSIVGEVTKDLVRKLGF 155
           KA  +V +I  +   DLV+ L  
Sbjct: 163 KALGDVDTIAQDTATDLVKHLLG 185


>gi|163852588|ref|YP_001640631.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           extorquens PA1]
 gi|218531429|ref|YP_002422245.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254562347|ref|YP_003069442.1| F0F1 ATP synthase subunit b [Methylobacterium extorquens DM4]
 gi|226698378|sp|A9VYW8|ATPX_METEP RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|163664193|gb|ABY31560.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           extorquens PA1]
 gi|218523732|gb|ACK84317.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           chloromethanicum CM4]
 gi|254269625|emb|CAX25596.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens DM4]
          Length = 201

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 3/171 (1%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
            S      FPPF++ TFLSQ  WLA+ FG+ Y++  +  LPR+ +I+  R   +SSD  +
Sbjct: 32  PSGGHGGAFPPFESHTFLSQLIWLALAFGLLYYLMSKVALPRIEAILGNRAGRLSSDLTE 91

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
               K E ++  ++YE+SL  A+A A+ I  +   +     + +R+  E +L  +L+ ++
Sbjct: 92  AQRMKTEADAAGAAYEKSLREAQAKAQAIAQETRNSLSAEADAKRKTLEAELNQRLAASE 151

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA 175
             I     +A   V +I GE    +V +L     D   Q  L+R  D   A
Sbjct: 152 ATIRTRTTEAMGNVRAIAGETASAIVERLTGQAPD---QASLNRALDATPA 199


>gi|240139923|ref|YP_002964400.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens AM1]
 gi|240009897|gb|ACS41123.1| putative F0F1 ATP synthase, subunit b (atpF) [Methylobacterium
           extorquens AM1]
          Length = 201

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 3/171 (1%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
            S      FPPF++ TFLSQ  WLA+ FG+ Y++  +  LPR+ +I+  R   +SSD  +
Sbjct: 32  PSGGHGGAFPPFESHTFLSQLIWLALAFGLLYYLMSKVALPRIEAILGNRAGRLSSDLTE 91

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
               K E ++  ++YE+SL  A+A A+ I  +   +     + +R+  E +L  +L+ ++
Sbjct: 92  AQRMKTEADAAGAAYEKSLREAQAKAQAIAQETRNSLSAEADAKRKTLEAELNQRLAVSE 151

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA 175
             I     +A   V +I GE    +V +L     D   Q  L+R  D   A
Sbjct: 152 ATIRTRTTEAMGNVRAIAGETASAIVERLTGQAPD---QASLNRALDATPA 199


>gi|154251151|ref|YP_001411975.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
 gi|226694418|sp|A7HQY5|ATPF2_PARL1 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|154155101|gb|ABS62318.1| H+transporting two-sector ATPase B/B' subunit [Parvibaculum
           lavamentivorans DS-1]
          Length = 187

 Score =  104 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 87/165 (52%)

Query: 7   SDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMD 66
           ++ +  FPPFD ++F SQ  WL + F   Y +  R  LPR+++++E RR+ I+ D ++  
Sbjct: 23  AEHAGGFPPFDAASFESQLVWLVLSFAALYLLMSRVALPRIANVLEERRDRIADDLDQAA 82

Query: 67  SAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNE 126
             + + E  I +YE++LA ARA A+ I  +     ++  E QR   E  L  K+S A+ +
Sbjct: 83  QFQLQTEEAIGAYEKALAEARAKAQGIAQETRDRLQEETERQRLAIEARLAEKISEAEKQ 142

Query: 127 IDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRD 171
           I   +  A Q V ++  +V   +V +L      +  ++ +D +  
Sbjct: 143 IAATKDAALQNVRAVAVDVADTIVAQLLGDSDRSATERAVDTELS 187


>gi|255262186|ref|ZP_05341528.1| ATP synthase B' chain (Subunit II) [Thalassiobium sp. R2A62]
 gi|255104521|gb|EET47195.1| ATP synthase B' chain (Subunit II) [Thalassiobium sp. R2A62]
          Length = 174

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 85/170 (50%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +   ++ +   P  D +TF +Q FWL +   + Y+V  R  LPR+ +++  R+  I++D 
Sbjct: 5   AKDVAESAPGMPQLDFATFPNQIFWLLVTLVVIYFVLSRIALPRIGAVLAERQGTITNDV 64

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
              +  K++     ++YE++LA ARA A  I+    A  + +L+ +    +  +  K + 
Sbjct: 65  AAAEELKQKAVGAEAAYEKALADARAEAGRIVADAKADIQADLDKELAKADTKIAAKAAE 124

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           ++  I +++  +++ V ++  +  K+LV  LG       +   ++ +  G
Sbjct: 125 SEKAIAEIRATSAESVKAVAKDTAKELVAALGGKADAKTITAAINARMKG 174


>gi|254440441|ref|ZP_05053935.1| ATP synthase B/B' CF(0) superfamily [Octadecabacter antarcticus
           307]
 gi|198255887|gb|EDY80201.1| ATP synthase B/B' CF(0) superfamily [Octadecabacter antarcticus
           307]
          Length = 178

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 79/169 (46%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           + +    +  P  D STF +Q FWL +   + Y +  R  LPR+ +++  R   I++D  
Sbjct: 10  TGAEAGGAGMPQLDFSTFPNQIFWLLVTLIVIYLILSRVALPRIGAVLAERSGTITNDIG 69

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
             +  K       ++Y+++LA AR+ A +I+ +  +  +  L+ Q +  + ++  + + +
Sbjct: 70  AAEELKMRAIRAEAAYDKALADARSEAGKIVAQAKSDIQAELDVQIQKADAEIAAQTAES 129

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
              I D+Q  A+  +  +  +  K+++   G  V    V   +  +  G
Sbjct: 130 AKAIADIQAGATDAIKVVAKDTAKEIIAAFGGKVDAKTVTAAVTARMKG 178


>gi|254485575|ref|ZP_05098780.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
 gi|214042444|gb|EEB83082.1| ATP synthase F0, B subunit [Roseobacter sp. GAI101]
          Length = 183

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 76/168 (45%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           S    +   P      F +Q FWL +     Y++  R  LPR+ S++  R+  I++D   
Sbjct: 16  SEFGSAIGMPQLCGEWFGNQIFWLVVALVAIYFILSRVALPRIGSVLAERQGTITNDIAA 75

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            +  K +     + Y+++L  ARA A  II    A  + +L+    V + D+  K + ++
Sbjct: 76  AEDLKVKATEAEAQYDKALIDARAEAHRIITDAKADIQADLDQAIAVADADIAAKAAESE 135

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
             I ++++ A + V  +  +  + ++  LG S     V   +D +  G
Sbjct: 136 KAIAEIREGAKKNVEEVAKDTAQAIIAALGGSADATTVSAAVDARMKG 183


>gi|316932388|ref|YP_004107370.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris DX-1]
 gi|315600102|gb|ADU42637.1| H+transporting two-sector ATPase B/B' subunit [Rhodopseudomonas
           palustris DX-1]
          Length = 185

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/171 (28%), Positives = 76/171 (44%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + +     + FPPF   TF SQ   LAI F   Y +  +  LPR+  ++E R+  I  D 
Sbjct: 15  TEADGGHKAPFPPFQQETFASQLVSLAIAFVALYLIVSKIALPRVGGVIEERQKTIDGDL 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E +  + +YE  LA ARA A+ I  +         E +R+  E+ L  KL++
Sbjct: 75  AAAQKLKGEADDALKAYEAELADARARAQAIGAETREKLNAQAEAERKTLEQRLAAKLAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
           A+  I   +  A   V +I  +    +V++L G +     V   +D    G
Sbjct: 135 AEKTIAATRAAAMGNVRNIASDAASAIVQQLAGVTPDGKAVDGAVDASLKG 185


>gi|159045568|ref|YP_001534362.1| F0F1 ATP synthase subunit B' [Dinoroseobacter shibae DFL 12]
 gi|226698377|sp|A8LKH8|ATPX_DINSH RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|157913328|gb|ABV94761.1| ATP synthase F0 [Dinoroseobacter shibae DFL 12]
          Length = 174

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/170 (25%), Positives = 81/170 (47%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++ + + +   P  D STF +Q FWL I     Y +  +  LPR+ S++  R   I++D 
Sbjct: 5   ATGAVEAAPGMPQLDFSTFPNQIFWLIITLVAIYLILTKVALPRIGSVLAERSGTITNDL 64

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
              +  K        +Y ++LA ARA A++I+ +  A  + +L+      + ++  K + 
Sbjct: 65  AAAEELKLAAVEAEKAYNQALADARAEAQKIVAEARAEIQADLDVATAKADAEIAAKSAE 124

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           A+  I ++++ A   V  +  +  + LV  L  S  DADV   +  +  G
Sbjct: 125 AEKAIAEIREGAMASVTEVATDTAQALVAALLPSAKDADVSAAVAERVKG 174


>gi|163733902|ref|ZP_02141344.1| ATP synthase F0, B' subunit [Roseobacter litoralis Och 149]
 gi|161393013|gb|EDQ17340.1| ATP synthase F0, B' subunit [Roseobacter litoralis Och 149]
          Length = 176

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/169 (23%), Positives = 83/169 (49%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  +  S   P  D ST+ +Q FWL I   + Y V  +  LPR+++I+  R+  I++D  
Sbjct: 8   ADVAASSPGMPQLDFSTWGNQIFWLVITLVVIYMVLSKVALPRIAAILSERQGTITNDIA 67

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
             +  K + +   ++YE++LA ARA A  I+ +  A  + +L+      + ++  K + +
Sbjct: 68  TAEDFKAKAKEAEAAYEKALADARAEAHRIVAEAKADIQSDLDVAISKADAEISAKAAES 127

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           +  I +++  A++ +  +  +  +++V   G       V   +D +  G
Sbjct: 128 EKAISEIRAGAAEAIQQVAKDTAQEIVATFGGKADAKAVNAAVDGQLKG 176


>gi|254511769|ref|ZP_05123836.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
 gi|221535480|gb|EEE38468.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium KLH11]
          Length = 183

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 73/165 (44%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +   P      F +Q FWL I   + + V  R  LPR+++I+  R+  I++D    + 
Sbjct: 19  GSAIGMPQLCFDWFPNQIFWLVITLVVIFLVLSRVALPRIAAILAERQGTITNDLAAAED 78

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K +      +Y ++LA AR+ A+ I  +  A  +  L+      + ++  K + ++  I
Sbjct: 79  LKAKAVEAEEAYNKALADARSEAQRIAAEARAEIQSGLDDAIAKADAEIAAKAAESEKAI 138

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            D++  A + +  +  +   +LV  LG       +   +D +  G
Sbjct: 139 ADIRAGALESIQVVAKDTAAELVTALGGEADAKAIDSAIDAQMKG 183


>gi|319899220|ref|YP_004159313.1| ATP synthase B chain (modular protein) [Bartonella clarridgeiae 73]
 gi|319403184|emb|CBI76743.1| ATP synthase B chain (modular protein) [Bartonella clarridgeiae 73]
          Length = 210

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 61/166 (36%), Positives = 93/166 (56%), Gaps = 1/166 (0%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           SS    +  FPPFD   F S F WLAI FG+FY    R I+PR+  ++E RR+ I SD +
Sbjct: 42  SSVEHANRVFPPFDFMYFGSHFLWLAISFGLFYLFISRVIVPRIGGVIETRRDRIVSDLD 101

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K+E ++++  Y++ LA AR  AK II       +   + QR+  E+DL  KL  +
Sbjct: 102 QAMRLKQEADNVVEVYKQKLAKARLEAKTIIQTESNEIKIRADLQRKKIEEDLEKKLKKS 161

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           +++I ++Q KA Q V  I  E+T ++V+KL   +VS   V   +  
Sbjct: 162 EDKIKEIQNKAMQNVGLIAEEITFEIVKKLIDINVSRKSVSSAVKA 207


>gi|254453468|ref|ZP_05066905.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
 gi|198267874|gb|EDY92144.1| ATP synthase F0, B subunit [Octadecabacter antarcticus 238]
          Length = 176

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/167 (20%), Positives = 79/167 (47%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
           +    +  P  D STF +Q FWL +   + Y +  R  LPR+ +++  R+  I++D    
Sbjct: 10  ADAGGAGMPQLDFSTFPNQIFWLLVTLVVIYMILSRVALPRIGAVLAERQGTITNDIAAA 69

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
           +  K+      ++Y+++LA AR+ A +I+ +  A  +  L+ Q    + ++  + + ++ 
Sbjct: 70  EELKQRAIEAEAAYDKALADARSEAGKIVAQAKADIQGELDVQMAKADAEIAAQTAESEK 129

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            I D+   A+  V ++  +   +++   G       V + +  +  G
Sbjct: 130 AIADIHAGATDAVKAVAKDTANEIIAAFGGKADAKAVTEAVTARMKG 176


>gi|49475211|ref|YP_033252.1| F0F1 ATP synthase subunit B' [Bartonella henselae str. Houston-1]
 gi|81696227|sp|Q6G5L0|ATPF1_BARHE RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|49238016|emb|CAF27222.1| ATP synthase B chain [Bartonella henselae str. Houston-1]
          Length = 188

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 58/157 (36%), Positives = 90/157 (57%), Gaps = 1/157 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD   F S  FWLAI FG+FY    R I+PR+  ++E RR+ I+SD ++    K+E 
Sbjct: 29  FPPFDFVHFGSHLFWLAISFGLFYLFISRVIVPRIGGVIETRRDRIASDLDQAMRMKQEA 88

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           + ++ +YE  LA AR+ A  I        +Q +E +R+  E +L  KL++A+ +I  ++ 
Sbjct: 89  DIVVETYERKLAQARSQAHVIAQTASEEIKQKVELERKEIEANLEKKLTDAEKQIAKIRD 148

Query: 133 KASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
           KA + V SI  EV  ++V+KL    VS   V+  +  
Sbjct: 149 KAMKSVGSIAEEVALEIVKKLIDVEVSKESVRSAVKA 185


>gi|84500335|ref|ZP_00998601.1| FoF1 ATP synthase, subunit B [Oceanicola batsensis HTCC2597]
 gi|84392269|gb|EAQ04537.1| FoF1 ATP synthase, subunit B [Oceanicola batsensis HTCC2597]
          Length = 182

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/161 (24%), Positives = 81/161 (50%)

Query: 12  RFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKRE 71
             P  D ST+ +Q FWL +     Y++  R  LPR+S+++  R   I++D    +  K++
Sbjct: 22  GMPQLDFSTWGNQIFWLIVTLIAIYFILSRIALPRISAVLAERTGTITNDIAAAEDLKQK 81

Query: 72  VESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQ 131
            +   ++YE++LA AR  A  I+ +  +  + +L+      + ++  K +  +  I +++
Sbjct: 82  AKDAEAAYEKALADARVEANRIVAETRSEIQADLDAATAKADAEIAAKTAEGEKAIAEIR 141

Query: 132 KKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
             A + V ++  +  + +V  LGFS   A V K +  +  G
Sbjct: 142 ANAMESVETVAKDTAQAIVSGLGFSAEAASVDKAVADRMKG 182


>gi|158425886|ref|YP_001527178.1| ATP synthase subunit B precursor [Azorhizobium caulinodans ORS 571]
 gi|158332775|dbj|BAF90260.1| ATP synthase subunit B precursor [Azorhizobium caulinodans ORS 571]
          Length = 235

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 1/159 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPF    F SQ  WL + FG  Y++  R  LPR+  I+E R + I+ D E+    + E 
Sbjct: 72  FPPFKPQHFASQLIWLIVSFGALYFLMSRVTLPRIGRILEERHDRIAKDLEEARLRQAES 131

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+  ++YE++L  AR  A  I  +  A      +  R+  E++L  KL++A+  I   + 
Sbjct: 132 EAAQAAYEKALTEARGKANAIAGEARARLAAETDANRKSLEENLNAKLADAERRIASTKA 191

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVS-DADVQKILDRKR 170
            A   V  I  + T  +V  L  + + + DV+  +D   
Sbjct: 192 TALSHVRGIAVDTTGAIVTALVGTPAGNQDVESAVDAAL 230


>gi|194335033|ref|YP_002016893.1| F0F1 ATP synthase subunit B [Prosthecochloris aestuarii DSM 271]
 gi|226694419|sp|B4S6E4|ATPF2_PROA2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|194312851|gb|ACF47246.1| ATP synthase F0, B subunit [Prosthecochloris aestuarii DSM 271]
          Length = 175

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/162 (19%), Positives = 67/162 (41%), Gaps = 3/162 (1%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            D +      FW A+ F I   +  +F    +   +E R   I S  ++  +AK E E+ 
Sbjct: 14  LDPN--PGLIFWTAVTFVIVLLILKKFAWGPILGALEEREKAIQSSIDRAHTAKDEAEAA 71

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
           +   +E L  A A A++I+ +     E+      E    +    +S+A+ EI+  +++A 
Sbjct: 72  LRKNKELLTKADAEAEKILREGKEYGEKLRADIVEKAHSEATKMISSAKEEIEQEKRRAL 131

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
            E+ + V ++      K+   ++     + I+      +   
Sbjct: 132 DELRNEVADLAVQGAEKILMANLDADKQKAIVSSMIQDLSKH 173


>gi|188582609|ref|YP_001926054.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           populi BJ001]
 gi|226698379|sp|B1ZJN3|ATPX_METPB RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|179346107|gb|ACB81519.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           populi BJ001]
          Length = 200

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 51/171 (29%), Positives = 85/171 (49%), Gaps = 3/171 (1%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
            S      FPPF++ TFL+Q  WLA+ FG+ Y++  +  LPR+ +I+  R   +SSD  +
Sbjct: 31  PSGGHGGAFPPFESHTFLAQLIWLALAFGLLYYLMSKVALPRIEAILGDRAGRLSSDLNE 90

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
               K E ++  ++YE SL  A+A A+ I  +   +     + +R+  E +L  +L+ ++
Sbjct: 91  AQRMKAEADAAGAAYETSLREAQAKAQAIAQETRNSLSAEADAKRKTLEAELNQRLAASE 150

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA 175
             I     +A   V +I GE    +V +L     D   Q  L+R  D   A
Sbjct: 151 ATIRARTSEAMGNVRTIAGETASAIVERLTGQAPD---QASLNRALDATPA 198


>gi|154245920|ref|YP_001416878.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
 gi|226694401|sp|A7IGS8|ATPF2_XANP2 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|154160005|gb|ABS67221.1| H+transporting two-sector ATPase B/B' subunit [Xanthobacter
           autotrophicus Py2]
          Length = 207

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 58/164 (35%), Positives = 85/164 (51%), Gaps = 1/164 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD +TF SQ  WL + FG+ Y +  R  LPR+  I+E R + I+ D E+    K E 
Sbjct: 43  FPPFDATTFASQLLWLVLSFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAES 102

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+  +SYE++LA ARA A  I  +       + E  R+  E  L  KL+ A+  I   + 
Sbjct: 103 EAAQASYEKALAEARAKANAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKT 162

Query: 133 KASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +A   V  I  + T  +V   +G S + +DV+K +D      DA
Sbjct: 163 EALTHVRGIAVDATHAIVSTLIGSSPAQSDVEKAVDVALVKKDA 206


>gi|259418002|ref|ZP_05741921.1| ATP synthase B' chain (Subunit II) [Silicibacter sp. TrichCH4B]
 gi|259346908|gb|EEW58722.1| ATP synthase B' chain (Subunit II) [Silicibacter sp. TrichCH4B]
          Length = 181

 Score =  102 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 76/155 (49%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
            ++ +   SS  P  D ST+ +Q FWL +   + Y +  R  LPR+++I+  R+  I++D
Sbjct: 11  GAADAVHGSSGMPQLDFSTYGNQIFWLLVTLVVIYLILSRVALPRIAAILNERQGTITND 70

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
               +  K +     ++Y ++LA ARA A+ I  +  A  +  ++      ++++  K +
Sbjct: 71  LAAAEDLKAKAVEAENAYNKALADARAEAQRIAAETRAEIQAGVDEAIAKADEEISAKAA 130

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS 156
            ++  I +++  A + V  +  +    LV  LG  
Sbjct: 131 ESEKAIAEIRAGALESVKVVATDTASALVAALGGK 165


>gi|197104052|ref|YP_002129429.1| FoF1 ATP synthase B' chain [Phenylobacterium zucineum HLK1]
 gi|196477472|gb|ACG77000.1| FoF1 ATP synthase B' chain [Phenylobacterium zucineum HLK1]
          Length = 206

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 66/155 (42%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
            ++        P F+   +  Q  WL I+F I Y++  +   PR   ++E R   I+   
Sbjct: 38  VAAHGGEGGGLPQFEVEYWGGQIIWLLILFAILYFLFAKVFTPRYRKVVEARAETIAGAL 97

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E+    + E ++  ++ +  +  AR+ A++++    A A   L   +   +  L  +L  
Sbjct: 98  EEARRVQAEADNQAAAVKAEVEQARSSARKVVADANAKAAAELARSQAAEDARLNAELDQ 157

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV 157
           A+  I  M+  A   V +I  +  K +V KL    
Sbjct: 158 AEQRIRKMRDGAMTNVEAIAADTAKTIVEKLTGKA 192


>gi|56698066|ref|YP_168437.1| F0F1 ATP synthase subunit B' [Ruegeria pomeroyi DSS-3]
 gi|56679803|gb|AAV96469.1| ATP synthase F0, B' subunit [Ruegeria pomeroyi DSS-3]
          Length = 181

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 75/165 (45%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +   P      F +Q FWL I   + + V  R  LPR+++I+  R+  I++D    + 
Sbjct: 17  GSAIGMPQLCFDWFPNQIFWLVITLVVVFLVLSRVALPRIAAILAERQGTITNDLAAAED 76

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K +  +   +Y ++LA ARA A+ I  +  A  +  L       + ++  K + ++  I
Sbjct: 77  LKAKAAAAEEAYTKALADARAEAQRIAAEARAEIQAGLNDAIAKADAEIAAKAAESEKVI 136

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
             ++  A + + ++  +  + LV  LG     A V   +D++  G
Sbjct: 137 AGIRAGALESIEAVAKDTAEALVDALGGKAEAASVAGAVDQRMKG 181


>gi|126734940|ref|ZP_01750686.1| ATP synthase F0, B' subunit [Roseobacter sp. CCS2]
 gi|126715495|gb|EBA12360.1| ATP synthase F0, B' subunit [Roseobacter sp. CCS2]
          Length = 181

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/167 (19%), Positives = 80/167 (47%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
           +   +   P        +Q FWL +     Y+V  R  LPR+S+++  R   I++D    
Sbjct: 15  AGGSALGMPQLCADWMPNQIFWLLVTLITLYFVMSRIALPRISAVLAERSGTITNDIAAA 74

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
           +  K +     ++Y+++L  AR+ A++I+ +  A  +  L+ + +  +  +  K + ++ 
Sbjct: 75  EELKNKAAEAEAAYDQALLDARSEAQKIVAEAKAEIQAELDVELQKADAQIAAKTAESEA 134

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            I ++++ A + V ++  +  K+LV  +G +     +   ++ +  G
Sbjct: 135 AIGEIREGAVKSVTAVAKDTAKELVAAMGGTADAKAITAAVNARMKG 181


>gi|83313094|ref|YP_423358.1| ATP synthase B' chain [Magnetospirillum magneticum AMB-1]
 gi|82947935|dbj|BAE52799.1| ATP synthase B' chain [Magnetospirillum magneticum AMB-1]
          Length = 164

 Score =  101 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/161 (23%), Positives = 76/161 (47%), Gaps = 1/161 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD + F  Q FWLA+ F   Y+V     LP++ ++++ R+  I  + +K    K E 
Sbjct: 1   MPQFDPTFFAPQLFWLALTFVTLYFVMSTVALPKIGAVLDERQRKIDDNLDKAAQLKAEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+ +++YE++LA +RAHA+ +I +       + E +       L  ++ + +  I + + 
Sbjct: 61  EAAVAAYEKALAESRAHAQSVIKEASDRLAADAETRNRELAARLADQVKSGEARIAEAKD 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDG 172
           KA   V  +  +V    + +L  S   +  ++  +      
Sbjct: 121 KALANVRDVALDVAGATIARLVGSPADNTRLEAAVAAALKE 161


>gi|114763714|ref|ZP_01443108.1| ATP synthase F0, B' subunit [Pelagibaca bermudensis HTCC2601]
 gi|114543715|gb|EAU46728.1| ATP synthase F0, B' subunit [Roseovarius sp. HTCC2601]
          Length = 183

 Score =  101 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/171 (22%), Positives = 75/171 (43%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           A   S   +   P        +Q FWL I   + ++V  R  LPR++S++  R+  I++D
Sbjct: 13  ACVDSHGSAIGMPQLCAEWIPNQVFWLVITLVVIFFVLSRIALPRIASVLAERQGTITND 72

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
               +  KR+     ++Y+++LA ARA A+ I  +     +  L+      +  +  K +
Sbjct: 73  IAAAEELKRQSADAEAAYDKALADARAEAQAIGQQTRDEIKAQLDEATREADAQIAEKTA 132

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            ++  I +++  A   V  +  +    +V  LG     A +   +D +  G
Sbjct: 133 ESEAAIAEIRASALANVEIVAKDTAAAIVAALGGKADQAAISSAVDNRMKG 183


>gi|226698383|sp|A1URU4|ATPX_BARBK RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
          Length = 188

 Score =  100 bits (249), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 58/158 (36%), Positives = 89/158 (56%), Gaps = 1/158 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD S F S FFWL I FG FY+   R I+PR+   +E+RR+ I+SD ++    K+E 
Sbjct: 29  FPPFDFSHFCSHFFWLVISFGFFYFFIARVIVPRIGCTIEIRRDRIASDLDRAMRLKQEA 88

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ++++  YE  LA AR  A  I  K     ++  + +R+  E  L  KL++A+ +I  ++ 
Sbjct: 89  DTVVEIYERKLAEARLQAYAIAQKTSNEIKEKTKLERKEIETSLDKKLADAEGQIAKIRN 148

Query: 133 KASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           KA Q + SI  EV  ++V+K +G  VS   V   +   
Sbjct: 149 KAVQNIGSIAEEVVPEIVKKLIGVEVSKESVSLAVKAA 186


>gi|23016149|ref|ZP_00055908.1| COG0711: F0F1-type ATP synthase, subunit b [Magnetospirillum
           magnetotacticum MS-1]
          Length = 164

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 75/161 (46%), Gaps = 1/161 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD + F  Q FWLA+ F   Y+V     LP++ ++++ R+  I  + +K    K E 
Sbjct: 1   MPQFDPTFFAPQLFWLALTFVTLYFVMSTVALPKIGAVLDERQRKIDDNLDKAAQLKAEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+ +++YE++LA +RAHA+ +I +         E +       L  ++   +  I + + 
Sbjct: 61  EAAVAAYEKALAESRAHAQSVIKEASDRLAAEAETRNRELAARLADQVKAGEARIAEAKD 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDG 172
           KA   V  +  +V    + +L  S   +A ++  +      
Sbjct: 121 KALANVRDVAIDVAGATIARLVGSPADNARLEAAVASALKE 161


>gi|241203303|ref|YP_002974399.1| F0F1 ATP synthase subunit B' [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240857193|gb|ACS54860.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 207

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 51/152 (33%), Positives = 80/152 (52%), Gaps = 1/152 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++TF SQ  WL I FG+FY +  + I PR+ +I++ R   IS D E
Sbjct: 37  AEGEHARGPFPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGTILDQRHTRISQDLE 96

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE  LA ARA +  I      AA+   E +R   E  L  K+  A
Sbjct: 97  EAGRLKAEADAAVRTYEGELAAARAKSNAIGSAARDAAKAKAEEERRAVEASLSEKIKAA 156

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +  I +++ KA  +V +I  E    +V +L  
Sbjct: 157 ELRIGEIKAKAFADVGTIAEETAAAVVDQLIG 188


>gi|170747146|ref|YP_001753406.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|226698380|sp|B1LWM1|ATPX_METRJ RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|170653668|gb|ACB22723.1| H+transporting two-sector ATPase B/B' subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 192

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/162 (29%), Positives = 81/162 (50%), Gaps = 1/162 (0%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             S  FPPF+TS FL+Q  WLA+ FG+ Y++  +  LPR+ SI+  R   + +D ++  +
Sbjct: 28  AHSGAFPPFETSGFLAQLIWLALAFGLLYYLMDKIALPRIQSILHARAERLRADLDQAQA 87

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K E ++   ++E +L  A+  A++I            E +R+  E +L  KLS ++  I
Sbjct: 88  MKAEADAAGVAFETALRDAQGKARDIAQTTRNELAAEAETKRKALEDELNAKLSASEATI 147

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD-ADVQKILDR 168
               + A   V +I GE    +V +L     D   + + LD 
Sbjct: 148 RTRTEAAMGNVRTIAGEAASAIVERLTGQAPDRTSLDRALDA 189


>gi|86356512|ref|YP_468404.1| F0F1 ATP synthase subunit B' [Rhizobium etli CFN 42]
 gi|123512872|sp|Q2KBV9|ATPX_RHIEC RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|86280614|gb|ABC89677.1| ATP synthase protein, subunit B` [Rhizobium etli CFN 42]
          Length = 207

 Score =  100 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 52/153 (33%), Positives = 80/153 (52%), Gaps = 1/153 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++T+ SQ  WL I FG+FY +  + I PR+ +I++ R   IS D E
Sbjct: 37  AEGEHARGPFPPFDSTTYASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHKRISQDLE 96

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE  LA ARA +  I      AA+   E  R   E  L  K+  A
Sbjct: 97  EAGRLKAEADAAVQTYEGELAAARAKSHAIGSAARDAAKVKAEEDRRTVEASLSEKIKAA 156

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS 156
           +  I D++ KA  +V +I  E    +V +L  S
Sbjct: 157 EARIADIKAKAFADVGTIAEETAAAVVEQLIGS 189


>gi|121602545|ref|YP_988697.1| F0F1 ATP synthase subunit B' [Bartonella bacilliformis KC583]
 gi|120614722|gb|ABM45323.1| ATP synthase F0, B subunit family protein [Bartonella bacilliformis
           KC583]
          Length = 161

 Score = 99.9 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 58/158 (36%), Positives = 89/158 (56%), Gaps = 1/158 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD S F S FFWL I FG FY+   R I+PR+   +E+RR+ I+SD ++    K+E 
Sbjct: 2   FPPFDFSHFCSHFFWLVISFGFFYFFIARVIVPRIGCTIEIRRDRIASDLDRAMRLKQEA 61

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ++++  YE  LA AR  A  I  K     ++  + +R+  E  L  KL++A+ +I  ++ 
Sbjct: 62  DTVVEIYERKLAEARLQAYAIAQKTSNEIKEKTKLERKEIETSLDKKLADAEGQIAKIRN 121

Query: 133 KASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           KA Q + SI  EV  ++V+K +G  VS   V   +   
Sbjct: 122 KAVQNIGSIAEEVVPEIVKKLIGVEVSKESVSLAVKAA 159


>gi|126724949|ref|ZP_01740792.1| FoF1 ATP synthase, subunit B [Rhodobacterales bacterium HTCC2150]
 gi|126706113|gb|EBA05203.1| FoF1 ATP synthase, subunit B [Rhodobacterales bacterium HTCC2150]
          Length = 184

 Score = 99.9 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 81/170 (47%), Gaps = 1/170 (0%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  +  +   P  D S+F +Q FWL +     Y V  R  LPR++S++  R+  I+ D  
Sbjct: 15  ADHAAEAVGMPQLDFSSFPNQIFWLIVTLVAIYLVLSRVALPRIASVLAERQGTITKDIA 74

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           + +  K+      ++Y ++LA AR+ A+EII    A  ++ L+    V + ++  K + +
Sbjct: 75  RAEELKQAAVDAEAAYNKALADARSEAQEIIAAAKADIQKELDAAVAVADAEISAKAAES 134

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDG 172
           +  I  ++  A   V  +  ++ KD+V  +    +    ++  +  +  G
Sbjct: 135 EKAITAIRDSAMTSVTDVANDIAKDIVSAVSTAKIDAKSLKAAVSSRLKG 184


>gi|319404578|emb|CBI78184.1| ATP synthase subunit b 1 [Bartonella rochalimae ATCC BAA-1498]
          Length = 210

 Score = 99.9 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 60/161 (37%), Positives = 86/161 (53%), Gaps = 1/161 (0%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            S  FPPFD   F S F WLAI FG FY    R I+PR+ S++E RR+ I SD ++    
Sbjct: 47  ASRTFPPFDFVYFGSHFLWLAISFGFFYLFISRVIVPRIGSVIETRRDRIVSDLDQAMRM 106

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K+E +++I   E+ LA AR  AK II       +   E QRE  E  L  +L +A+N+I 
Sbjct: 107 KQEADTVIEICEKKLAEARLEAKTIIQVANNEIKLKAELQREKIEAALEKELEDAENKIK 166

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
            +Q KA Q V  I  E+  ++++KL    +S   +   +  
Sbjct: 167 KIQNKAMQNVNLIAEEIAFEIIKKLIDVDISKKSISSAIKA 207


>gi|163738205|ref|ZP_02145621.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
 gi|163743799|ref|ZP_02151172.1| FoF1 ATP synthase, subunit B [Phaeobacter gallaeciensis 2.10]
 gi|161382948|gb|EDQ07344.1| FoF1 ATP synthase, subunit B [Phaeobacter gallaeciensis 2.10]
 gi|161388821|gb|EDQ13174.1| H+-transporting two-sector ATPase, B/B' subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 181

 Score = 99.9 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 77/163 (47%)

Query: 10  SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK 69
           S   P  D ST+ +Q FWL +   + Y++  R  LPR+++++  R+  I++D    +  K
Sbjct: 19  SGGMPQLDFSTYANQIFWLVVTLVVIYFILSRIALPRIAAVLAERQGTITNDLAAAEDLK 78

Query: 70  REVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129
            +     ++Y ++LA ARA A+ I  +  A  + +L+      +  +  K + ++  I +
Sbjct: 79  AKAVEAETAYNQALADARAEAQRIAAETRAEIQADLDEAIAKADAQIAAKAAESEAVIAE 138

Query: 130 MQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           ++  A   V ++  +   ++V   G    +  V   +  +  G
Sbjct: 139 IKAGAIASVEAVAVDTAAEIVATFGGKADEKAVAAAVADRMKG 181


>gi|115526765|ref|YP_783676.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
 gi|122294476|sp|Q07H88|ATPX_RHOP5 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|115520712|gb|ABJ08696.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisA53]
          Length = 181

 Score = 99.5 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 78/171 (45%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + +     + FPPF   TF SQ   L I F   Y +  +  LP++  +++ R+  I  D 
Sbjct: 11  TGAEGGHKAPFPPFQQDTFASQLVSLLIAFVALYLIVSKVALPKVGGVLDARQKKIEDDF 70

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E +  + +YE++LA ARA A+ I  +         E +R+  E+ L  KL++
Sbjct: 71  AAALRLKGESDDALKAYEDALAQARARAQAIGTETRERLNAAAEAERKTLEQRLAVKLAD 130

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
           A+  I   +++A   V  I  +    +V++L G +     V   +D    G
Sbjct: 131 AEKTIAATREQAMSNVRGIATDAASAIVQQLVGIAPDAKAVGHAVDATLKG 181


>gi|114769966|ref|ZP_01447576.1| FoF1 ATP synthase, subunit B [alpha proteobacterium HTCC2255]
 gi|114549671|gb|EAU52553.1| FoF1 ATP synthase, subunit B [alpha proteobacterium HTCC2255]
          Length = 178

 Score = 99.5 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 84/172 (48%), Gaps = 1/172 (0%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
            ++ +++ +   P  D STF +Q FWL +   + Y V  R  LPR+++++  R   I  D
Sbjct: 7   GAAQAAESAPGMPQLDFSTFPNQIFWLVVTLIVLYLVLSRVALPRIATVLSERHGAIQRD 66

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            +K +  KR      ++Y ++LA ARA A +I+++  A  +++L+      + ++  K +
Sbjct: 67  LDKAEEMKRSAIEAENTYNKALADARAKANDIVNEAKAEIQKDLDKAIAKADLEIAAKAA 126

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD-ADVQKILDRKRDG 172
            ++  I  ++  A Q V  +      ++V  +    +D   ++  +  +  G
Sbjct: 127 ESEKAISAIKDSAVQSVEEVANITANNIVDAILPEAADTKKIKVAVATRLKG 178


>gi|190890577|ref|YP_001977119.1| ATP synthase, subunit B' [Rhizobium etli CIAT 652]
 gi|226698815|sp|B3PRF8|ATPX_RHIE6 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|190695856|gb|ACE89941.1| ATP synthase protein, subunit B' [Rhizobium etli CIAT 652]
 gi|327190880|gb|EGE57939.1| ATP synthase protein, subunit B [Rhizobium etli CNPAF512]
          Length = 207

 Score = 99.5 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 50/152 (32%), Positives = 78/152 (51%), Gaps = 1/152 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++T+ SQ  WL I F +FY +  + I PR+ +I++ R   IS D E
Sbjct: 37  AEGEHARGPFPPFDSTTYASQLLWLVITFSVFYLLMQKVIAPRIGAILDQRHTRISQDLE 96

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE  LA ARA +  I      AA+   E  R   E  L  K+  A
Sbjct: 97  EAGRLKAEADAAVQTYEGELAAARAKSNAIGSAARDAAKAKAEEDRRAVEASLSEKIKAA 156

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +  I D++ KA  +V +I  E    +V +L  
Sbjct: 157 EVRIADIKAKAFADVGTIAEETAAAVVEQLIG 188


>gi|254464611|ref|ZP_05078022.1| ATP synthase B' chain [Rhodobacterales bacterium Y4I]
 gi|206685519|gb|EDZ46001.1| ATP synthase B' chain [Rhodobacterales bacterium Y4I]
          Length = 182

 Score = 99.5 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/164 (23%), Positives = 79/164 (48%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            +   P  D STF +Q FWL +   + Y +  R  LPR+++++  R+  I++D    +  
Sbjct: 19  SAPGMPQLDFSTFGNQIFWLVVALVVIYLILSRVALPRIAAVLAERQGTITNDLAAAEDL 78

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K +     ++Y ++LA ARA A+ I  +  A  +  L+      ++ +  K + ++  I 
Sbjct: 79  KAKAVEAENAYNKALADARAEAQRIAAETRAEIQAGLDEAIAKADEQISAKAAESEKAIA 138

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           +++  A + V ++  E  + LV  LG S     +   + ++  G
Sbjct: 139 EIKAGALESVKAVATETAEALVTALGGSADKDAIASAVAQRTKG 182


>gi|85706760|ref|ZP_01037852.1| FoF1 ATP synthase, subunit B [Roseovarius sp. 217]
 gi|85668818|gb|EAQ23687.1| FoF1 ATP synthase, subunit B [Roseovarius sp. 217]
          Length = 177

 Score = 99.1 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 82/170 (48%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++  +  +   P  D STF +Q FWL +   + Y+V  R  LPR++++M  R+  I++D 
Sbjct: 8   AAGQAASTPGLPQLDFSTFGNQIFWLLVTLVVIYFVLSRIALPRIAAVMAERQGAITNDL 67

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
              +  K + E    +Y ++LA ARA A+ I+ K  A  +  L+      + ++  + + 
Sbjct: 68  AAAEDLKVKAEQAELAYLKALADARAEAQTIVAKAKAEIKAELDAATAKADAEIAARAAE 127

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            + +I++++  A   V  +  +   ++V  +G       V   ++ +  G
Sbjct: 128 GEQKIEEIRANAMDSVKEVAKDAAAEIVAVMGGKADAKTVSAAVNARMKG 177


>gi|49473961|ref|YP_032003.1| F0F1 ATP synthase subunit B' [Bartonella quintana str. Toulouse]
 gi|81696062|sp|Q6G0H1|ATPF1_BARQU RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|49239464|emb|CAF25815.1| ATP synthase B chain [Bartonella quintana str. Toulouse]
          Length = 188

 Score = 99.1 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 58/158 (36%), Positives = 88/158 (55%), Gaps = 1/158 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD   F S FFWLAI FG+FY    R I+PR+  ++E RR+ I+SD ++    K+E 
Sbjct: 29  FPPFDFVHFGSHFFWLAISFGLFYLFISRVIVPRIGDVIETRRDRIASDLDQAMRMKQEA 88

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ++++ +YE  LA AR+ A  I        +Q +E +R   E  L  KL +A+ +I  ++ 
Sbjct: 89  DTVVETYERKLAQARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQIAKIRD 148

Query: 133 KASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRK 169
           KA Q V SI  E   ++V+K +   VS   V+  +   
Sbjct: 149 KAMQNVGSIAEEAALEIVKKMIDVDVSRESVRSAVKAA 186


>gi|209883848|ref|YP_002287705.1| H+-transporting two-sector ATPase, B/B' subunit [Oligotropha
           carboxidovorans OM5]
 gi|226737879|sp|B6JDC8|ATPX_OLICO RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|209872044|gb|ACI91840.1| H+-transporting two-sector ATPase, B/B' subunit [Oligotropha
           carboxidovorans OM5]
          Length = 187

 Score = 99.1 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 49/161 (30%), Positives = 79/161 (49%), Gaps = 1/161 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPF+  TF SQ    AI F + Y +  RF LPR+  +++ R   I  D  +  + + E 
Sbjct: 22  FPPFNKDTFASQLVSFAIAFALLYVIVSRFALPRVGGVIKTREGTIEKDLAEAQAFRDES 81

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           +  + +YE  LA AR  A+ I  +         + +R+  E  L  KL+ A+  I DM+ 
Sbjct: 82  DLALKAYETELAAARTRAQAIGSETRDTLAAQSDAERKAVELSLSAKLAEAEKTISDMRT 141

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDAD-VQKILDRKRDG 172
           KA   V +I  + T  +V++L  +  DA  + + +D    G
Sbjct: 142 KAMGNVKAIAADATSAIVQQLSGTAPDAQLIDRAVDASLKG 182


>gi|226698382|sp|A8HT70|ATPX_AZOC5 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
          Length = 196

 Score = 98.7 bits (244), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 1/159 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPF    F SQ  WL + FG  Y++  R  LPR+  I+E R + I+ D E+    + E 
Sbjct: 33  FPPFKPQHFASQLIWLIVSFGALYFLMSRVTLPRIGRILEERHDRIAKDLEEARLRQAES 92

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+  ++YE++L  AR  A  I  +  A      +  R+  E++L  KL++A+  I   + 
Sbjct: 93  EAAQAAYEKALTEARGKANAIAGEARARLAAETDANRKSLEENLNAKLADAERRIASTKA 152

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVS-DADVQKILDRKR 170
            A   V  I  + T  +V  L  + + + DV+  +D   
Sbjct: 153 TALSHVRGIAVDTTGAIVTALVGTPAGNQDVESAVDAAL 191


>gi|240850061|ref|YP_002971454.1| ATP synthase subunit B' [Bartonella grahamii as4aup]
 gi|240267184|gb|ACS50772.1| ATP synthase subunit B' [Bartonella grahamii as4aup]
          Length = 188

 Score = 98.3 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 58/165 (35%), Positives = 92/165 (55%), Gaps = 1/165 (0%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
           +   +  FPPFD   F S FFWLAI FG+FY    R I+PR+  ++E RR+ I+SD ++ 
Sbjct: 22  AEHANRVFPPFDFVHFGSHFFWLAISFGLFYLFISRVIVPRIGGVIETRRDRIASDLDQA 81

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
              K+E + ++ +YE  LA AR  A  I        ++  E +R+  E+ L  KL++A+ 
Sbjct: 82  MRMKQEADIVVETYERKLAEARLKAHAIAQVASEELKEKAELERKEIEESLEKKLADAEK 141

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRK 169
           +I  ++ KA Q V SI  EV  ++V+KL    +S   V+ ++   
Sbjct: 142 QIAKIRDKAMQNVGSIAEEVALEIVKKLIDVDISKEAVRSVVKTA 186


>gi|297618433|ref|YP_003703592.1| ATP synthase F0 subunit beta [Syntrophothermus lipocalidus DSM
           12680]
 gi|297146270|gb|ADI03027.1| ATP synthase F0, B subunit [Syntrophothermus lipocalidus DSM 12680]
          Length = 197

 Score = 98.3 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 77/173 (44%), Gaps = 4/173 (2%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A+S  +  S   PPF    +  +  W A+ F + + + ++F    + +++E R N I S
Sbjct: 22  LATSCFAAESEGVPPF-PDIY--KIGWTAVNFFVLFAILYKFGYTPIVNMLEQRTNTIES 78

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             +  +  + EVE M    + +LA AR  A+EI+ +    AE+         ++D   + 
Sbjct: 79  SLKHAEDLRAEVEQMRKEAQTNLAEARREAQEIVARATKVAEEAKNDIIAKAQQDARAEK 138

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
             A  EI   +++A  E+      +      K LG ++++ D + ++      
Sbjct: 139 DKALAEIKAEKEQALTELRDTAATLAIMAAEKVLGRALTEEDHKGMVKEFVKE 191


>gi|189501405|ref|YP_001960875.1| F0F1 ATP synthase subunit B [Chlorobium phaeobacteroides BS1]
 gi|226741336|sp|B3EQ96|ATPF_CHLPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189496846|gb|ACE05394.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides BS1]
          Length = 175

 Score = 98.3 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/168 (20%), Positives = 72/168 (42%), Gaps = 5/168 (2%)

Query: 10  SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK 69
           S      D +      FW  + F I  ++  +F    + S +E R   I +  ++  SAK
Sbjct: 10  SGGL--LDPN--PGLIFWTTVTFLIVLFILKKFTWGPMLSALEEREKGIKNSIDRAQSAK 65

Query: 70  REVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129
            E E++++   + LA A A A +II +     ++      E    +    +S+A++EID 
Sbjct: 66  EEAEAVLNKNRQLLAQAGADADKIIREGKEYGDKLKAEITEKAHLEASRMISSAKDEIDQ 125

Query: 130 MQKKASQEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
            +++A  E+ + V ++      K+   ++     + I+D     +   
Sbjct: 126 EKRRALTELRTEVADLAVKGAEKIIMANLDAEKQKNIVDSMIQELSQH 173


>gi|163794977|ref|ZP_02188946.1| H+-transporting two-sector ATPase, B/B' subunit [alpha
           proteobacterium BAL199]
 gi|159179796|gb|EDP64323.1| H+-transporting two-sector ATPase, B/B' subunit [alpha
           proteobacterium BAL199]
          Length = 199

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/153 (22%), Positives = 69/153 (45%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +++     S  P  D  ++ +Q FWL + F + Y +  +  LP+++ ++E R+  I+ D 
Sbjct: 27  AANDGHDPSGLPQLDVHSYPTQIFWLIVAFVVLYAIMSKVALPKIAEVLEERQERIADDI 86

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E  +  + E  ++ + YE++LA AR  A+E+  +      +          K L  K   
Sbjct: 87  ETAERLRSEAAAVQAEYEKALAGARGKAQELFRETADVVAKEHAEAEAEAAKKLNRKTKT 146

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           A+  I   + +A + + ++  E       KL  
Sbjct: 147 AETRIGKQRDEALESLRAVASETAAAATAKLIG 179


>gi|86751671|ref|YP_488167.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris HaA2]
 gi|123098175|sp|Q2IRA4|ATPX_RHOP2 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|86574699|gb|ABD09256.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris HaA2]
          Length = 185

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 73/171 (42%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +++     + FPPF   TF SQ   L I F   Y +  +  LPR+  ++E R+  I  D 
Sbjct: 15  TAADGGHKAPFPPFQKETFASQLVSLTIAFVALYLIVSKLALPRVGGVIEERQKTIDGDL 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E +  + +YE  LA AR  A+ I  +         E +R+  E+ L  KL++
Sbjct: 75  AAAQKLKGESDDALKAYEAELAAARTRAQAIGAETREKLNAAAEAERKTLEERLSAKLAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
           A+  I   +  A   V  I  E    +V++L G       +   ++    G
Sbjct: 135 AEKTIAATRTAAMGNVRGIASEAAAAIVQQLAGVQPDSKALDSAVNASIKG 185


>gi|116250701|ref|YP_766539.1| F0F1 ATP synthase subunit B' [Rhizobium leguminosarum bv. viciae
           3841]
 gi|226698816|sp|Q1MKT0|ATPX_RHIL3 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|115255349|emb|CAK06424.1| putative ATP synthase B' chain (ec 3.6.3.14) (subunit II)
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 207

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 77/154 (50%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
             +        FPPFD++T+ SQ  WL I FG+FY +  + I PR+ +I++ R   +S D
Sbjct: 35  GVAEGGHARGPFPPFDSTTYASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHTRLSQD 94

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            E+    K E ++ + +YE  LA ARA +  I      AA+   E  R   E  L  K+ 
Sbjct: 95  VEEAGRLKAEADAAVRTYEGELAAARAKSNAIGSAARDAAKAKAEQDRRAVEATLSEKIK 154

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
            A+  I +++ KA  +V +I  E    ++ +L  
Sbjct: 155 AAEVRIGEIKAKAFADVGAIAEETAAAVIDQLIG 188


>gi|126738038|ref|ZP_01753759.1| ATP synthase F0, B' subunit [Roseobacter sp. SK209-2-6]
 gi|126720535|gb|EBA17240.1| ATP synthase F0, B' subunit [Roseobacter sp. SK209-2-6]
          Length = 178

 Score = 98.3 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/171 (22%), Positives = 82/171 (47%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           A+  +++ +   P  D STF +Q FWLA+     Y++  R  LPR+++++  R+  I++D
Sbjct: 8   AAHGAAESAPGMPQLDFSTFGNQIFWLAVALVAIYFILSRVALPRIAAVLAERQGTITND 67

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
               +  K +     ++Y ++LA ARA A+ I  +  A  + +L       ++ +  K +
Sbjct: 68  LAAAEDLKAKAVEAENAYNKALADARAEAQRIAGETRAEIQADLNEAIAKADEQISAKAA 127

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            ++  I +++  A + V  +  +  + LV  LG       +   +  +  G
Sbjct: 128 ESEKAIAEIKAGALESVKEVAADTAEALVAALGGKADAKAIAAAVAERTKG 178


>gi|319407569|emb|CBI81219.1| ATP synthase subunit b 1 [Bartonella sp. 1-1C]
          Length = 210

 Score = 97.9 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 61/161 (37%), Positives = 85/161 (52%), Gaps = 1/161 (0%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            S  FPPFD   F S F WLAI FG FY    R I+PR+  ++E RR+ I SD ++    
Sbjct: 47  ASRTFPPFDFVYFGSHFLWLAISFGFFYLFISRVIVPRIGGVIETRRDRIVSDLDQAMRM 106

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K+E +++I   E+ LA AR  AK II       +   E QRE  E  L  KL +A+N+I 
Sbjct: 107 KQEADTVIEICEKKLAEARLEAKTIIQVANNEIKLKAELQREKIEAALEKKLEDAENKIK 166

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
            +Q KA Q V  I  E+  ++++KL    +S   V   +  
Sbjct: 167 KIQNKAMQNVNLIAEEIAFEIIKKLIDVDISKKSVSSAIKA 207


>gi|254476309|ref|ZP_05089695.1| ATP synthase B' chain [Ruegeria sp. R11]
 gi|214030552|gb|EEB71387.1| ATP synthase B' chain [Ruegeria sp. R11]
          Length = 181

 Score = 97.9 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/163 (22%), Positives = 78/163 (47%)

Query: 10  SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK 69
           S   P  D ST+ +Q FWL +   + Y++  R  LPR+++++  R+  I++D    +  K
Sbjct: 19  SGGMPQLDFSTYANQIFWLVVTLVVIYFILSRIALPRIAAVLAERQGTITNDLAAAEDLK 78

Query: 70  REVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129
            +     ++Y ++LA ARA A+ I  +  A  + +L+      +  +  K + ++  I +
Sbjct: 79  AKAVEAETAYNQALADARAEAQRIAAETRAEIQADLDEAIAKADAQIAAKAAESEASIAE 138

Query: 130 MQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           ++  A + V ++  E   ++V   G    +  +   +  +  G
Sbjct: 139 IKAGAIESVEAVAVETAAEIVAAFGGKADEKAIAAAVADRMKG 181


>gi|92115898|ref|YP_575627.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           hamburgensis X14]
 gi|122418842|sp|Q1QRI0|ATPX_NITHX RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|91798792|gb|ABE61167.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           hamburgensis X14]
          Length = 185

 Score = 97.9 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 46/171 (26%), Positives = 79/171 (46%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + +     + FPPF   TF SQ   L I F   Y ++ R  LPR+   ++ R+N I  D 
Sbjct: 15  TEAGGGHKAPFPPFQKDTFASQLVSLTIAFVALYLISSRLALPRVRKTIDDRQNKIEGDI 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
            +  + K E ++ + +YE  LA AR  A+ I ++         + +R+  EK L  KL++
Sbjct: 75  AQAQTLKNESDAALKAYEVELAAARTRAQAIGNETREKLNAEADTERKALEKRLSAKLAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD-ADVQKILDRKRDG 172
           A+  I   +  A   V  I  +    +V++L  ++ D   V   ++    G
Sbjct: 135 AEKTIASTRTAAMSNVRGIASDAATAIVQQLTGAMPDRKLVDSAVEASMKG 185


>gi|218512639|ref|ZP_03509479.1| F0F1 ATP synthase subunit B' [Rhizobium etli 8C-3]
          Length = 194

 Score = 97.9 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 50/152 (32%), Positives = 78/152 (51%), Gaps = 1/152 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++T+ SQ  WL I F +FY +  + I PR+ +I++ R   IS D E
Sbjct: 37  AEGEHARGPFPPFDSTTYASQLLWLVITFSVFYLLMQKVIAPRIGAILDQRHTRISQDLE 96

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE  LA ARA +  I      AA+   E  R   E  L  K+  A
Sbjct: 97  EAGRLKAEADAAVQTYEGELAAARAKSNAIGSAARDAAKAKAEEDRRAVEASLSEKIKAA 156

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +  I D++ KA  +V +I  E    +V +L  
Sbjct: 157 EVRIADIKAKAFADVGTIAEETAAAVVEQLIG 188


>gi|299134066|ref|ZP_07027259.1| H+transporting two-sector ATPase B/B' subunit [Afipia sp. 1NLS2]
 gi|298590813|gb|EFI51015.1| H+transporting two-sector ATPase B/B' subunit [Afipia sp. 1NLS2]
          Length = 184

 Score = 97.9 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 48/161 (29%), Positives = 80/161 (49%), Gaps = 1/161 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPF+  TF SQ    A+ F + Y +  RF LPR+  +++ R N I  D  +  + + E 
Sbjct: 24  FPPFNKDTFASQLVSFAVAFALLYVIVSRFALPRVGGVIKARENTIEKDLTEAQALRDES 83

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           +  + +YE  LA AR+ A+ I  +         E +R+  E  L  KL  A+  I  M++
Sbjct: 84  DLALKAYETELAEARSRAQAIGSETRDTLAAQSEAERKALEISLSAKLVEAEKTIAAMRE 143

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
           KA   V +I  + T  +V++L G +  +  + + +D    G
Sbjct: 144 KAMGSVKTIATDATAAIVQRLSGVTPDNQAIDRAVDASLKG 184


>gi|27376297|ref|NP_767826.1| FoF1 ATP synthase B' chain [Bradyrhizobium japonicum USDA 110]
 gi|81739768|sp|Q89V70|ATPX_BRAJA RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|27349437|dbj|BAC46451.1| FoF1 ATP synthase B' chain [Bradyrhizobium japonicum USDA 110]
          Length = 187

 Score = 97.5 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 1/161 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPF++ST+ SQ   LAI F + Y +  +  LP++   +E R+N I  D  +  + + + 
Sbjct: 27  FPPFESSTYASQLVSLAIFFVVLYVIVSKLALPKVGGAIEARQNKIEGDLAEAQTLRDQS 86

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ++ + +YE  LA AR+ A+ I ++    A    E +R+  E+ L  KL+ A+  I   + 
Sbjct: 87  DAALKAYESELASARSRAQAIGNESRDKANAQAETERKALEEQLAAKLAGAEKTIASTRT 146

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSV-SDADVQKILDRKRDG 172
            A   V  I  +    +V++L   V   A V   +D    G
Sbjct: 147 AAMSNVRGIAADAAGQIVQQLTGVVPDAASVNAAVDASLKG 187


>gi|85713868|ref|ZP_01044857.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter sp.
           Nb-311A]
 gi|85698994|gb|EAQ36862.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter sp.
           Nb-311A]
          Length = 185

 Score = 97.5 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 80/171 (46%), Gaps = 3/171 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + +     + FPPF   TF SQ   L I F   Y ++ R  LPR+   ++ R++ I  D 
Sbjct: 15  TEADGGHKAPFPPFQKDTFASQLVSLTIAFVALYLISSRLALPRVRKTIDDRQDTIDGDL 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
            +    K E +S + +YE  LA AR  A+ I ++         + +R+  E+ L  KL++
Sbjct: 75  AQAQKLKDESDSALKAYEAELAAARTRAQAIGNETREKLNAAADAERKALEERLSVKLAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGI 173
           A+  I   +  A   V  I  +    +V++L  +  D+   K++D   + +
Sbjct: 135 AEKTIASTRAAAMSNVRGIASDAATAIVQQLTGATPDS---KLVDVAVESL 182


>gi|83815076|ref|YP_445047.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855]
 gi|83756470|gb|ABC44583.1| ATP synthase F0, B subunit [Salinibacter ruber DSM 13855]
          Length = 204

 Score = 97.5 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW  + F IF ++ +RF    ++  +E R   I    ++ + A  E +++ +  EE
Sbjct: 49  VGLIFWKTVAFLIFLYILYRFGWGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEE 108

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +   A   A++I+ +   +AE+  E ++    +++      AQ EI+  ++ A QE+   
Sbjct: 109 ARREAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDE 168

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDG 172
           V ++  +  +K+    +     ++++D   D 
Sbjct: 169 VADLAIEAAQKIIENDLDADRHRQLVDDALDD 200


>gi|260429057|ref|ZP_05783034.1| ATP synthase B' chain [Citreicella sp. SE45]
 gi|260419680|gb|EEX12933.1| ATP synthase B' chain [Citreicella sp. SE45]
          Length = 183

 Score = 97.2 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 34/171 (19%), Positives = 74/171 (43%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
               S   +   P        +Q FWL I   + ++V  R  LPR++S++  R+  I++D
Sbjct: 13  ICVDSHGSAIGMPQLCADWIPNQVFWLVITLVVIFFVLSRIALPRIASVLAERQGTITND 72

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
               +  KR+      +Y+++LA ARA A+ I  K     +  L+      ++ ++ K +
Sbjct: 73  IAAAEEFKRQATEAEKAYDKALADARAEAQGIAQKTREEIKVQLDEAIAEADRAIVAKAA 132

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            ++  I +++  A + +  +  +    +V  +G       +   +  +  G
Sbjct: 133 ESEKAIAEIRASALENIEIVAKDTAAAIVATMGGKADQDAISAAVGDRMKG 183


>gi|258543513|ref|YP_003188946.1| ATP synthase F0 subunit beta' [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634591|dbj|BAI00567.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01]
 gi|256637647|dbj|BAI03616.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-03]
 gi|256640701|dbj|BAI06663.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-07]
 gi|256643756|dbj|BAI09711.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-22]
 gi|256646811|dbj|BAI12759.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-26]
 gi|256649864|dbj|BAI15805.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-32]
 gi|256652854|dbj|BAI18788.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655908|dbj|BAI21835.1| ATP synthase F0 B' chain [Acetobacter pasteurianus IFO 3283-12]
          Length = 193

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/178 (24%), Positives = 93/178 (52%), Gaps = 5/178 (2%)

Query: 1   MASSSSSDFSSRFPPFDTSTFL--SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58
           +A S+   +++  P  D +  L   Q  W A+IF +FY V  + +LP ++ ++E R   I
Sbjct: 16  LAVSAPGAYATGMPQLDFANPLVTGQVMWGAVIFFVFYMVLSKAMLPGITRVLEDRSKRI 75

Query: 59  SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLH 118
           S D E   +AK++ +  ++  +++   A A A+  +D+V+A   +  E Q +     +  
Sbjct: 76  SGDLEIARAAKQDADKAVAELQQARKDAMAEAQAHLDQVLAEEHKAAEQQMQEINARVTA 135

Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176
           ++++A+  + + + +A   +  I G+ T+ LV++L   V DA   +++ +K +   A 
Sbjct: 136 EIADAEKRVAEEKTRALSALKEIAGDTTQALVQRLTGIVPDA---QLVAQKVESASAH 190


>gi|163867853|ref|YP_001609057.1| F0F1 ATP synthase subunit B' [Bartonella tribocorum CIP 105476]
 gi|226694365|sp|A9IQI5|ATPF1_BART1 RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|161017504|emb|CAK01062.1| ATP synthase, B' chain [Bartonella tribocorum CIP 105476]
          Length = 188

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 59/165 (35%), Positives = 91/165 (55%), Gaps = 1/165 (0%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
           +   +  FPPFD   F S FFWLAI FG FY    R I PR+  ++E RR+ I+SD ++ 
Sbjct: 22  AEHANRVFPPFDFVHFSSHFFWLAISFGFFYLFISRVIAPRIGGVIETRRDRIASDLDQA 81

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
              K+E ++++ +YE  LA AR  A  I        +Q  E +R+  E+ L  KL++A+ 
Sbjct: 82  MRMKQEADTVVETYERELAEARLKAHTIAQAAGEELKQKAELERKEIEERLEKKLADAEK 141

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRK 169
           +I  ++ KA Q V SI  EVT  +V+KL    ++   V+ ++   
Sbjct: 142 QIAKIRDKAMQNVGSIAEEVTLGIVKKLIDVDINKETVRSVIKTA 186


>gi|126732372|ref|ZP_01748172.1| ATP synthase F0, B' subunit [Sagittula stellata E-37]
 gi|126707241|gb|EBA06307.1| ATP synthase F0, B' subunit [Sagittula stellata E-37]
          Length = 183

 Score = 96.8 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/167 (23%), Positives = 77/167 (46%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
           +   +   P        +Q FWL I   + Y++  R  LPR++S++  R+  I++D    
Sbjct: 17  AHGSAIGMPQLCGEWIGNQVFWLIITLVVIYFILARVALPRIASVLAERQGTITNDIAAA 76

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
           +  K + E    +YE++LA ARA A+ I  K     +  L+      + D+  K + ++ 
Sbjct: 77  EDLKSKAEEAEKAYEKALADARAEAQAIAQKTRDDIKGELDDAIAKADADIAAKGAESEK 136

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            I +++  A Q V  +  +  + +V  LG S  +  +   +D +  G
Sbjct: 137 AIAEIRASAMQHVEVVAKDTAQAIVAALGMSADEGRISAAVDNQLKG 183


>gi|91975308|ref|YP_567967.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB5]
 gi|123763046|sp|Q13CX3|ATPX_RHOPS RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|91681764|gb|ABE38066.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB5]
          Length = 185

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 45/171 (26%), Positives = 75/171 (43%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +++     + FPPF   TF SQ   L I F   Y +  + ILPR+  ++E R+  I  D 
Sbjct: 15  TAADGGHKAPFPPFQKETFASQLVSLTIAFVALYLIVSKIILPRVGGVIEERQKTIEGDL 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E +  + +YE  LA AR+ A+ I  +         E +R+  E+ L  K+++
Sbjct: 75  AAAQKLKGESDDALKAYEAELAQARSRAQAIGAETREKLNAAAEAERKTLEQRLAAKIAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
           A+  I   +  A   V  I  E    +V++L G       +   ++    G
Sbjct: 135 AEKTISATRTAAMGNVRGIASEAAAAIVQQLAGIQPDSKALDSAVNASIKG 185


>gi|329113593|ref|ZP_08242373.1| ATP synthase subunit b 1 [Acetobacter pomorum DM001]
 gi|326697115|gb|EGE48776.1| ATP synthase subunit b 1 [Acetobacter pomorum DM001]
          Length = 199

 Score = 96.4 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/178 (24%), Positives = 93/178 (52%), Gaps = 5/178 (2%)

Query: 1   MASSSSSDFSSRFPPFDTSTFL--SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58
           +A S+   +++  P  D +  L   Q  W A+IF +FY V  + +LP ++ ++E R   I
Sbjct: 22  LAVSAPGAYATGMPQLDFANPLVTGQVMWGAVIFFVFYMVLSKAMLPGITRVLEDRSKRI 81

Query: 59  SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLH 118
           S D E   +AK++ +  ++  +++   A A A+  +D+V+A   +  E Q +     +  
Sbjct: 82  SGDLEIARAAKQDADKAVAELQQARKDAMAEAQAHLDQVLAEEHKAAEQQMQEINARVTA 141

Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176
           ++++A+  + + + +A   +  I G+ T+ LV++L   V DA   +++ +K +   A 
Sbjct: 142 EIADAEKRVAEEKTRALSALKEIAGDTTQALVQRLTGIVPDA---QLVAQKVESASAH 196


>gi|78187938|ref|YP_375981.1| ATP synthase F0, subunit B [Chlorobium luteolum DSM 273]
 gi|123582422|sp|Q3B143|ATPF2_PELLD RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|78167840|gb|ABB24938.1| ATP synthase F0 subcomplex B subunit [Chlorobium luteolum DSM 273]
          Length = 175

 Score = 96.4 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/154 (24%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  I F +   +  +     + S +E R   I S  ++   AK E E+++    E
Sbjct: 18  PGLIFWTTITFVLVLIILKKIAWGPIISALEEREKGIQSSIDRAHGAKEESEAILRQNRE 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A A A  +I +    AE+      E   ++    +S A+ EI+  +++A  E+ + 
Sbjct: 78  LLAKADAEADRVIREGREYAEKIRAEITEKAHQESQKMISAAKEEIEQEKRRALAELRNE 137

Query: 142 VGEVTKDLVRKLGFSVSDAD-VQKILDRKRDGID 174
           V ++      K+   V DAD  +K++D     + 
Sbjct: 138 VADLAVRGAEKIIRGVLDADVQKKVVDSMIQDLS 171


>gi|99082432|ref|YP_614586.1| F0F1 ATP synthase subunit B' [Ruegeria sp. TM1040]
 gi|122397568|sp|Q1GDE2|ATPX_SILST RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|99038712|gb|ABF65324.1| H+-transporting two-sector ATPase B/B' subunit [Ruegeria sp.
           TM1040]
          Length = 181

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/146 (25%), Positives = 72/146 (49%)

Query: 10  SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK 69
           SS  P  D ST+ +Q FWL +   + Y +  R  LPR+++I+  R+  I++D    +  K
Sbjct: 19  SSGMPQLDFSTYGNQIFWLLVTLVVIYLILSRIALPRIAAILNERQGTITNDLAAAEDLK 78

Query: 70  REVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129
            +     ++Y ++LA ARA A+ I  +  A  +  ++      + ++  K + ++  I +
Sbjct: 79  AKAVEAENAYNKALADARAEAQRIAAETRAEIQAEVDEAIAKADAEISAKAAESEKAIAE 138

Query: 130 MQKKASQEVYSIVGEVTKDLVRKLGF 155
           ++  A + V  +  +    LV  LG 
Sbjct: 139 IRAGALESVKVVAADTASALVAALGG 164


>gi|319406085|emb|CBI79715.1| ATP synthase subunit b 1 (modular protein) [Bartonella sp. AR 15-3]
          Length = 210

 Score = 96.0 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 87/161 (54%), Gaps = 1/161 (0%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            S  FPPFD+  F S F WLAI FG FY    R I+PR+  ++E RR+ I SD ++    
Sbjct: 47  ASRVFPPFDSLYFASHFLWLAISFGFFYLFVSRIIVPRIGGVIETRRDRIVSDLDQAMRI 106

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K+E + +I  YE+ LA AR  AK +I       +   E QR+  E  L  KL +A+++I 
Sbjct: 107 KQETDIVIEIYEKKLAEARLEAKNMIQAANNEIKLKAELQRKKIEAVLEKKLEDAEDKIK 166

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDR 168
            +Q KA Q +  I  E+T ++++KL    +S   +   +  
Sbjct: 167 KIQDKAMQNINLIAEEITFEIIKKLIDVDISKKSISSAVKA 207


>gi|218679068|ref|ZP_03526965.1| F0F1 ATP synthase subunit B' [Rhizobium etli CIAT 894]
          Length = 205

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 1/152 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++T+ SQ  WL I F +FY +  + I PR+ +I++ R   +S D E
Sbjct: 35  AEGEHARGPFPPFDSTTYASQLLWLVITFSVFYLLMQKVIAPRIGAILDQRHTRLSQDLE 94

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE  LA ARA +  I      AA+   E  R   E  L  K+  A
Sbjct: 95  EAGRLKAEADAAVQTYEGELAAARAKSNAIGAAARDAAKLKAEEDRRAVEASLSEKIKAA 154

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +  I D++ KA  +V +I  E    +V +L  
Sbjct: 155 EVRIADIKAKAFADVGTIAEETAAAVVEQLIG 186


>gi|146343459|ref|YP_001208507.1| ATP synthase subunit B', membrane-bound, F0 sector [Bradyrhizobium
           sp. ORS278]
 gi|226698373|sp|A4Z2B6|ATPX_BRASO RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|146196265|emb|CAL80292.1| ATP synthase subunit B', membrane-bound, F0 sector [Bradyrhizobium
           sp. ORS278]
          Length = 191

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 46/172 (26%), Positives = 78/172 (45%), Gaps = 1/172 (0%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           ++ + ++    FPPF   TF SQ   L I F   Y +  R  LP++ ++++ R+  I  D
Sbjct: 18  SAHTEAEGGHGFPPFQKETFPSQIASLVIAFVALYVIVSRVALPKVGAVIDARQKSIDGD 77

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
             +    K E E+ + +YE  LA ARA A+ I  +       + E +R+  E  L  KL+
Sbjct: 78  LAEAQRLKDESEAAMKAYETELATARARAQAIGAETRDKLAASSEAERKALEDSLAAKLA 137

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV-SDADVQKILDRKRDG 172
            A+  I   +  A   V  I  +    +V++L     +   V+  +D    G
Sbjct: 138 AAETSIASTRATAMSNVRGIAADAASAIVQQLTGKAPAAKTVEAAVDASLKG 189


>gi|222147703|ref|YP_002548660.1| ATP synthase [Agrobacterium vitis S4]
 gi|221734691|gb|ACM35654.1| ATP synthase [Agrobacterium vitis S4]
          Length = 194

 Score = 95.6 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 55/164 (33%), Positives = 86/164 (52%), Gaps = 1/164 (0%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           + +      FPPFD STF SQ  WL I FG+FY +  R I+PR+  I+E R + I+ D +
Sbjct: 25  AEAGHGRGVFPPFDHSTFPSQLLWLVITFGLFYILMQRVIVPRVGGILENRHDRIAKDID 84

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE+ L  A+A   +I      AA+      R   E +L  K++ A
Sbjct: 85  EASRLKAEADAEVETYEKELIAAKAKGNQIASAAREAAKAKAAADRAAVEAELSSKVAAA 144

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKIL 166
           +  I  ++ KA  EV +I  E    +V +L G +V+ AD Q  +
Sbjct: 145 EASIAAIKTKAFAEVDTIATETVAAIVEQLTGANVTVADAQSAV 188


>gi|323136716|ref|ZP_08071797.1| H+transporting two-sector ATPase B/B' subunit [Methylocystis sp.
           ATCC 49242]
 gi|322398033|gb|EFY00554.1| H+transporting two-sector ATPase B/B' subunit [Methylocystis sp.
           ATCC 49242]
          Length = 197

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 2/174 (1%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           A    +     FPPF T  F  Q  WL +IFG+ Y +  R  LPR+  I+E R N I++D
Sbjct: 25  APGGEAHHEGLFPPFQTENFAPQLVWLVLIFGVLYILMSRLALPRVGGIIENRANKIAAD 84

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            +     + + ++  ++ +E+L + R  A+ I  +           QR + E     K+ 
Sbjct: 85  LDASRDMQAKAQAAAAANDENLRLRREEAQAIGREAQQKIANEAAAQRTLAETQAAEKIR 144

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA 175
            A+  I   + +A   V  I  +    ++ KL    +  DV K++   R  + +
Sbjct: 145 AAEERIASAKAQALGNVEQIAVDAAASIIEKLAG--AKVDVNKLVAEYRSAVKS 196


>gi|58039571|ref|YP_191535.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
 gi|58001985|gb|AAW60879.1| ATP synthase B' chain [Gluconobacter oxydans 621H]
          Length = 186

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 40/170 (23%), Positives = 75/170 (44%), Gaps = 2/170 (1%)

Query: 1   MASSSSSDFSSRFPPFDTS--TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58
           +A+      ++  P  +      + Q  W A+IFG FY    RF LPR+  ++  RR  I
Sbjct: 14  LAAVPGRAVAAGMPQLNFHDPLLIGQVVWGAVIFGGFYLALSRFALPRVERVLTNRRTRI 73

Query: 59  SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLH 118
            +D +    AK E +   +    +   A   A+  ++++ + A  N E       K L  
Sbjct: 74  QNDLDVARKAKAEADRASAELLSARHEAAEQARAHVERIQSEARANAEAHAAETAKRLEA 133

Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDR 168
           ++++A+  I   +++A   +  I    T+DLV +L  +  +  V   + R
Sbjct: 134 EIASAETRITQSREQALSSLSEIATSTTQDLVSRLIGTQDEQTVASAVKR 183


>gi|83941575|ref|ZP_00954037.1| ATP synthase F0, B' subunit [Sulfitobacter sp. EE-36]
 gi|83847395|gb|EAP85270.1| ATP synthase F0, B' subunit [Sulfitobacter sp. EE-36]
          Length = 183

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 77/165 (46%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +   P      F +Q FWL +     Y++  R  LPR+ +++  R+  I++D    + 
Sbjct: 19  GSAIGMPQLCIDWFGNQIFWLIVALVAIYFILSRVALPRIGAVLAERQGTITNDIAAAED 78

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K +     ++Y+++L  ARA A++II    A  + +L+      + ++  K + ++  I
Sbjct: 79  LKVKATEAEAAYDKALIDARAEAQQIIAAAKADIQADLDKAIAKADAEIAAKSAESEKAI 138

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            +++  A + V ++  +  + +V  +G S     +   +D +  G
Sbjct: 139 SEIRASAMENVEAVAKDTAEAIVAAVGGSADAKTISAAVDARMKG 183


>gi|110598590|ref|ZP_01386858.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031]
 gi|110339824|gb|EAT58331.1| ATP synthase F0, B subunit [Chlorobium ferrooxidans DSM 13031]
          Length = 175

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 66/152 (43%), Gaps = 1/152 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW A+ F I   +  +     + + +E R   I S  ++   AK E E+ +    E
Sbjct: 18  PGLIFWTAVTFVIVLLILKKVAWGPILTALEEREKGIQSSIDRAYHAKDEAEAALRKNSE 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A A + +II +    A++      E  + +    +S A++EI+  +++A  E+ + 
Sbjct: 78  LLAKADAESDKIIREGKDFADKLRTDITEKAQAEAQKMISMAKDEIEQEKRRALNELRTE 137

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDG 172
           V ++      K+   S+     +KI+D     
Sbjct: 138 VADLAVKGAEKIIRGSLDADLQKKIVDSMIQD 169


>gi|296446970|ref|ZP_06888905.1| H+transporting two-sector ATPase B/B' subunit [Methylosinus
           trichosporium OB3b]
 gi|296255537|gb|EFH02629.1| H+transporting two-sector ATPase B/B' subunit [Methylosinus
           trichosporium OB3b]
          Length = 194

 Score = 95.2 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/156 (27%), Positives = 71/156 (45%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
                  FPPFD + F  Q  WLA+IFG+ Y +  R  LPR+ SI+  R + I S+    
Sbjct: 27  EHHGGGDFPPFDVNNFAPQLVWLALIFGLLYVLMSRIALPRIGSILSDRESRIESNLSAS 86

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
              + + ++  + ++E+L   +A A+ I       A    + +R   E +   KL+ A  
Sbjct: 87  RELQTKAQAAAAEHDETLRATKAQAQAIGRDAQQQAASETQTRRSAQEAEFAKKLAEADA 146

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDAD 161
           +I   + +A   V  I  E    ++ KL  +   AD
Sbjct: 147 QISAAKAQALSHVEEIATEAAGSILEKLTGARIAAD 182


>gi|294676300|ref|YP_003576915.1| ATP synthase F0 subunit B' [Rhodobacter capsulatus SB 1003]
 gi|75498233|sp|O05332|ATPX_RHOCA RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|1934977|emb|CAA72983.1| FoF1 ATP synthase, subunit B [Rhodobacter capsulatus]
 gi|294475120|gb|ADE84508.1| ATP synthase F0, B' subunit [Rhodobacter capsulatus SB 1003]
          Length = 186

 Score = 94.8 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/163 (23%), Positives = 80/163 (49%)

Query: 10  SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK 69
               P  D STF +Q FWL +  G  YW+     +PR+++I+  R   IS D    +  K
Sbjct: 24  KGGMPQLDFSTFPNQIFWLLLALGAIYWLLKNIAIPRIAAILADRAGTISGDLAAAEQYK 83

Query: 70  REVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129
            + +   ++Y ++LA ARA A++II +  A  +++L+      + D+  +++ ++ +I +
Sbjct: 84  LKAKDAEAAYAKALADARAQAQKIIAETRAVIQKDLDAATAKADADIAARVAQSEVKIAE 143

Query: 130 MQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           ++  A + V  +  +    +V  LG       +   + ++  G
Sbjct: 144 IRAGALEAVQIVATDTATAIVTALGGKADMGALNAAVGQRVKG 186


>gi|260574858|ref|ZP_05842860.1| H+transporting two-sector ATPase B/B' subunit [Rhodobacter sp. SW2]
 gi|259022863|gb|EEW26157.1| H+transporting two-sector ATPase B/B' subunit [Rhodobacter sp. SW2]
          Length = 160

 Score = 94.8 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 77/160 (48%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  D ST+ +Q FWL +   + Y V  R  LPR+ +++  R   I++D    +  K++ 
Sbjct: 1   MPQLDFSTWANQIFWLVVTLVVIYLVLTRVALPRIGAVLAERNGTITNDLAAAEELKKKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
            +   SY+E+L  ARA A +I+    A  +++L+      + ++  K + ++  I +++ 
Sbjct: 61  VAAEKSYQEALTNARAEAAKIVAAAKADIQKDLDAAITRADAEIAAKAAESEKSISEIRA 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A Q V  +  +  +++V  LG       V   +  +  G
Sbjct: 121 GAVQSVTEVAQDTAREIVAALGGKADVRAVTAAVSARLKG 160


>gi|315122434|ref|YP_004062923.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495836|gb|ADR52435.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 175

 Score = 94.8 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 97/167 (58%), Positives = 131/167 (78%), Gaps = 1/167 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
            ++SSDFSS+FPPFDTSTFLSQFFWL +IFGIFYW+ HRF+LPRL+  M +R N ISSDQ
Sbjct: 1   MATSSDFSSKFPPFDTSTFLSQFFWLVVIFGIFYWIMHRFVLPRLAFGMILRHNQISSDQ 60

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
            KM++A  E+ SM +SYEE+LAIAR +AKEI+ K +  AEQNLE +R++FEKDLLH++S 
Sbjct: 61  SKMEAAVMELNSMTASYEEALAIARTNAKEIVQKAIIDAEQNLECKRKMFEKDLLHEISV 120

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDR 168
           AQ +I+  Q+K+ +E+ S+   +TKDL+ KL G S+SD D+   + +
Sbjct: 121 AQRKIESTQEKSLKELQSVSEGITKDLIHKLMGISISDVDIDVAMKK 167


>gi|110678646|ref|YP_681653.1| F0F1 ATP synthase subunit B' [Roseobacter denitrificans OCh 114]
 gi|123172763|sp|Q16AM6|ATPX_ROSDO RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|109454762|gb|ABG30967.1| ATP synthase F0, B' subunit [Roseobacter denitrificans OCh 114]
          Length = 176

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/152 (24%), Positives = 79/152 (51%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  +  S   P  D ST+ +Q FWL I   I Y V  +  LPR+++I+  R+  I++D  
Sbjct: 8   ADVAASSPGMPQLDFSTWGNQIFWLVITLVIIYMVLSKVALPRIAAILSERQGTITNDIA 67

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
             +  K + +   ++YE++LA ARA A+ I+ +  A  + +L+      + ++  K + +
Sbjct: 68  TAEDFKAKAKDAEAAYEKALADARAEAQRIVAEAKADIQSDLDVAISKADAEIAAKAAES 127

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +  I +++  A++ +  +  +  +++V   G 
Sbjct: 128 EKAIAEIRAGAAEAIQQVAKDTAQEIVATFGG 159


>gi|260432717|ref|ZP_05786688.1| ATP synthase B' chain [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416545|gb|EEX09804.1| ATP synthase B' chain [Silicibacter lacuscaerulensis ITI-1157]
          Length = 160

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 74/160 (46%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P      F +Q FWL I   + + V  R  LPR+++I+  R+  I++D    +  K + 
Sbjct: 1   MPQLCFDWFPNQIFWLVITLVVIFLVLSRVALPRIAAILAERQGTITNDLAAAEDLKAKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y ++LA ARA A+ I  +  A  + +L+      + ++  K + ++  I +++ 
Sbjct: 61  VEAEEAYNKALADARAEAQRIAAEARAEIQADLDDAIAKADAEIAAKAAESEKAIAEIRA 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A + +  +  +V  +LV  LG       +   ++ +  G
Sbjct: 121 GALESIQVVAKDVAAELVTALGGKADADAIAGAVEAQLKG 160


>gi|84515977|ref|ZP_01003338.1| ATP synthase F0, B' subunit [Loktanella vestfoldensis SKA53]
 gi|84510419|gb|EAQ06875.1| ATP synthase F0, B' subunit [Loktanella vestfoldensis SKA53]
          Length = 181

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 78/171 (45%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           A   +   +   P        +Q FWL +     ++V  R  LPR+ +++  R   I++D
Sbjct: 11  ACVDAGGSALGMPQLCAEWMPNQIFWLIVTLIAIFFVMSRIALPRIGAVLAERSGTITND 70

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
               +  K +     ++YE++L  ARA A+EII K  A  + +L+   +  +  +  K +
Sbjct: 71  IAAAEDFKNKAAEAETAYEQALTDARAKAQEIIAKAKAEIQADLDVALQKADAAIAAKAA 130

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            ++  I +++  A + +  +  +  K+LV  LG +     +   ++ +  G
Sbjct: 131 ESETAIGEIRDSAIKNITEVATDTAKELVLALGGTADATTITAAVNARMKG 181


>gi|83855052|ref|ZP_00948582.1| ATP synthase F0, B' subunit [Sulfitobacter sp. NAS-14.1]
 gi|83842895|gb|EAP82062.1| ATP synthase F0, B' subunit [Sulfitobacter sp. NAS-14.1]
          Length = 183

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 77/165 (46%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +   P      F +Q FWL +     Y++  R  LPR+ +++  R+  I++D    + 
Sbjct: 19  GSAIGMPQLCIDWFGNQIFWLIVALVAIYFILSRVALPRIGAVLAERQGTITNDIAAAED 78

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
            K +     ++Y+++L  ARA A++II    A  + +L+      + ++  K + ++  I
Sbjct: 79  LKVKATEAEAAYDKALIDARAEAQQIIAAAKADIQADLDKAIAKADAEIAAKSAESEKAI 138

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            +++  A + V ++  +  + +V  +G S     +   +D +  G
Sbjct: 139 SEIRASAMENVEAVAKDTAEAIVAAVGGSADAKTISAAVDARMKG 183


>gi|209966767|ref|YP_002299682.1| ATP synthase F0, B' subunit [Rhodospirillum centenum SW]
 gi|226698818|sp|B6IX46|ATPX_RHOCS RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|209960233|gb|ACJ00870.1| ATP synthase F0, B' subunit [Rhodospirillum centenum SW]
          Length = 204

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 36/139 (25%), Positives = 72/139 (51%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A+ ++       P  +  T+ +Q FWLA+ FG+  ++  +  LPR++ ++E R+  I+ 
Sbjct: 26  VAAETAEHAKGGLPQLNPDTYPTQIFWLAVTFGLLLFLMSKVALPRVAEVLEARQEKIAD 85

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D ++  + K E +++I +YE  LA ARA A++++     AAE     +      DL  + 
Sbjct: 86  DLDRAGALKAEADAVIENYERELAEARAKAQKVLSDATLAAESETTQRLGELAADLAERA 145

Query: 121 SNAQNEIDDMQKKASQEVY 139
             A+  I+  ++ A   + 
Sbjct: 146 RAAEARIEQARRAALGNIR 164


>gi|209548120|ref|YP_002280037.1| F0F1 ATP synthase subunit B' [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226698817|sp|B5ZS18|ATPX_RHILW RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|209533876|gb|ACI53811.1| H+transporting two-sector ATPase B/B' subunit [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 207

 Score = 94.5 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 1/152 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++T+ SQ  WL I F +FY +  + I PR+ +I++ R   +S D E
Sbjct: 37  AEGEHARGPFPPFDSTTYASQLLWLVITFSVFYLLMQKVIAPRIGAILDQRHTRLSQDLE 96

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           +    K E ++ + +YE  LA ARA +  I      AA+   E  R   E  L  K+  A
Sbjct: 97  EAGRLKAEADAAVQTYEGELAAARAKSNAIGAAARDAAKLKAEEDRRAVEASLSEKIKAA 156

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +  I D++ KA  +V +I  E    +V +L  
Sbjct: 157 EVRIADIKAKAFADVGTIAEETAAAVVEQLIG 188


>gi|227503865|ref|ZP_03933914.1| F0F1 ATP synthase subunit B [Corynebacterium striatum ATCC 6940]
 gi|227199488|gb|EEI79536.1| F0F1 ATP synthase subunit B [Corynebacterium striatum ATCC 6940]
          Length = 188

 Score = 94.5 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 78/177 (44%), Gaps = 4/177 (2%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A+   +  S  F       +    FW  I F +  W+  +F+LP  + +++ R + I  
Sbjct: 8   LAAGEENPGSGSFSVLLPKNYD--IFWSLICFVVILWLFWKFVLPAYNKMLQEREDRIEG 65

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             ++ ++ + E ++ +  Y   LA ARA A EI ++     +Q     +   E++    +
Sbjct: 66  GMKRAEAQQAEAKAALEKYNAQLADARAEAAEIREQARERGKQIEAEAKSQAEEESRRIV 125

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL--GFSVSDADVQKILDRKRDGIDA 175
           ++ + ++   + +   E+ S +G+ + +L  KL  G   S       +D     +D+
Sbjct: 126 ASGEKQLQASRAQVISELRSEIGQNSINLAEKLLGGELSSATKQSSTIDTFLSELDS 182


>gi|284046070|ref|YP_003396410.1| ATP synthase F0 B subunit [Conexibacter woesei DSM 14684]
 gi|283950291|gb|ADB53035.1| ATP synthase F0, B subunit [Conexibacter woesei DSM 14684]
          Length = 194

 Score = 94.1 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  + F +   V  ++  P+++ I++ R+  I    +  D  ++E + +++ Y +
Sbjct: 31  PGLMIWTLLAFVVALLVLRKYAWPQITRILDQRQQQIEESIDAADRTRQEADELLAEYRQ 90

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  ARA A EI+ K   A E       +  +      L   + +I     +A QE+   
Sbjct: 91  RLTDARAQADEIVAKAERAGEVAEREGLDAAKVKREELLEQTRRDIQAETNRAIQEIRRE 150

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
           V ++T     K+    +S  D +++++     +D
Sbjct: 151 VADLTVQATEKVTRKTLSPDDQKRLVEEALSELD 184


>gi|144898767|emb|CAM75631.1| ATP synthase B' chain [Magnetospirillum gryphiswaldense MSR-1]
          Length = 164

 Score = 94.1 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 37/161 (22%), Positives = 73/161 (45%), Gaps = 1/161 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD + F  Q FWLA+ F   Y +  +  LP++ ++++ R+  I  + +K    K E 
Sbjct: 1   MPQFDPAFFAPQLFWLAVTFITLYVLMAKVALPKIGAVLDERQRKIDDNLDKAAQLKAEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+ +++YE++L+ +RAHA  +I +      +  E +       L  ++   +  I   + 
Sbjct: 61  EAAVAAYEKALSESRAHAHSVIKEASERLSKQAEERTRDLSAKLAQQIKAGEARIAAAKD 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDG 172
            A   V  +  +V    V +L G +   A ++  +      
Sbjct: 121 AALTNVREVALDVAGATVSRLVGGNADQAKLEAAVASALKE 161


>gi|227501701|ref|ZP_03931750.1| F0F1 ATP synthase subunit B [Corynebacterium accolens ATCC 49725]
 gi|306835878|ref|ZP_07468873.1| ATP synthase F0 sector subunit B [Corynebacterium accolens ATCC
           49726]
 gi|227077726|gb|EEI15689.1| F0F1 ATP synthase subunit B [Corynebacterium accolens ATCC 49725]
 gi|304568243|gb|EFM43813.1| ATP synthase F0 sector subunit B [Corynebacterium accolens ATCC
           49726]
          Length = 189

 Score = 93.7 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 77/153 (50%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  + F +  W+  +F+LPR + ++E R + I    ++ ++ + E ++ +  Y   LA
Sbjct: 31  IFWSLLCFIVILWLFWKFVLPRYTKLLEEREDRIEGGMKRAEAQQAEAKAALEKYNAQLA 90

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI ++     +Q     +   E++    ++N + +++  + +   E+ S +G+
Sbjct: 91  DARAEAAEIREQARERGKQIEADAKSQAEEESRRIVANGEKQLEASRAQVVTELRSEMGQ 150

Query: 145 VTKDLVRKL-GFSVSDADVQ-KILDRKRDGIDA 175
            + +L  K+ G  +SDA  +   +D     +D+
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDS 183


>gi|284992520|ref|YP_003411074.1| ATP synthase F0 subunit B [Geodermatophilus obscurus DSM 43160]
 gi|284065765|gb|ADB76703.1| ATP synthase F0, B subunit [Geodermatophilus obscurus DSM 43160]
          Length = 195

 Score = 93.7 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/177 (20%), Positives = 78/177 (44%), Gaps = 8/177 (4%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           M + ++   +   PP      + +     I F I ++V  +F+ PR   +   RR  I  
Sbjct: 1   MRTLAAESANPLLPP------VGEIIIGTITFAIAFFVLGKFVWPRFEQVFRARREAIEG 54

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             E+ +S + E ++ +  Y   LA AR  A +I D+  A  +Q LE  R   +++    +
Sbjct: 55  GIERAESMQAEAKAALEQYRAQLAEARTEAAQIRDQARAEGQQILEELRAQAQEESARIV 114

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQK--ILDRKRDGIDA 175
           +  + ++   +++   E+   +G +  DL  ++     +   ++   +DR  D +D 
Sbjct: 115 ARGEEQLATSRQQVVNELRGQIGRLAVDLAGRVVGESLEDQARRSGTVDRFLDQLDG 171


>gi|227487989|ref|ZP_03918305.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227542631|ref|ZP_03972680.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227092080|gb|EEI27392.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227181829|gb|EEI62801.1| F0F1 ATP synthase subunit B [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 195

 Score = 93.7 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  + F +  +V  +F+LP+   ++  R +LI    ++ ++A+ E +  +  Y   LA
Sbjct: 37  IFWSLVAFLVILFVFWKFVLPKFQEVLSEREDLIKGGIQRAEAAQAEAKQALEKYNSQLA 96

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A++I ++     EQ     R    ++    +   + ++   +++   E+   +G 
Sbjct: 97  EARAEAQQIREEARERGEQIKAEMRAQAAEESNRIIEAGEKQLAAQREQVVSELRRDMGR 156

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
            + DL  +L       D      +D+    +D
Sbjct: 157 NSVDLAERLLGQQLSDDLTRSGTIDKFLADLD 188


>gi|329850279|ref|ZP_08265124.1| ATP synthase B' chain [Asticcacaulis biprosthecum C19]
 gi|328840594|gb|EGF90165.1| ATP synthase B' chain [Asticcacaulis biprosthecum C19]
          Length = 226

 Score = 93.7 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 64/153 (41%), Gaps = 2/153 (1%)

Query: 1   MASSSSSDF--SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58
           +A++  ++   S   P   T  +  Q  WL IIF +FY +      PRL  ++  R + I
Sbjct: 54  VATTEHTEEHGSGGLPQLQTEHWAGQIVWLLIIFAVFYALMATVFTPRLRKVISNRGSTI 113

Query: 59  SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLH 118
           + D     + + E E+         A A A  +++  + +A +   +  Q    +  L  
Sbjct: 114 AEDLANARANRDEAEAQAKDAAAETAAAHAAGRKLASEALARSNAEIAEQTAAEDAKLNT 173

Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVR 151
           +LS A+  I   +  A   V  I GE  + LV 
Sbjct: 174 RLSEAEARIRAARDTAMAHVTDIAGETAQALVE 206


>gi|119358471|ref|YP_913115.1| ATP synthase F0, B subunit [Chlorobium phaeobacteroides DSM 266]
 gi|226741357|sp|A1BJW4|ATPF_CHLPD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119355820|gb|ABL66691.1| ATP synthase F0 subcomplex B subunit [Chlorobium phaeobacteroides
           DSM 266]
          Length = 175

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 63/154 (40%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  + F I   +  +     + S +E R   I S  ++   AK E E ++    E
Sbjct: 18  PGLIFWTTVSFVIVLLILRKLAWGPIISALEEREKGIQSSIDRAHKAKDEAEEILRKNRE 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A A + +II +     E+      E  + +    +S A+ EI+  +++A   + + 
Sbjct: 78  LLAKADAESDKIIREGKEYGEKLRAGIAEKAQAEAAKMISMAKEEIEQEKRRALDVLRNE 137

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
           V E+      K+   S+     +KI+D     + 
Sbjct: 138 VAELAVMGAEKIIKTSLDADMQKKIVDSMIQDLS 171


>gi|90426285|ref|YP_534655.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
 gi|122474862|sp|Q20X00|ATPX_RHOPB RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|90108299|gb|ABD90336.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodopseudomonas
           palustris BisB18]
          Length = 188

 Score = 93.7 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 76/171 (44%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +++     + FPPF   TF SQ   L I F   Y +  +  LPR+ S+++ R   I  D 
Sbjct: 15  TAADGGHKAPFPPFQKDTFASQLVSLLIAFVALYLIVSKIALPRVGSVLDERAKRIEDDF 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E +  + +YE  LA ARA A+ I  +         E +R+  E+ L  KL+ 
Sbjct: 75  AAAQRLKGESDDALKAYETELAQARARAQAIGAETRERLNAASEAERKSLEEKLAVKLAE 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD-ADVQKILDRKRDG 172
           A+  I   ++ A   V  I  +    +V++L   V D   + + +D    G
Sbjct: 135 AEKTIAATRETAMSNVRGIAADAAAAIVQQLSGLVPDGKALDRAVDATLKG 185


>gi|294506921|ref|YP_003570979.1| ATP synthase B chain [Salinibacter ruber M8]
 gi|294343249|emb|CBH24027.1| ATP synthase B chain [Salinibacter ruber M8]
          Length = 194

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW  + F IF ++ +RF    ++  +E R   I    ++ + A  E +++ +  EE
Sbjct: 39  VGLIFWKTVAFLIFLYILYRFGWGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEE 98

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +   A   A++I+ +   +AE+  E ++    +++      AQ EI+  ++ A QE+   
Sbjct: 99  ARREAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDE 158

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDG 172
           V ++  +  +K+    +     ++++D   D 
Sbjct: 159 VADLAIEAAQKIIENDLDADRHRQLVDDALDD 190


>gi|149201373|ref|ZP_01878348.1| H+-transporting two-sector ATPase, B/B' subunit [Roseovarius sp.
           TM1035]
 gi|149145706|gb|EDM33732.1| H+-transporting two-sector ATPase, B/B' subunit [Roseovarius sp.
           TM1035]
          Length = 177

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 35/170 (20%), Positives = 78/170 (45%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++  +  +   P  D +TF +Q FWL +   + Y+V  R  LPR+++++  R+  I++D 
Sbjct: 8   AAGQAASTPGLPQLDFTTFGNQIFWLLVTLVVIYFVLSRIALPRIAAVLAERQGAITNDL 67

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
              +  K +      +Y ++LA AR  A+ I+ +  A  +  L+      + ++  + + 
Sbjct: 68  AAAEDLKVKAVEAEQAYLKALADARTEAQTIVGQAKAEIKAELDAATAKADAEIAARAAE 127

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            + +I D++  A   V  +      ++V  +G    +  V   +  +  G
Sbjct: 128 GEKKIADIRATAMDSVKEVAVAAAAEIVAVMGGKADEKTVGAAVADRMKG 177


>gi|75674435|ref|YP_316856.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           winogradskyi Nb-255]
 gi|123614285|sp|Q3SW37|ATPX_NITWN RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|74419305|gb|ABA03504.1| H+-transporting two-sector ATPase, B/B' subunit [Nitrobacter
           winogradskyi Nb-255]
          Length = 185

 Score = 93.3 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 47/171 (27%), Positives = 78/171 (45%), Gaps = 1/171 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + +     + FPPF   TF SQ   L I F   Y ++ R  LPR+   ++ R N I  D 
Sbjct: 15  TEADGGHKAPFPPFQKETFASQLVSLTIAFVALYLISSRLALPRVRQTIDDRENTIKGDL 74

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
            +    K + ++ + +YE  LA ARA A+ I ++         E +R+  E+ L  KL++
Sbjct: 75  AQAQKLKDDSDAALKAYEAELAAARARAQAIGNETREKLNAAAEAERKALEERLSVKLAD 134

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDAD-VQKILDRKRDG 172
           A+  I   +  A   V  I  +    +V++L  +  D+  V   +D    G
Sbjct: 135 AEKTIASTRAAAMSNVRGIASDAATAIVQQLTGATPDSKLVDSAVDASMKG 185


>gi|83945331|ref|ZP_00957679.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
 gi|83851165|gb|EAP89022.1| ATP synthase subunit B [Oceanicaulis alexandrii HTCC2633]
          Length = 181

 Score = 92.9 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/149 (32%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD + F SQ FWLAI F + Y +  RF+LPR+   +E RR+ I+ D +     K + 
Sbjct: 22  FPPFDPTYFASQLFWLAISFIVLYVLLSRFVLPRIGGAIEERRDRIADDLDTAAQLKAQA 81

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           +  + +YE+SLA ARA A  +  +  AAA+  +       + +L  +++ +++ I   + 
Sbjct: 82  DETVRAYEKSLADARAKAHSVAAEAKAAADAEIADAIRKADAELEAQMAESEDRIRASRD 141

Query: 133 KASQEVYSIVGEVTKDLVRKLGF-SVSDA 160
            A  EV +I        V  L    VS++
Sbjct: 142 AALGEVRTIAAGAAVVAVEHLAGLEVSES 170


>gi|332559510|ref|ZP_08413832.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
 gi|332277222|gb|EGJ22537.1| F0F1 ATP synthase subunit B [Rhodobacter sphaeroides WS8N]
          Length = 180

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 75/160 (46%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  +   + +Q FWL +     Y++  R  LPR+ +++  RR  I++D    +  K++ 
Sbjct: 21  MPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLAERRGTITNDLAAAEELKQKA 80

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y E+LA ARA A+ I+ +  AA +  L+      + ++  K + ++  I +++ 
Sbjct: 81  VLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATSKADAEISAKSAESEARIAEIRA 140

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A Q V  +  +  + LV  LG     A V   +  +  G
Sbjct: 141 GALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG 180


>gi|296114243|ref|ZP_06832898.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979319|gb|EFG86042.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 204

 Score = 92.9 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/157 (22%), Positives = 66/157 (42%), Gaps = 2/157 (1%)

Query: 1   MASSSSSDFSSRFPPFDTS--TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58
           MA  +    +   P  D      + Q  W A IF I Y +  R  LP++  ++ +RR  I
Sbjct: 27  MAMVAPGARAEGMPQLDFGNPYVIGQVVWGAGIFLILYLLLSRSALPKVEKVLSLRRQTI 86

Query: 59  SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLH 118
            +D E    AK   +  ++   ++   A A A+  +DKVV  A    E Q +     L  
Sbjct: 87  ENDLEIAHKAKSRADDAVAELRQARKDAMAEAQANVDKVVEEARAAAEKQAQEMNTRLGA 146

Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           ++  A+  +   ++ A   +  I  +  + L+ ++  
Sbjct: 147 EIREAEARVALARETALGSLRQISTDTAEALIHQISG 183


>gi|77464617|ref|YP_354121.1| F0F1 ATP synthase subunit B' [Rhodobacter sphaeroides 2.4.1]
 gi|126463457|ref|YP_001044571.1| F0F1 ATP synthase subunit B' [Rhodobacter sphaeroides ATCC 17029]
 gi|221640529|ref|YP_002526791.1| F0F1 ATP synthase subunit B' [Rhodobacter sphaeroides KD131]
 gi|123590920|sp|Q3IZ14|ATPX_RHOS4 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|226698820|sp|A3PN83|ATPX_RHOS1 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|77389035|gb|ABA80220.1| FoF1 ATP synthase, subunit B [Rhodobacter sphaeroides 2.4.1]
 gi|126105121|gb|ABN77799.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|221161310|gb|ACM02290.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides KD131]
          Length = 180

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 39/160 (24%), Positives = 75/160 (46%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  +   + +Q FWL +     Y++  R  LPR+ +++  RR  I++D    +  K++ 
Sbjct: 21  MPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLAERRGTITNDLAAAEELKQKA 80

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y E+LA ARA A+ I+ +  AA +  L+      + ++  K + ++  I +++ 
Sbjct: 81  VLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATAKADAEISAKSAESEARIAEIRA 140

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A Q V  +  +  + LV  LG     A V   +  +  G
Sbjct: 141 GALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG 180


>gi|194337849|ref|YP_002019643.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1]
 gi|226694332|sp|B4SH38|ATPF_PELPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|194310326|gb|ACF45026.1| ATP synthase F0, B subunit [Pelodictyon phaeoclathratiforme BU-1]
          Length = 175

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 36/154 (23%), Positives = 69/154 (44%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW AI F I   +  +     +   +E R   I S  ++  SAK E E+++    E
Sbjct: 18  PGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAHSAKEESEAILRKNRE 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A A + +II +    A++      E  + +    ++ A++EI+  +++A   + + 
Sbjct: 78  LLAKADAESDKIIREGKDYADKLRADITEKAQSEAKKMIATAKDEIEQEKRRALDVLRNE 137

Query: 142 VGEVTKDLVRKLGFSVSDAD-VQKILDRKRDGID 174
           V ++      K+  +  DAD  +KI+D     + 
Sbjct: 138 VADLAVKGAEKIIKTTLDADMQKKIVDSMIQDLS 171


>gi|300933620|ref|ZP_07148876.1| F0F1 ATP synthase subunit B [Corynebacterium resistens DSM 45100]
          Length = 186

 Score = 92.5 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I   V  +F+LP+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 28  VVWSLIPFVIILLVFWKFVLPKFQEVLNQREDQIEGGMQRAEAAQAEAQAALEKYNAQLA 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D      ++ +   +    ++    + +   +++  +     ++   +GE
Sbjct: 88  EARTEAAQIRDDARNQGQKIIADMKAQATEESARIVESGNKQLEAQRSAVVSDLRKEMGE 147

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGIDA 175
            +  L  +L       DV++   +D     +D+
Sbjct: 148 NSISLAERLLGEQLSDDVKRSGTIDNFLADLDS 180


>gi|145220542|ref|YP_001131251.1| ATP synthase F0, B subunit [Prosthecochloris vibrioformis DSM 265]
 gi|226694438|sp|A4SGZ0|ATPF_PROVI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145206706|gb|ABP37749.1| ATP synthase F0 subcomplex B subunit [Chlorobium phaeovibrioides
           DSM 265]
          Length = 175

 Score = 92.2 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/160 (20%), Positives = 67/160 (41%), Gaps = 3/160 (1%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            D +      FW AI F +   +  +     +   +E R   I S  ++   AK E E++
Sbjct: 14  LDPN--PGLIFWTAITFVLVLLILKKIAWGPILGALEEREKGIQSSIDRAYGAKEEAEAI 71

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
           +   +E+LA A A +  II +    A++      E    +    +  A++EI+  +++A 
Sbjct: 72  LRQNKETLAKAEAESDRIIREGREFADKIRAEITEKAHTESQKMIGAAKDEIEQEKRRAL 131

Query: 136 QEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
             + + V ++      K+   S+     +K++D     + 
Sbjct: 132 DVLRNEVADLAVRGAEKIIRASLDGEVQRKVVDSMIADLS 171


>gi|189347958|ref|YP_001944487.1| F0F1 ATP synthase subunit B [Chlorobium limicola DSM 245]
 gi|226741334|sp|B3EIJ6|ATPF_CHLL2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189342105|gb|ACD91508.1| ATP synthase F0, B subunit [Chlorobium limicola DSM 245]
          Length = 175

 Score = 92.2 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 68/153 (44%), Gaps = 1/153 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW A+ F I   +  +     + S +E R   I S  ++  SAK E E+++    +
Sbjct: 18  PGLIFWTAVTFVIVLLILKQLAWGPIISALEEREKGIQSSIDRAYSAKDEAEAILRKNRD 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A   ++ II +     E+  +   E  + +    +++A++EI+  +++A   + + 
Sbjct: 78  MLAKADLESERIIREGKEYGEKLRQEMAEKAQFEAKKMIASAKDEIEQEKRRALDVLRNE 137

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           V ++      K+   S+     +KI+D     +
Sbjct: 138 VADLAIMGAEKIIKSSLDADTQKKIVDSMIRDL 170


>gi|21672860|ref|NP_660925.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
 gi|81860150|sp|Q8KGE9|ATPF_CHLTE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21645909|gb|AAM71267.1| ATP synthase F0, B subunit [Chlorobium tepidum TLS]
          Length = 175

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW A+ F I   +  +     + S++E R   I S  ++  +AK E E+++    +
Sbjct: 18  PGLIFWTALTFLIVLVILRKTAWGPILSMLEERAKSIQSAIDRAHTAKDEAEAILKKNRD 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A A A +II +    A++      E    +    +++A+ EI+  +++A   + + 
Sbjct: 78  LLAKADAEADKIIREAKEVADKLRADLTEKAHDESRKIIASAKEEIEQEKRRALDVLRNE 137

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           V ++      K+   ++     + +++     + A
Sbjct: 138 VADMAVKGAEKIIRTTLDADKQKAVVNDMIKEMAA 172


>gi|255324523|ref|ZP_05365640.1| ATP synthase F0, B subunit [Corynebacterium tuberculostearicum
           SK141]
 gi|255298429|gb|EET77729.1| ATP synthase F0, B subunit [Corynebacterium tuberculostearicum
           SK141]
          Length = 189

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 73/153 (47%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  + F +   +  + +LP+ + +++ R + I     +  + + E ++ +  Y   LA
Sbjct: 31  IFWSLLCFIVILLLFWKLVLPKYTKMLQEREDRIEGGLNRAKAQQAEAKAALEKYNAQLA 90

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI ++     +Q     +   E++    ++N + +++  + +   E+ S +G+
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTNAEEESRRIVANGEKQLEASRSQVVTELRSEMGQ 150

Query: 145 VTKDLVRKL-GFSVSDADVQ-KILDRKRDGIDA 175
            + +L  K+ G  +SDA  +   +D     +D+
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDS 183


>gi|114798353|ref|YP_760622.1| ATP synthase F0 subunit B family protein [Hyphomonas neptunium ATCC
           15444]
 gi|114738527|gb|ABI76652.1| ATP synthase F0, B subunit family protein [Hyphomonas neptunium
           ATCC 15444]
          Length = 179

 Score = 91.8 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/170 (28%), Positives = 79/170 (46%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++     ++ FPPF+T    SQ FWLA++F   Y    RFILP++S  +E R N ++SD 
Sbjct: 9   TAIPGAEAAAFPPFETWHMPSQLFWLAVLFTALYIALSRFILPKMSDTIEKRANRVASDL 68

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           ++      +      + E  LA ARA A++  +K     E  L  +    + DL  KL  
Sbjct: 69  DEAARLNNQAIEAQKALELRLAQARAKARDTAEKAREKTEAELASETARVDADLAKKLET 128

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
           A   I  ++  A   V  I  +    ++ + G   S AD++K +    + 
Sbjct: 129 ADARISKLRADAMTNVEQIAVDTADAMIARFGVKASPADLKKAVSAALEQ 178


>gi|229819798|ref|YP_002881324.1| ATP synthase F0, B subunit [Beutenbergia cavernae DSM 12333]
 gi|229565711|gb|ACQ79562.1| ATP synthase F0, B subunit [Beutenbergia cavernae DSM 12333]
          Length = 200

 Score = 91.8 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  ++  I  +  +R+++P++++I++ R   I    E     + E +      E  LA
Sbjct: 28  IVWSLVVTVIIAFFVYRYLMPKMTAILDERSAKIEGGLEHAAKVQAEADKAREEQEAVLA 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A  I ++        +   R   + +    + +AQ +ID  +++A   + S VG 
Sbjct: 88  EARGEAARIREEAQGDGAAIVAEARGRAQAEANRIVESAQRQIDAERQQAVVSLRSEVGT 147

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +  +L  ++       DA   +++DR  + +D+
Sbjct: 148 LATELASRIVGESLADDARQSRLIDRFLEELDS 180


>gi|114570753|ref|YP_757433.1| H+-transporting two-sector ATPase subunit B/B' [Maricaulis maris
           MCS10]
 gi|122314862|sp|Q0AK33|ATPF1_MARMM RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|114341215|gb|ABI66495.1| H+-transporting two-sector ATPase, B/B' subunit [Maricaulis maris
           MCS10]
          Length = 189

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 57/174 (32%), Positives = 84/174 (48%), Gaps = 1/174 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +++    S  FPPFD + F SQ FWL I F I Y    R ILP++ + +E RR+ I+ D 
Sbjct: 16  AAADHADSGVFPPFDPTYFASQLFWLTIAFVILYIALDRLILPKIKTTIEDRRDRIADDL 75

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           +    AK + E+   +YE+SLA AR  A  +  K     +  +  +    E +L  K   
Sbjct: 76  DAAAQAKADAEAAGEAYEKSLAEARNKAHALAAKTRQTLDAEIAKETAAVEAELSAKQEA 135

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           ++  I   + KA  EV  I    T  +V  L G  VS+AD  K +D      +A
Sbjct: 136 SEAAIRKAKDKAFAEVRGIAATATAAVVSALAGVEVSEADAGKTVDGLIKAKEA 189


>gi|89053260|ref|YP_508711.1| F0F1 ATP synthase subunit B' [Jannaschia sp. CCS1]
 gi|122499468|sp|Q28UC6|ATPX_JANSC RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|88862809|gb|ABD53686.1| H+-transporting two-sector ATPase B/B' subunit [Jannaschia sp.
           CCS1]
          Length = 193

 Score = 91.4 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 67/146 (45%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            S   P  D +TF +Q FWL +     Y+V  +  LPR+SS++  R+  +++D    +  
Sbjct: 28  SSPGMPQLDFATFPNQIFWLVLTLLAIYFVLTKIALPRISSVIAERQGTLTNDLAAAEDL 87

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           KR+      SY  +LA ARA A  I  +     +   + + +  +  +  + +  +  I 
Sbjct: 88  KRQAAEAEESYNTALANARAEASRIAQETRDEIQAQTQVEIDKADAQIAARTAEGEARIA 147

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLG 154
           +++  A      +  +V  ++VR  G
Sbjct: 148 EIEAGAIATAEEVARDVATEIVRAFG 173


>gi|68536424|ref|YP_251129.1| F0F1 ATP synthase subunit B [Corynebacterium jeikeium K411]
 gi|260577557|ref|ZP_05845496.1| ATP synthase F0, B subunit [Corynebacterium jeikeium ATCC 43734]
 gi|123650711|sp|Q4JUJ6|ATPF_CORJK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68264023|emb|CAI37511.1| ATP synthase B chain [Corynebacterium jeikeium K411]
 gi|258604281|gb|EEW17519.1| ATP synthase F0, B subunit [Corynebacterium jeikeium ATCC 43734]
          Length = 186

 Score = 91.4 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 67/152 (44%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F +  +V  +F+LP+   ++  R + I     + +SA+ E ++ +  Y   LA
Sbjct: 28  IVWSIIPFAVILFVFWKFVLPKFQEVLNQREDQIEGGIRRAESAQAEAKAALEKYNAQLA 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   +  ++ +   +    ++    + +   +++  +     ++   +GE
Sbjct: 88  EARTEAAQIRDDARSQGQKIIADMKAQATEESNRIVESGHKQLEAQRSAVVTDLRKEMGE 147

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L  +L       DV++   +D    G+D
Sbjct: 148 NSINLAERLLGEQLSDDVKRSGTIDNFLAGLD 179


>gi|324997448|ref|ZP_08118560.1| ATP synthase F0 subunit B [Pseudonocardia sp. P1]
          Length = 181

 Score = 91.4 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 62/149 (41%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I  +V  +F +PR  ++ E R + I    ++    + + + +   YE+ LA  RA
Sbjct: 24  IVAFAILLFVLWKFAVPRFETLYEERTDAIEGGLKRAQETQEQADRLKKEYEDQLAGLRA 83

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  I D   A  +Q     RE  E++     +  + ++   +  A + + + VG ++  
Sbjct: 84  EAARIRDDARAEGQQIKAELREEAEQEAARIRTRGEEQVSAARDAAQRALRNEVGGLSVQ 143

Query: 149 LVRKLGFS--VSDADVQKILDRKRDGIDA 175
           L  +L       D+     +D     +D 
Sbjct: 144 LAERLLREQLTDDSRRSSTIDSFLGELDQ 172


>gi|217979917|ref|YP_002364064.1| H+transporting two-sector ATPase B/B' subunit [Methylocella
           silvestris BL2]
 gi|217505293|gb|ACK52702.1| H+transporting two-sector ATPase B/B' subunit [Methylocella
           silvestris BL2]
          Length = 183

 Score = 91.4 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 48/147 (32%), Positives = 81/147 (55%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
           FPPFD+S F S   WLAI FG+ Y++  +  LPR+  I+  R+  I+SD E+   A+ + 
Sbjct: 24  FPPFDSSNFSSTLIWLAISFGLLYYLLSKIALPRVEGILNTRQGKITSDLEEAHRAREKS 83

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E   + +E+++A ARA A+ +  +  A      + +R   E +L  KL++A+ +I + + 
Sbjct: 84  EQAAAEHEKTIASARAKAQALAQEAQAKINAENDAKRHALESNLAGKLADAEKQIVETKS 143

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSD 159
           KA   V +I  E    +V +L    +D
Sbjct: 144 KAMANVETIAAEAASAIVERLTGRPAD 170


>gi|311740607|ref|ZP_07714434.1| ATP synthase F0 sector subunit B [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304127|gb|EFQ80203.1| ATP synthase F0 sector subunit B [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 189

 Score = 91.4 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 74/153 (48%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  + F +   +  + +LP+ + +++ R + I    ++  + + E ++ +  Y   LA
Sbjct: 31  IFWSLLCFIVILLLFWKLVLPKYTKMLQEREDRIEGGLKRAKAQQAEAKAALEKYNAQLA 90

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI ++     +Q     +   E++    ++N + +++  + +   E+ S +G+
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTNAEEESRRIVANGEKQLEASRSQVVTELRSEMGQ 150

Query: 145 VTKDLVRKL-GFSVSDADVQ-KILDRKRDGIDA 175
            + +L  K+ G  +SDA  +   +D     +D+
Sbjct: 151 NSINLAEKILGGELSDASKKSSTIDGFLSELDS 183


>gi|319408194|emb|CBI81847.1| ATP synthase, B' chain [Bartonella schoenbuchensis R1]
          Length = 193

 Score = 91.0 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 90/151 (59%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           +    +  FPPFD   F S  FWLAI FG FY    R I+PR+ +++E RR+ I+SD ++
Sbjct: 21  AVEHANRVFPPFDFVHFSSHLFWLAISFGFFYLFIARVIVPRIGNVIETRRDRIASDLDQ 80

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
               K+E +++I  YE+ LA AR  A+ ++ +     ++  + +R+  EK L  KL+ A 
Sbjct: 81  AMRMKQEADTVIEVYEKKLAEARLQARIVVQEARDKIKEKADLERKEVEKKLEKKLATAG 140

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           ++I +++ KA Q V  I  EVT+++V+KL  
Sbjct: 141 DQIAEIRDKAMQNVGLIAEEVTREIVKKLLD 171


>gi|148252427|ref|YP_001237012.1| ATP synthase subunit B', membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
 gi|226698372|sp|A5EAB2|ATPX_BRASB RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|146404600|gb|ABQ33106.1| ATP synthase subunit B', membrane-bound, F0 sector [Bradyrhizobium
           sp. BTAi1]
          Length = 186

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 1/172 (0%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           ++ + ++    FPPF   TF SQ   L I F   Y +  R  LP++  +++ R+  I  D
Sbjct: 13  SAHTEAEGGHGFPPFQKETFPSQIVSLVITFVALYVIVSRLALPKVGGVIDARQKAIDGD 72

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
             +      E E+ + +YE  LA ARA A+ I  +       + + +R+  E  L  KL+
Sbjct: 73  LAEAQRLNDESEAAMKAYESELAAARARAQAIGAETREKLAASSDAERKALEDSLAAKLA 132

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD-ADVQKILDRKRDG 172
            A+  I   +  A   V  I  +    +V++L         V+  +D    G
Sbjct: 133 AAEKSIATTRATAMSNVRGIAADAASAIVQQLTGKAPAGKTVEAAVDASLKG 184


>gi|84684305|ref|ZP_01012207.1| FoF1 ATP synthase, subunit B [Maritimibacter alkaliphilus HTCC2654]
 gi|84668058|gb|EAQ14526.1| FoF1 ATP synthase, subunit B [Rhodobacterales bacterium HTCC2654]
          Length = 160

 Score = 91.0 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/160 (23%), Positives = 81/160 (50%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  + STF +Q FWL +   I ++V  +  LPR++ ++  R+  I++D    +  K++ 
Sbjct: 1   MPQLEFSTFGNQIFWLVVALVIIFFVLSKIALPRIAGVLAERQGTITNDLAAAEELKQKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y+++LA ARA A +I+    A  + +L+  +   + ++  K + ++  I +++ 
Sbjct: 61  VDAEEAYKKALADARAEANKIVADAKAEIQSDLDAAQAKADAEIAAKTAESEKAISEIRA 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A +    +  + TK+++  +GFS     V   +  +  G
Sbjct: 121 GALESATEVAKDTTKEILAAMGFSADAKTVDAAVSERIKG 160


>gi|326382090|ref|ZP_08203783.1| F0F1 ATP synthase subunit B [Gordonia neofelifaecis NRRL B-59395]
 gi|326199516|gb|EGD56697.1| F0F1 ATP synthase subunit B [Gordonia neofelifaecis NRRL B-59395]
          Length = 184

 Score = 90.6 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 33/163 (20%), Positives = 73/163 (44%), Gaps = 4/163 (2%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P     +     W  + F +  +V  +F++P+   +++ R + I     + ++A+ E   
Sbjct: 17  PLLPEWYD--ITWSLVAFAVVLFVFWKFVIPKYRKVLDERHDTIEGGIARAEAAQAEAAQ 74

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
            +++Y E LA AR  A  I D+      Q +   +     +    ++N   ++D  +++ 
Sbjct: 75  QLAAYREQLAGAREEAAAIRDEARTQGAQIVSDMKAQASTESDRIIANGNAQLDAQRQQV 134

Query: 135 SQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGIDA 175
             E+   +G+++ DL  KL  +    DV++   +DR    +D 
Sbjct: 135 VSELRGDLGKLSVDLAEKLVGASLSDDVKQAGTVDRFLAELDG 177


>gi|310814622|ref|YP_003962586.1| ATP synthase F0, B' subunit [Ketogulonicigenium vulgare Y25]
 gi|308753357|gb|ADO41286.1| ATP synthase F0, B' subunit [Ketogulonicigenium vulgare Y25]
          Length = 169

 Score = 90.6 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 77/165 (46%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
              +  P  +T+ + +  FW  +     Y++  R  LPR+ S++  R   + +D    + 
Sbjct: 5   AVEAAMPQLNTAYYGNLIFWTLLGLVAIYFILSRIALPRIGSVLAERAGTVGNDLSAAEE 64

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
             ++  S  ++Y+++L+ AR  A  I+++  A  +  L+ +    +  +  K++ ++  +
Sbjct: 65  LNQKARSAEAAYQQALSDARVEAGRIVEQTRATIDTELKAELAKADAQISVKVAESEKVL 124

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            +++ +A   + S+  E   D+V   G +  D  +   +D K  G
Sbjct: 125 GEIRDQAVASITSVAKETVGDVVALFGVAAEDDALSAAVDAKMKG 169


>gi|301299955|ref|ZP_07206182.1| ATP synthase F0, B subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300852437|gb|EFK80094.1| ATP synthase F0, B subunit [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 175

 Score = 90.6 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 74/152 (48%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           F +  + F I   +  +F    ++ +ME R   IS+D +  + A+++ E ++   + +L 
Sbjct: 19  FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVKKRDLALK 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R+ A +IID+     EQ          +++    +NA+ +I   +++A   V + V E
Sbjct: 79  NSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKTNAKKDIQQERQEALDSVKNDVAE 138

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           ++ ++  K+    ++  D + ++D   +G+  
Sbjct: 139 LSIEIASKIIRKELTADDQKALVDSYIEGLGK 170


>gi|193213684|ref|YP_001999637.1| F0F1 ATP synthase subunit B [Chlorobaculum parvum NCIB 8327]
 gi|226741335|sp|B3QLV1|ATPF_CHLP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193087161|gb|ACF12437.1| ATP synthase F0, B subunit [Chlorobaculum parvum NCIB 8327]
          Length = 175

 Score = 90.2 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 70/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW A+ F I   +  +     + S++E R   I S  ++  +AK E ES++   +E
Sbjct: 18  PGLIFWTAVTFVIVLVILKKIAWGPIVSMLEEREKGIQSAIDRAHTAKEEAESILKKNKE 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A A A +II +    A++      E  + +    ++ A+ EI+  +++A   + + 
Sbjct: 78  MLAKADAEADKIIREGKEYADKVRSELTEKAQVESQKMIAAAKEEIEQEKRRALDVLRNE 137

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           V ++      K+   ++     + +++   + + A
Sbjct: 138 VADMAVKGAEKIIRTTLDADKQKAVVNDMINEMAA 172


>gi|146276248|ref|YP_001166407.1| F0F1 ATP synthase subunit B' [Rhodobacter sphaeroides ATCC 17025]
 gi|226698821|sp|A4WNY8|ATPX_RHOS5 RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|145554489|gb|ABP69102.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 180

 Score = 90.2 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 75/160 (46%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  +   + +Q FWL +     Y++  R  LPR+ +++  RR  I++D    +  K++ 
Sbjct: 21  MPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLAERRGTITNDLAAAEELKQKA 80

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y E+LA ARA A+ II +  AA +  L       + ++  K + +++ I +++ 
Sbjct: 81  VLAEKAYNEALAKARAEAQAIIAETRAAIQAELAVATAKADAEIAAKSAESESRISEIRA 140

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A Q V  +  +  + LV  LG     A V   +  +  G
Sbjct: 141 GALQSVTEVAKDTAEALVAALGGKSDAASVDAAVAARMKG 180


>gi|254293424|ref|YP_003059447.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
 gi|254041955|gb|ACT58750.1| H+transporting two-sector ATPase B/B' subunit [Hirschia baltica
           ATCC 49814]
          Length = 178

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 49/172 (28%), Positives = 81/172 (47%), Gaps = 2/172 (1%)

Query: 3   SSSSSDFSSRFPPF-DTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           +  +   S  FPP  D +++ SQ FWLA+ FG+ Y    R ILPR+   ++ R + I+ D
Sbjct: 6   AHGAEAASGIFPPLNDYASYPSQIFWLALTFGVLYLFMSRMILPRIGGAIDRRADSITQD 65

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            E+         +   S E+ LA ARA A+    +  A  E  +  +    E ++  +L+
Sbjct: 66  LEEASRMSDRASAAQQSLEKELAEARAKARATAAQAKAEIEAEVAAETAKTEAEVDARLA 125

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           +A   I ++Q  A + V  +      ++V K +G SVS  D  K +     G
Sbjct: 126 SAATRIAEVQASAMKNVEDVASMTAANIVNKLIGVSVSKDDAAKAVSAVLKG 177


>gi|90961572|ref|YP_535488.1| ATP synthase B chain [Lactobacillus salivarius UCC118]
 gi|227890658|ref|ZP_04008463.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus salivarius
           ATCC 11741]
 gi|122449154|sp|Q1WUD0|ATPF_LACS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|90820766|gb|ABD99405.1| ATP synthase B chain [Lactobacillus salivarius UCC118]
 gi|227867596|gb|EEJ75017.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus salivarius
           ATCC 11741]
 gi|300214396|gb|ADJ78812.1| ATP synthase subunit b (ATP synthase F(0) sector subunit b) (F-type
           ATPase subunit b) (F-ATPase subunit b) (ATPase subunit
           I) [Lactobacillus salivarius CECT 5713]
          Length = 175

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 74/152 (48%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           F +  + F I   +  +F    ++ +ME R   IS+D +  + A+++ E ++   + +L 
Sbjct: 19  FIFYIVTFLILLALVKKFAWTPITDMMEKRATKISNDIDSAEQARQKAEELVEKRDLALK 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R+ A +IID+     EQ          +++    +NA+ +I   +++A   V + V E
Sbjct: 79  NSRSEASQIIDRAKKNGEQQKANIVSSAHEEVQTMKANAKKDIQQERQEALDSVKNDVAE 138

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           ++ ++  K+    ++  D + ++D   +G+  
Sbjct: 139 LSIEIASKIIRKELTADDQKALVDSYIEGLGK 170


>gi|257069068|ref|YP_003155323.1| ATP synthase F0 subcomplex B subunit [Brachybacterium faecium DSM
           4810]
 gi|256559886|gb|ACU85733.1| ATP synthase F0 subcomplex B subunit [Brachybacterium faecium DSM
           4810]
          Length = 179

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/156 (23%), Positives = 74/156 (47%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
             + +W  I   IF  V  +F+LPR++++++ R   I       +  + +V+ + S  E+
Sbjct: 18  PQEIWWSLIFLVIFAGVFMKFVLPRMNAVLDERAEKIEGGIRNAEKVQEQVDQLKSDQEQ 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR  A  I +K  A  ++ ++  R   + +    L+  + ++   +  AS E+   
Sbjct: 78  ELAAARQEAASIREKARADGQKIVDEARARADAESERVLAAGRQQLSAERIAASTELRGE 137

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           VG +  DL  K+       D   ++++DR  D +++
Sbjct: 138 VGTLASDLASKIVGESLSDDERSRRVIDRFLDDLES 173


>gi|254459818|ref|ZP_05073234.1| ATP synthase F0, B subunit [Rhodobacterales bacterium HTCC2083]
 gi|206676407|gb|EDZ40894.1| ATP synthase F0, B subunit [Rhodobacteraceae bacterium HTCC2083]
          Length = 160

 Score = 89.8 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 36/160 (22%), Positives = 74/160 (46%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P      F +Q FWL +   + + V  R  LPR+++++  R+  IS+D    ++ + +V
Sbjct: 1   MPQLCFEWFPNQIFWLVLTLVVIFLVLSRIALPRIAAVLAERQGTISNDIAAAEALRNKV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y ++LA ARA A+ I+    A  + +L+      + ++  K + ++  I +++ 
Sbjct: 61  ADAEDAYNKALADARAEAQNIVASAKADIQADLDVAIAKADAEISAKAAESEKAIAEIRA 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            A   V  +  +   ++V  LG   S   V   +  +  G
Sbjct: 121 GALASVEEVAKDTAAEIVSALGGKASAKVVGAAVAARLKG 160


>gi|108804478|ref|YP_644415.1| ATP synthase F0 subunit B [Rubrobacter xylanophilus DSM 9941]
 gi|122381737|sp|Q1AVH5|ATPF_RUBXD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|108765721|gb|ABG04603.1| ATP synthase F0, B subunit [Rubrobacter xylanophilus DSM 9941]
          Length = 174

 Score = 89.5 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 71/154 (46%), Gaps = 1/154 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           S  FW  + F I   + +R++ P +   ++ R+  I    E+ +  + E   ++  Y   
Sbjct: 13  SLIFWEVVTFLILLALLYRYVYPIIRDQIQKRQAQIEQAIEEAEKTRAEARELLEEYRRQ 72

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +  AR  A++I+D+    A+   E  RE   ++    +  A+ EI   +  A +EV   V
Sbjct: 73  IEAARGEARQILDEARRQAKAQRERAREEAREEGDRIIQRAREEISRERDAALREVRREV 132

Query: 143 GEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
            ++      + +G  +  A+ +++++   + ++A
Sbjct: 133 ADMVIMASSRVIGRELDAAEHERLINEALESLEA 166


>gi|78188050|ref|YP_378388.1| F0F1 ATP synthase subunit B [Chlorobium chlorochromatii CaD3]
 gi|123579103|sp|Q3ANW4|ATPF_CHLCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78170249|gb|ABB27345.1| ATP synthase F0 subcomplex B subunit [Chlorobium chlorochromatii
           CaD3]
          Length = 175

 Score = 89.1 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 67/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW AI F I   +  +     +   +E R   I S  ++ + AK E E+++    E
Sbjct: 18  PGLIFWTAITFVIVLLILKKIAWGPIIGALEEREKGIQSSIDRAEKAKDEAEAILRKNRE 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L+ A A +++I+ +    AE+      E    +    +++A+ EI+  +++A   + + 
Sbjct: 78  LLSKADAESEKIVREGKEYAEKLRTDITEKAHTEAAKMIASAKEEIEQEKRRALDVLRNE 137

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           V ++      ++    ++    +K++      + +
Sbjct: 138 VADLAVLGAERIIRESLNADMQKKVVASMIQDMSS 172


>gi|251771548|gb|EES52125.1| ATP synthase F0, B subunit [Leptospirillum ferrodiazotrophum]
          Length = 168

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/164 (21%), Positives = 73/164 (44%), Gaps = 1/164 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD+  F S  FW  + F +  ++  +++ P L  I++ RR  +SSD E    ++ E 
Sbjct: 1   MPQFDSQFFPSTIFWSLVSFALMLFIVGKYLYPSLIRILDERRTKVSSDMEAARKSREEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +++   E L  ARA A+ +I +    A    E + +   + +  +L  A  +I   ++
Sbjct: 61  EKLLAEQHELLEKARAQAENMIRQAEEMARTLREEREKEIAQSVKAELDKAAAQIAADRE 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           K   E+ +    +    +  +    ++D      +++    ID 
Sbjct: 121 KMKSELRTETVTLVVRSLETILEETLTDTQKVVYINKAMKAIDE 164


>gi|29377097|ref|NP_816251.1| ATP synthase F0, B subunit [Enterococcus faecalis V583]
 gi|227554107|ref|ZP_03984154.1| ATP synthase F0, B subunit [Enterococcus faecalis HH22]
 gi|229545020|ref|ZP_04433745.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1322]
 gi|229549264|ref|ZP_04437989.1| ATP synthase F0, B subunit [Enterococcus faecalis ATCC 29200]
 gi|256853923|ref|ZP_05559288.1| ATP synthase F0 [Enterococcus faecalis T8]
 gi|256957851|ref|ZP_05562022.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis DS5]
 gi|256961150|ref|ZP_05565321.1| ATP synthase subunit B [Enterococcus faecalis Merz96]
 gi|257081865|ref|ZP_05576226.1| ATP synthase subunit B [Enterococcus faecalis E1Sol]
 gi|257084407|ref|ZP_05578768.1| ATP synthase subunit B [Enterococcus faecalis Fly1]
 gi|257087594|ref|ZP_05581955.1| ATP synthase subunit B [Enterococcus faecalis D6]
 gi|257416801|ref|ZP_05593795.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis AR01/DG]
 gi|257420017|ref|ZP_05597011.1| ATP synthase subunit B [Enterococcus faecalis T11]
 gi|293384096|ref|ZP_06629990.1| ATP synthase F0, B subunit [Enterococcus faecalis R712]
 gi|293386911|ref|ZP_06631480.1| ATP synthase F0, B subunit [Enterococcus faecalis S613]
 gi|300861260|ref|ZP_07107347.1| ATP synthase F0, B subunit [Enterococcus faecalis TUSoD Ef11]
 gi|307285542|ref|ZP_07565681.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0860]
 gi|307290374|ref|ZP_07570289.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0411]
 gi|312899986|ref|ZP_07759304.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0470]
 gi|312902383|ref|ZP_07761589.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0635]
 gi|312907953|ref|ZP_07766936.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 512]
 gi|312953643|ref|ZP_07772480.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0102]
 gi|312978519|ref|ZP_07790257.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 516]
 gi|81722327|sp|Q831A1|ATPF_ENTFA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29344563|gb|AAO82321.1| ATP synthase F0, B subunit [Enterococcus faecalis V583]
 gi|227176733|gb|EEI57705.1| ATP synthase F0, B subunit [Enterococcus faecalis HH22]
 gi|229305501|gb|EEN71497.1| ATP synthase F0, B subunit [Enterococcus faecalis ATCC 29200]
 gi|229309912|gb|EEN75899.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1322]
 gi|256710866|gb|EEU25909.1| ATP synthase F0 [Enterococcus faecalis T8]
 gi|256948347|gb|EEU64979.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis DS5]
 gi|256951646|gb|EEU68278.1| ATP synthase subunit B [Enterococcus faecalis Merz96]
 gi|256989895|gb|EEU77197.1| ATP synthase subunit B [Enterococcus faecalis E1Sol]
 gi|256992437|gb|EEU79739.1| ATP synthase subunit B [Enterococcus faecalis Fly1]
 gi|256995624|gb|EEU82926.1| ATP synthase subunit B [Enterococcus faecalis D6]
 gi|257158629|gb|EEU88589.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ARO1/DG]
 gi|257161845|gb|EEU91805.1| ATP synthase subunit B [Enterococcus faecalis T11]
 gi|291078576|gb|EFE15940.1| ATP synthase F0, B subunit [Enterococcus faecalis R712]
 gi|291083581|gb|EFE20544.1| ATP synthase F0, B subunit [Enterococcus faecalis S613]
 gi|295113591|emb|CBL32228.1| ATP synthase F0 subcomplex B subunit [Enterococcus sp. 7L76]
 gi|300850299|gb|EFK78049.1| ATP synthase F0, B subunit [Enterococcus faecalis TUSoD Ef11]
 gi|306498567|gb|EFM68069.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0411]
 gi|306502766|gb|EFM72031.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0860]
 gi|310626044|gb|EFQ09327.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 512]
 gi|310628481|gb|EFQ11764.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0102]
 gi|310634053|gb|EFQ17336.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0635]
 gi|311288668|gb|EFQ67224.1| ATP synthase F0, B subunit [Enterococcus faecalis DAPTO 516]
 gi|311292982|gb|EFQ71538.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0470]
 gi|315025248|gb|EFT37180.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2137]
 gi|315030331|gb|EFT42263.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4000]
 gi|315035797|gb|EFT47729.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0027]
 gi|315150004|gb|EFT94020.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0012]
 gi|315151910|gb|EFT95926.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0031]
 gi|315159209|gb|EFU03226.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0312]
 gi|315162852|gb|EFU06869.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0645]
 gi|315173363|gb|EFU17380.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1346]
 gi|315576216|gb|EFU88407.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0309B]
 gi|315579207|gb|EFU91398.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0630]
 gi|315582932|gb|EFU95123.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0309A]
 gi|323481548|gb|ADX80987.1| ATP synthase F0, B subunit [Enterococcus faecalis 62]
 gi|327535843|gb|AEA94677.1| ATP synthase F0 sector subunit B [Enterococcus faecalis OG1RF]
          Length = 176

 Score = 88.7 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            ST L     ++  F I   +  ++    +  I+  R   I++D +  + ++     M  
Sbjct: 13  PSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEK 72

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             ++ L  +R+ A EII     + EQ  +   +    ++      A+ +I   +++A   
Sbjct: 73  ERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSS 132

Query: 138 VYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           V + V +++  +  K+    ++    + ++D   + +  
Sbjct: 133 VKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGK 171


>gi|153007322|ref|YP_001381647.1| ATP synthase F0 subunit B [Anaeromyxobacter sp. Fw109-5]
 gi|226741090|sp|A7HIW7|ATPF_ANADF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|152030895|gb|ABS28663.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. Fw109-5]
          Length = 175

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  I F +  +V  +F    +  ++  R   I    +     + E E +++  + 
Sbjct: 17  PGLTLWTGITFLVLLFVLGKFAWGPIVKMLAERERTIREAIDSAKRERTEAERLLAEQKA 76

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A   A E+  +     E   +       K+    ++ A+ +I++ + KA  E+ ++
Sbjct: 77  LLGKAAREAAELARRNQQEVEAMRQELTARARKEADDLVATARKQIEEEKTKAMSELRAV 136

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           V ++  D   +L   ++ DA  +K+++     + A
Sbjct: 137 VADLAIDAASRLVKANLDDASQRKLVEDYIAQLPA 171


>gi|315170138|gb|EFU14155.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1342]
          Length = 176

 Score = 88.3 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            ST L     ++  F I   +  ++    +  I+  R   I++D +  + ++     M  
Sbjct: 13  PSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEK 72

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             ++ L  +R+ A EII     + EQ  +   +    ++      A+ +I   +++A   
Sbjct: 73  ERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTVEVTRLREKARTDISQEREEALSS 132

Query: 138 VYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           V + V +++  +  K+    ++    + ++D   + +  
Sbjct: 133 VKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGK 171


>gi|330991388|ref|ZP_08315339.1| ATP synthase subunit b 1 [Gluconacetobacter sp. SXCC-1]
 gi|329761407|gb|EGG77900.1| ATP synthase subunit b 1 [Gluconacetobacter sp. SXCC-1]
          Length = 200

 Score = 88.3 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 38/159 (23%), Positives = 66/159 (41%), Gaps = 2/159 (1%)

Query: 5   SSSDFSSRFPPFDTS--TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +    +   P  D      + Q  W A IF + Y +  R  LP++  ++ +RR  I +D 
Sbjct: 27  APGARAEGMPQLDFGNPYVIGQVVWGAGIFLVLYLLLSRSALPKVEKVLSLRRQTIETDL 86

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                AK   +  ++   E+   A A A+  +DKVV  A      Q E     L  ++ +
Sbjct: 87  GIAHKAKTRADEAVAELHEARRKALAEAQANVDKVVEEARLAAARQTEEMNARLAAEIHD 146

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDAD 161
           A+  I+  + +A   V  I     + L+ +L    + AD
Sbjct: 147 AETRIEQARGQALASVREISTTTAETLIHQLSGIAAPAD 185


>gi|295394656|ref|ZP_06804875.1| ATP synthase F0 sector subunit B [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972549|gb|EFG48405.1| ATP synthase F0 sector subunit B [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 184

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/168 (20%), Positives = 72/168 (42%), Gaps = 4/168 (2%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
            +    P   + +     W A+ F I   V  + ILP+    ++ R   I    EK +  
Sbjct: 8   AAGGNNPLVPALYD--IVWSAVCFIIILVVFWKVILPKFKKTLDERAERIQGGIEKAEKV 65

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           + E ++ ++ Y++ LA  RA A  +  +      Q L   ++   ++    +S A+ +I+
Sbjct: 66  QAEADAALAEYQKQLADGRAEAARLRAEAQEEGAQILAETKQRATEEADRIISAAKAQIE 125

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
             +++A   + + VG +  DL  ++       DA    ++DR    ++
Sbjct: 126 AERQQAMNSLRTEVGSLATDLASRIVGESLQDDARSASVVDRFIADLE 173


>gi|116333892|ref|YP_795419.1| F0F1 ATP synthase subunit B [Lactobacillus brevis ATCC 367]
 gi|122269421|sp|Q03QY4|ATPF_LACBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116099239|gb|ABJ64388.1| F0F1-type ATP synthase, subunit b [Lactobacillus brevis ATCC 367]
          Length = 171

 Score = 87.9 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 70/148 (47%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F +  W+        ++ +M+ R + IS+D +  + ++ +   ++   + +LA +R+
Sbjct: 20  AVCFLLLMWIIKVLAWKPVTKMMQDRADKISNDIDSAEKSRNDAAELVQKRQAALASSRS 79

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A+ I++   A  +Q  E      + D+     NAQ +I+  ++ A     + V +++ +
Sbjct: 80  EAQTIVNDAKANGQQQREQIVTQAQADVQTLKQNAQKDIEQERQDALSNARNYVADLSIE 139

Query: 149 LVRKLG-FSVSDADVQKILDRKRDGIDA 175
           +  K+    +   D + ++D   +G+  
Sbjct: 140 IASKIIQRELKADDQKALIDSYIEGLGK 167


>gi|311113391|ref|YP_003984613.1| ATP synthase F0 sector subunit B [Rothia dentocariosa ATCC 17931]
 gi|310944885|gb|ADP41179.1| ATP synthase F0 sector subunit B [Rothia dentocariosa ATCC 17931]
          Length = 185

 Score = 87.9 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 37/176 (21%), Positives = 71/176 (40%), Gaps = 6/176 (3%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A    ++ SS   P   + +        + F I Y++ H++++P    I + R+  I  
Sbjct: 4   LAEGGGAEHSSN--PLIPNLWELGI--TVVGFVILYFIVHKYVVPAFEKIYQDRKEAIEG 59

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
              K + A+ E  +    Y + L  AR  A++I ++     E  +   RE    +     
Sbjct: 60  GLAKAEKAQAEAAAAREEYNQQLENARLEAQKIREEARTEGESIIAAARERATVEAQRIT 119

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
            NAQ  I+  +  AS  +   VG +   L  K+       D    +++DR    ++
Sbjct: 120 DNAQKTIEAERLAASVSLRHEVGTLATTLAGKIVGEALDDDERSARVVDRFLADLE 175


>gi|315498137|ref|YP_004086941.1| h+transporting two-sector atpase b/b' subunit [Asticcacaulis
           excentricus CB 48]
 gi|315416149|gb|ADU12790.1| H+transporting two-sector ATPase B/B' subunit [Asticcacaulis
           excentricus CB 48]
          Length = 214

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 34/165 (20%), Positives = 62/165 (37%), Gaps = 1/165 (0%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
               S   P F T  +  Q  WL +IF + + +  +   PRL ++++ R   I+ D    
Sbjct: 50  EDHASGGLPQFQTEHWAGQMVWLVVIFTVLFILIAKVFAPRLRNVIDSRGATIAEDLANA 109

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
            + + E E+         A A A A+++     + A   +   +   +  L   L+ A+ 
Sbjct: 110 RAIRDEAEAQAKDAAAETAAAHAAARKLAADAKSKATAEMAAAQAKEDARLNGILAEAEA 169

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV-SDADVQKILDRK 169
            I   +  A   V  I  +    LV KL     +   +   L + 
Sbjct: 170 SIRAKRDGALAHVTEIATDTASALVEKLTGKAPTKTALTAALKKS 214


>gi|227519703|ref|ZP_03949752.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0104]
 gi|256616876|ref|ZP_05473722.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ATCC 4200]
 gi|256963731|ref|ZP_05567902.1| ATP synthase subunit B [Enterococcus faecalis HIP11704]
 gi|257079789|ref|ZP_05574150.1| ATP synthase subunit B [Enterococcus faecalis JH1]
 gi|257421804|ref|ZP_05598794.1| ATP synthase F0 subunit B [Enterococcus faecalis X98]
 gi|294781388|ref|ZP_06746730.1| ATP synthase F0, B subunit [Enterococcus faecalis PC1.1]
 gi|307270672|ref|ZP_07551963.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4248]
 gi|307271678|ref|ZP_07552949.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0855]
 gi|307276860|ref|ZP_07557971.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2134]
 gi|307287563|ref|ZP_07567606.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0109]
 gi|227072791|gb|EEI10754.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0104]
 gi|256596403|gb|EEU15579.1| ATP synthase DNA gyrase subunit B [Enterococcus faecalis ATCC 4200]
 gi|256954227|gb|EEU70859.1| ATP synthase subunit B [Enterococcus faecalis HIP11704]
 gi|256987819|gb|EEU75121.1| ATP synthase subunit B [Enterococcus faecalis JH1]
 gi|257163628|gb|EEU93588.1| ATP synthase F0 subunit B [Enterococcus faecalis X98]
 gi|294451515|gb|EFG19975.1| ATP synthase F0, B subunit [Enterococcus faecalis PC1.1]
 gi|306501301|gb|EFM70604.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0109]
 gi|306506497|gb|EFM75656.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2134]
 gi|306511556|gb|EFM80555.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0855]
 gi|306512982|gb|EFM81623.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4248]
 gi|315032745|gb|EFT44677.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0017]
 gi|315143756|gb|EFT87772.1| ATP synthase F0, B subunit [Enterococcus faecalis TX2141]
 gi|315148587|gb|EFT92603.1| ATP synthase F0, B subunit [Enterococcus faecalis TX4244]
 gi|315155494|gb|EFT99510.1| ATP synthase F0, B subunit [Enterococcus faecalis TX0043]
 gi|315164960|gb|EFU08977.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1302]
 gi|315168603|gb|EFU12620.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1341]
 gi|329578104|gb|EGG59516.1| ATP synthase F0, B subunit [Enterococcus faecalis TX1467]
          Length = 176

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            ST L     ++  F I   +  ++    +  I+  R   I++D +  + ++     M  
Sbjct: 13  PSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEK 72

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             ++ L  +R+ A EII     + EQ  +   +    ++      A+ +I   +++A   
Sbjct: 73  ERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSS 132

Query: 138 VYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           V + V +++  +  K+    ++    + ++D   + +  
Sbjct: 133 VKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGK 171


>gi|331701225|ref|YP_004398184.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
 gi|329128568|gb|AEB73121.1| ATP synthase subunit b [Lactobacillus buchneri NRRL B-30929]
          Length = 169

 Score = 87.5 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 23/156 (14%), Positives = 66/156 (42%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           ++    ++ I F +  W+        ++ +M+ R + I +D +    ++ +   +    +
Sbjct: 12  YVGDMLFVMITFLVLMWLVKIVAWKPITKMMQDRSDKIVNDIDSAKESRTKAAELAQKRQ 71

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
             L   R  A  II+      ++  E   E    +  +  S+A+ +I+  +++A      
Sbjct: 72  AELDKTRDDANTIINTAKQNGQRQQEQIVEDARNEASNLKSSAEKDIEQERQEALANSRK 131

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            V  ++ ++  K+    +++ D + ++D   +G+  
Sbjct: 132 DVASLSVEIASKIISKELNEDDQKGLVDSYIEGLGK 167


>gi|70725929|ref|YP_252843.1| F0F1 ATP synthase subunit B [Staphylococcus haemolyticus JCSC1435]
 gi|88909587|sp|Q4L7Y8|ATPF_STAHJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68446653|dbj|BAE04237.1| ATP synthase B chain [Staphylococcus haemolyticus JCSC1435]
          Length = 176

 Score = 87.1 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 64/149 (42%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F I   +  +F    L  +M+ R   I+ D ++ + AK   + +    +++L 
Sbjct: 24  VIVTVITFAILLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTLK 83

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   + I++     A +  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 84  QTQDEVQRILEDARVQARKQHEEIIHEANIRANGMIETAQSEINSEKERALADINNQVSE 143

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D ++++D+    
Sbjct: 144 LSVLIASKVLKKEISEQDQKELVDKYLKE 172


>gi|255971976|ref|ZP_05422562.1| ATP synthase subunit B [Enterococcus faecalis T1]
 gi|255975033|ref|ZP_05425619.1| ATP synthase subunit B [Enterococcus faecalis T2]
 gi|256763250|ref|ZP_05503830.1| ATP synthase subunit B [Enterococcus faecalis T3]
 gi|257090753|ref|ZP_05585114.1| ATP synthase subunit B [Enterococcus faecalis CH188]
 gi|255962994|gb|EET95470.1| ATP synthase subunit B [Enterococcus faecalis T1]
 gi|255967905|gb|EET98527.1| ATP synthase subunit B [Enterococcus faecalis T2]
 gi|256684501|gb|EEU24196.1| ATP synthase subunit B [Enterococcus faecalis T3]
 gi|256999565|gb|EEU86085.1| ATP synthase subunit B [Enterococcus faecalis CH188]
          Length = 171

 Score = 87.1 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            ST L     ++  F I   +  ++    +  I+  R   I++D +  + ++     M  
Sbjct: 8   PSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSAEQSRVAAAKMEK 67

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             ++ L  +R+ A EII     + EQ  +   +    ++      A+ +I   +++A   
Sbjct: 68  ERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKARTDISQEREEALSS 127

Query: 138 VYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           V + V +++  +  K+    ++    + ++D   + +  
Sbjct: 128 VKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGK 166


>gi|300741311|ref|ZP_07071332.1| ATP synthase F0, B subunit [Rothia dentocariosa M567]
 gi|300380496|gb|EFJ77058.1| ATP synthase F0, B subunit [Rothia dentocariosa M567]
          Length = 182

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 38/176 (21%), Positives = 71/176 (40%), Gaps = 6/176 (3%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           MA    ++ SS   P   + +        + F I Y++ H++++P    I + R+  I  
Sbjct: 1   MAEGGGAEHSSN--PLIPNLWELGI--TVVGFVILYFIVHKYVVPAFEKIYQDRKEAIEG 56

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
              K + A+ E  +    Y + L  AR  A++I ++     E  +   RE    +     
Sbjct: 57  GLAKAEKAQAEAAAAREEYNQQLENARLEAQKIREEARTEGESIIAAARERATVEAQRIT 116

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
            NAQ  I+  +  AS  +   VG +   L  K+       D    +++DR    ++
Sbjct: 117 DNAQKTIEAERLAASVSLRHEVGTLATTLAGKIVGEALDDDERSARVVDRFLADLE 172


>gi|172040392|ref|YP_001800106.1| F0F1 ATP synthase subunit B [Corynebacterium urealyticum DSM 7109]
 gi|226741419|sp|B1VFY3|ATPF_CORU7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|171851696|emb|CAQ04672.1| ATP synthase B chain [Corynebacterium urealyticum DSM 7109]
          Length = 186

 Score = 87.1 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 67/152 (44%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F +  +V  + +LP+   ++  R + I    ++ ++AK E +  +  Y + LA
Sbjct: 28  IVWSIIPFAVILFVFAKVVLPKFQEVLTQREDKIEGGIQRAEAAKAEAQEALEKYNKQLA 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   +  ++ +   +    ++    +     +++  +     ++   +GE
Sbjct: 88  EARTEAAQIRDDARSQGQKIIADMKTQATEESNRIVEAGNKQLEANRASVVADLRKEMGE 147

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L  +L     + DV++   +D    G+D
Sbjct: 148 NSINLAERLLGEQLNDDVKRSGTIDNFLAGLD 179


>gi|330996916|ref|ZP_08320781.1| ATP synthase F0, B subunit [Paraprevotella xylaniphila YIT 11841]
 gi|329571990|gb|EGG53661.1| ATP synthase F0, B subunit [Paraprevotella xylaniphila YIT 11841]
          Length = 168

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 71/156 (45%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ IIFGI +++  ++  P ++ +++ R+  I S  E    A  +++ + +  E 
Sbjct: 8   PGTLFWMVIIFGIVFFILAKYAFPVITGMVDKRKQYIDSSLEAARQANEQLQQVKAESEA 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A      I+ +  A  ++ +   RE    +    L   +++I   ++ A  ++   
Sbjct: 68  LLARAHEEQTAILKEASATRDRIIAEARERARTEARKALDETRHQIAAEKESAINDIRRQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           V  ++ D+  K+       D +  ++++R  D + +
Sbjct: 128 VAILSVDVAEKVLRKKLSDDKEQLELVNRLLDEVKS 163


>gi|332880274|ref|ZP_08447952.1| ATP synthase F0, B subunit [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332681719|gb|EGJ54638.1| ATP synthase F0, B subunit [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 168

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 71/156 (45%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ IIFGI +++  ++  P ++ +++ R+  I S  E    A  +++ + +  E 
Sbjct: 8   PGTLFWMVIIFGIVFFILAKYAFPVITGMVDKRKQYIDSSLEAARQANEQLQQVKAESEA 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A      I+ +  A  ++ +   RE    +    L   +++I   ++ A  ++   
Sbjct: 68  LLARAHEEQTAILKEASATRDRIIAEARERARTEARKALDETRHQIAAEKESAINDIRRQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           V  ++ D+  K+       D +  ++++R  D + +
Sbjct: 128 VAILSVDVAEKVLRKKLSDDKEQLELVNRLLDEVKS 163


>gi|224477096|ref|YP_002634702.1| F0F1 ATP synthase subunit B [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421703|emb|CAL28517.1| ATP synthase B chain [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 174

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 64/148 (43%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             I F I   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L   +
Sbjct: 25  TLITFLILLALLKKFAWGPLKQVMDKREQDINKDIDDAEQAKINAQKLEEENRQTLRETQ 84

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              ++I+++    A    E       +     +  AQ+EI+  +++A  E+   V +++ 
Sbjct: 85  NEVQKILEEAKVQARDQHEQIIHEANQRANGMIETAQSEINSQKERAISEINDEVSKLSV 144

Query: 148 DLVRKLG-FSVSDADVQKILDRKRDGID 174
            +  K+    +S+ D ++++D+    + 
Sbjct: 145 LIASKILQKDISEKDQKELIDKYIKEVG 172


>gi|84494530|ref|ZP_00993649.1| ATP synthase subunit B [Janibacter sp. HTCC2649]
 gi|84384023|gb|EAP99903.1| ATP synthase subunit B [Janibacter sp. HTCC2649]
          Length = 211

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 37/178 (20%), Positives = 76/178 (42%), Gaps = 7/178 (3%)

Query: 3   SSSSSDFSSRFP---PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLIS 59
           +S  +     FP   P        +     I FGI YW+    ++PR+ ++   R   I 
Sbjct: 4   TSVVAAEEVGFPSGFPLLPH--PVEMIVGLIAFGIMYWLYKSKVVPRMEALYAERTAAIE 61

Query: 60  SDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHK 119
              E+ + A+ +  + +  YE  L  AR  A  I ++  A     +   RE  + +    
Sbjct: 62  GGMEQAEEAQAQAHAALQQYEAQLHEARTEANTIREEARAEGALIVTELREKAQAEAARI 121

Query: 120 LSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQK--ILDRKRDGIDA 175
             +AQ +I+  +++A   + S VG ++  L  ++     + +V++   +DR    +++
Sbjct: 122 TESAQRQIEAERQQALVSLRSEVGTLSTTLAGRIVGESLEDEVRQKGTIDRFLAELES 179


>gi|319893058|ref|YP_004149933.1| ATP synthase B chain [Staphylococcus pseudintermedius HKU10-03]
 gi|317162754|gb|ADV06297.1| ATP synthase B chain [Staphylococcus pseudintermedius HKU10-03]
          Length = 172

 Score = 86.8 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 62/154 (40%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +       + F I   +  +F    L  +M+ R   I+ D +  + AK   + +     +
Sbjct: 17  IGDIIVTVVTFLILLALLRKFAWGPLKKVMDDRERSINQDIDDAERAKLNAQRLEEENRQ 76

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L   +    +I++     A +  E       +     L  AQ+EI   +++A  E+ + 
Sbjct: 77  KLKETQDEVHKILEDAKLQARRQQEEILHEANQRANGMLETAQSEIKSEKERALAEINNQ 136

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
           V E++  +  K L   +S+ D + ++++    + 
Sbjct: 137 VSELSVLIASKVLRKEISEQDQKALIEKYVKEVG 170


>gi|296128922|ref|YP_003636172.1| ATP synthase F0, B subunit [Cellulomonas flavigena DSM 20109]
 gi|296020737|gb|ADG73973.1| ATP synthase F0, B subunit [Cellulomonas flavigena DSM 20109]
          Length = 193

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 73/153 (47%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W AI+        ++F+LP+  ++++ R   I     K +SA+ E  + ++ Y++ LA
Sbjct: 31  LLWSAIVLVGIAIPFYKFVLPKFQAVLDERTAKIEGGIAKAESAQAEAAAQLAEYQQLLA 90

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR+ A  I +     A Q +   R   +++       AQ +ID  +++A+  + + VG 
Sbjct: 91  DARSEAARIREDARTEAGQIVAEARTRAQEEAARIAETAQRQIDAERQQAAVSLRTDVGT 150

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+       +A   +++DR  D ++A
Sbjct: 151 LATQLASKIVGESLEDEARRSRVVDRFLDELEA 183


>gi|269957236|ref|YP_003327025.1| ATP synthase F0 subunit B [Xylanimonas cellulosilytica DSM 15894]
 gi|269305917|gb|ACZ31467.1| ATP synthase F0, B subunit [Xylanimonas cellulosilytica DSM 15894]
          Length = 194

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 65/152 (42%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W A++  I     ++F+LP +  +++ R   I     +   AK   E  +   +E L 
Sbjct: 28  LLWSAVVLVIIAVAFYKFVLPPMLKVLDERTEAIEGGMAQAAQAKEAAEQALERQQELLT 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR+ A ++ D+     +  +   R   +++       A  +I+  ++ A+  + + VG+
Sbjct: 88  AARSDAAKVRDEAREEGKAIVAEHRSKAQEEAARITETAHRQIEAERQAAAVSLRTDVGD 147

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           +   L  K+        A   +++DR  D ++
Sbjct: 148 LATQLASKIVGEELADSAARARVVDRFLDELE 179


>gi|138896939|ref|YP_001127392.1| F0F1 ATP synthase subunit B [Geobacillus thermodenitrificans
           NG80-2]
 gi|134268452|gb|ABO68647.1| ATPase subunit b [Geobacillus thermodenitrificans NG80-2]
          Length = 207

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  + F +   +  +F    L  +M+ R   I+++ ++ +  ++E E ++    E L 
Sbjct: 51  IIFQLVAFILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLK 110

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A+ I++     AE+  E        +       A+ EI+  +++A   +   V  
Sbjct: 111 QSRQEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVAS 170

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           ++  +  K +   +++ D +K+++     I
Sbjct: 171 LSVLIASKVIERELTEQDQRKLIEAYIKDI 200


>gi|296120445|ref|YP_003628223.1| ATP synthase F0 subunit beta [Planctomyces limnophilus DSM 3776]
 gi|296012785|gb|ADG66024.1| ATP synthase F0, B subunit [Planctomyces limnophilus DSM 3776]
          Length = 238

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 69/154 (44%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  I F  F ++  +F    L++ ++ R   I +D ++ +SA+ + + +++ +E 
Sbjct: 81  PDLMVWSLITFVAFVFLLSKFAWKPLAAGLDQREARIRNDIQEAESARLKAQQLLAEHEA 140

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA      +E+I +    AE+         E D+      A +EI+  +  A Q+++  
Sbjct: 141 RLAKTEETVRELIAEAKRDAEKVRVDLTAAAEADVQTMKKRAVSEIEQARDVALQQLFDT 200

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +     D   ++ G S++  D Q+++      ++
Sbjct: 201 LSTHVMDATSRIVGRSLNSDDHQRLVQEALAELN 234


>gi|319902310|ref|YP_004162038.1| ATP synthase F0 subcomplex B subunit [Bacteroides helcogenes P
           36-108]
 gi|319417341|gb|ADV44452.1| ATP synthase F0 subcomplex B subunit [Bacteroides helcogenes P
           36-108]
          Length = 168

 Score = 86.4 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P +++++E R+N I    E    A  ++  +    +  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITNMVEGRKNYIDQSLEVAREANAQLARLKEEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  +     +L   + +I   +++A +++   V
Sbjct: 69  VAAANKEQGRILREAMHERDKIIVEARKQADIVAQKELDEVRKQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D   ++  ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKNLDEKHEQMDMIDRMLDEV 161


>gi|298207196|ref|YP_003715375.1| ATP synthase F0, subunit B [Croceibacter atlanticus HTCC2559]
 gi|83849831|gb|EAP87699.1| ATP synthase F0, subunit B [Croceibacter atlanticus HTCC2559]
          Length = 164

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 62/154 (40%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  I F I +++  +F    +   +  R   I S  +  ++A+RE+E++ +  E 
Sbjct: 8   FGLVVWTVITFLILFFLLKKFAWKPILGAVHDRETSIKSALDSAEAARREMENLQADNER 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR     II +  +  ++ +    +  +      +  AQ  I   ++ A  ++ + 
Sbjct: 68  ILQEARTERDSIIKEARSMKDKMIADASDEAQAKADQIIKQAQAAILSEKQAAIADIKNQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++ D+  K+      +     K+++     +
Sbjct: 128 VANLSIDIAEKVVREELSNKEKQAKLVEDMLGDV 161


>gi|116494658|ref|YP_806392.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei ATCC 334]
 gi|122263921|sp|Q03A22|ATPF_LACC3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116104808|gb|ABJ69950.1| ATP synthase F0 subcomplex B subunit [Lactobacillus casei ATCC 334]
          Length = 162

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 69/148 (46%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F +      +     +S +M  R+  IS D +  + ++++ +++++  +E L  ++
Sbjct: 9   TLVTFLVLMLAVGKVAWKPVSKMMADRQQKISGDLDYAEKSRKDADALVAKRQEELQHSQ 68

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+++     E+  +   +    ++     NAQ EID  +K A     + V +++ 
Sbjct: 69  ADAVKIVNQAKENGEKLRQSLVDAANAEVTTMKKNAQTEIDQARKDALASAKNDVADLSL 128

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            + +K +G  ++  D + ++D     + 
Sbjct: 129 TIAQKLIGKELNADDQKGLIDDYIKRLG 156


>gi|73662086|ref|YP_300867.1| F0F1 ATP synthase subunit B [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|88909588|sp|Q49Z54|ATPF_STAS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|72494601|dbj|BAE17922.1| F0F1-type ATP synthase b subunit' [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 175

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 65/149 (43%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F I   +  +F    L  +M+ R + I+ D +  + AK   + +    +++L 
Sbjct: 23  IIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDIDDAEQAKLNAQKLEEQNKQTLK 82

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   ++I+++    A +  E             +  AQNEI+  +++A  ++ + V E
Sbjct: 83  ETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIETAQNEINSEKERAIADINNQVSE 142

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +SD D + ++++    
Sbjct: 143 LSVLIASKVLQKEISDKDQKALVEKYIKE 171


>gi|304320005|ref|YP_003853648.1| hypothetical protein PB2503_02142 [Parvularcula bermudensis
           HTCC2503]
 gi|303298908|gb|ADM08507.1| hypothetical protein PB2503_02142 [Parvularcula bermudensis
           HTCC2503]
          Length = 196

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 48/165 (29%), Positives = 80/165 (48%), Gaps = 3/165 (1%)

Query: 11  SRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKR 70
              P  +TST++SQ FWL I F I Y +  R  LPRL  I+E RRN I++D +K    KR
Sbjct: 35  GGLPQLETSTYVSQVFWLLIAFLILYLLCARIFLPRLGGIIEERRNRIANDFDKAAEYKR 94

Query: 71  EVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDM 130
           E E    ++ ++LA ARA A +I  +  A  ++ +       ++++   ++ A+  I   
Sbjct: 95  EAEEAQQAFNQALADARARAAQIASETRARIDEEIAEMTADADREIEADIAAAEERIRAT 154

Query: 131 QKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDA 175
            ++A+  V     + TK +V  L       D    ++     + A
Sbjct: 155 GEEAAAAVRRAAHDTTKAVVNALIDETPSDD---AVENALSTVAA 196


>gi|86137236|ref|ZP_01055814.1| ATP synthase F0, B' subunit [Roseobacter sp. MED193]
 gi|85826560|gb|EAQ46757.1| ATP synthase F0, B' subunit [Roseobacter sp. MED193]
          Length = 160

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/143 (26%), Positives = 70/143 (48%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  D STF +Q FWLAI     Y +  R  LPR+++++  R+  I++D    +  K + 
Sbjct: 1   MPQLDFSTFGNQIFWLAIALVAIYLILSRVALPRIAAVLAERQGTITNDLAAAEDLKAKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
                +Y ++LA ARA A+ I  +  A  +  L+      ++ +  K + ++  I +++ 
Sbjct: 61  VEAEDAYNKALADARAEAQRIAAETRAEIQVGLDEAIAKADEQIAAKAAESEKAIGEIKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGF 155
            A + V  +  +  + LV  LG 
Sbjct: 121 GALESVKVVAADTAEALVTALGG 143


>gi|289643103|ref|ZP_06475233.1| ATP synthase F0, B subunit [Frankia symbiont of Datisca glomerata]
 gi|289507067|gb|EFD28036.1| ATP synthase F0, B subunit [Frankia symbiont of Datisca glomerata]
          Length = 196

 Score = 86.0 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 66/155 (42%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +S+     + FG+        + P++      R + I  +  + +  +RE E ++ SY  
Sbjct: 26  VSELLIGILAFGLLVAFFFWKVYPQIRRTYAERSDRIEGNLARAERTQREAEDLLVSYRR 85

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A+  A  I        +Q L+  R    +++    +  + ++   + +   ++   
Sbjct: 86  QLAEAQDEAGRIRQDAREQGQQILDSLRAQAGEEVAEIKARGEAQLAAERAQVVAQIRRE 145

Query: 142 VGEVTKDLVRKL-GFSVS-DADVQKILDRKRDGID 174
           +GE+  +L  K+ G  +  D   ++++D    G+D
Sbjct: 146 IGEIALELATKIVGHELQRDDRQRQLIDDFIAGLD 180


>gi|83594574|ref|YP_428326.1| H+-transporting two-sector ATPase, subunit B/B' [Rhodospirillum
           rubrum ATCC 11170]
 gi|114696|sp|P15015|ATPX_RHORU RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|123525686|sp|Q2RPA6|ATPX_RHORT RecName: Full=ATP synthase subunit b'; AltName: Full=ATP synthase
           F(0) sector subunit b'; AltName: Full=ATPase subunit II;
           AltName: Full=F-type ATPase subunit b'; Short=F-ATPase
           subunit b'
 gi|46373|emb|CAA31248.1| ATPase F-0-subunit b' (AA 1 - 161) [Rhodospirillum rubrum]
 gi|152601|gb|AAA26457.1| ATP synthase F-0 sector, b' subunit [Rhodospirillum rubrum]
 gi|83577488|gb|ABC24039.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 161

 Score = 85.6 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 76/143 (53%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD S+F SQ  WL I     Y+V  R  +PRL+ ++E R+ LI+ D ++ ++ K E 
Sbjct: 1   MPQFDPSSFPSQIVWLVIALVAMYFVMSRLAIPRLAEVLEQRQRLINDDLKQAEALKAET 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E+ I++YE +LA ARA A + I  V  AA +  E +     K L  ++ + +  I   + 
Sbjct: 61  EAAIAAYETALAEARARAHDEIRAVTEAAAKAAEARNAEVAKALNTRIKDGEARIVQARD 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGF 155
           +A   V  + G V  D+V KL  
Sbjct: 121 EALTHVREVAGAVASDIVGKLAG 143


>gi|261879473|ref|ZP_06005900.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
 gi|270333898|gb|EFA44684.1| ATP synthase F0 [Prevotella bergensis DSM 17361]
          Length = 173

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 73/156 (46%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW+ + F + + V  +F  P +++++E R+  I     K   A   +E++    E 
Sbjct: 12  LGLLFWMLLAFLVVFGVLAKFGFPAITNMVEDRKKYIDDSLRKAHEASERLENIRQEGES 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR    +++ +     +  +E  +E  + +    LS+A+ +I+  ++ A +++ S 
Sbjct: 72  MLQEAREKQAQLLKEATETRDVIVEKAQEKAKAEGTRLLSDAKAQIEAEKQNAIRDIRSQ 131

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           V E++  +  ++      S+    +++D+  D +  
Sbjct: 132 VAELSVKIAERIVKQQLSSNDKQMELIDKLLDEVSE 167


>gi|269794327|ref|YP_003313782.1| ATP synthase F0 subcomplex subunit B [Sanguibacter keddieii DSM
           10542]
 gi|269096512|gb|ACZ20948.1| ATP synthase F0 subcomplex B subunit [Sanguibacter keddieii DSM
           10542]
          Length = 194

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 71/153 (46%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W A++      + ++ +LP+ ++I++ R   I     K + A+ E +++++ Y+  L 
Sbjct: 32  IVWSAVVMVAVGLMFYKLVLPKFTAILDERTAKIEGGLSKAEHAQAEADALLAQYKAQLQ 91

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A  I ++    A   +   +    ++       AQ +I+  +++AS  + + VG 
Sbjct: 92  EARTDAARIREEARGEATAIVAEAKAKASEESARIFETAQRQIEAERQQASTSLRNDVGA 151

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +  +L  K+        A   +++DR  D ++A
Sbjct: 152 LATELASKIVGESLEDTARQSRVVDRFLDELEA 184


>gi|326402638|ref|YP_004282719.1| ATP synthase subunit b' [Acidiphilium multivorum AIU301]
 gi|325049499|dbj|BAJ79837.1| ATP synthase subunit b' [Acidiphilium multivorum AIU301]
          Length = 189

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/159 (25%), Positives = 77/159 (48%), Gaps = 2/159 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLS--QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           + +++    + P  D S  L+  Q  W+A+I  + Y+V  R+ LPR+  ++E R N I++
Sbjct: 16  TPATAMAEGKMPQMDFSNPLTGAQVVWMAVIMVVLYFVLARWALPRIGGVIENRHNRIAT 75

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D E    AK E E  +     ++  AR  ++  I + V AA++    Q       L  ++
Sbjct: 76  DLETARRAKAEAEHAVRELNLAIQNARESSQGAIAEAVNAAKERARAQTAALNDRLSAQI 135

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD 159
           ++A+ EID  ++ A   +  I  +V   L+ +L     +
Sbjct: 136 ASAEAEIDSARRTAVGALAPIARDVASSLLHRLIGEAVE 174


>gi|25027867|ref|NP_737921.1| F0F1 ATP synthase subunit B [Corynebacterium efficiens YS-314]
 gi|259506258|ref|ZP_05749160.1| H+-ATPase b subunit [Corynebacterium efficiens YS-314]
 gi|81749547|sp|Q8FQ24|ATPF_COREF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|23493150|dbj|BAC18121.1| H+-ATPase b subunit [Corynebacterium efficiens YS-314]
 gi|259166162|gb|EEW50716.1| H+-ATPase b subunit [Corynebacterium efficiens YS-314]
          Length = 190

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 67/152 (44%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I  +V  +F+LP+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 32  IVWSLIPFLIILFVFWKFVLPKFQEVLTEREDRIKGGIQRAEAAQAEAKAALEKYNAQLA 91

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A EI ++     +Q     +   E++    +     ++   +++   E+   +G+
Sbjct: 92  EARTEAAEIREQARERGKQIEVEMKAKAEEESNRIIEAGTKQLMAQREQVVNELRREMGQ 151

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L   L       DV++   +DR    +D
Sbjct: 152 NSINLAEHLLGDQLSDDVKRSGTIDRFLADLD 183


>gi|319948461|ref|ZP_08022597.1| F0F1 ATP synthase subunit B [Dietzia cinnamea P4]
 gi|319437881|gb|EFV92865.1| F0F1 ATP synthase subunit B [Dietzia cinnamea P4]
          Length = 190

 Score = 85.6 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I   +  W+  +FILP+   +++ R   I     + +  + E +  ++ Y+  LA
Sbjct: 31  IVWSLIPLAVILWLFWKFILPKFQQVLDEREERIEGGLRRAEQTQAEAKEELAKYKAQLA 90

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR+ A +I D   A  +Q L   +   + +    ++    ++   +++   E+ S +G 
Sbjct: 91  EARSEAAKIRDDARAQGQQILADMKAEAQAESDRIVAAGNQQLAAQRQQIVAELRSDLGR 150

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + DL  +L        V++   +DR    +D
Sbjct: 151 QSVDLAERLMGEQLSDSVRRSGTIDRFLADLD 182


>gi|325297380|ref|YP_004257297.1| ATP synthase subunit b [Bacteroides salanitronis DSM 18170]
 gi|324316933|gb|ADY34824.1| ATP synthase subunit b [Bacteroides salanitronis DSM 18170]
          Length = 167

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 68/154 (44%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ I FG+ + +  ++  P +   +E R+  I +  +    A  ++ ++    E+
Sbjct: 8   PGLVFWMIITFGVVFVLLAKYGFPVIIKAVEDRKAYIDNSLKAARDANEQLANVKLEGEK 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR     I+ +     ++ ++  ++    +    ++  + +I+  ++ A +++   
Sbjct: 68  ILAQAREEQNRILSEAAVTRDRIVKDAQDRAITEGQRLMAEVKKQIETEKESAIRDIRRQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++ ++  K+  S      +   ++DR  D +
Sbjct: 128 VAVLSVEIAGKIMRSKLADTKEQNALIDRMLDEM 161


>gi|167648334|ref|YP_001685997.1| H+transporting two-sector ATPase subunit B/B' [Caulobacter sp. K31]
 gi|167350764|gb|ABZ73499.1| H+transporting two-sector ATPase B/B' subunit [Caulobacter sp. K31]
          Length = 199

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 64/154 (41%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +S +   S   P F+   +  Q  +L ++F I Y +  R   PR+ ++++ R + I+   
Sbjct: 28  ASGAEHGSGGLPQFEFQHWGGQIAYLLVLFAILYVLIARVFTPRMRAVIDERASRIAGAL 87

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           E     + E      +    LA ARA ++ +     A A      +    E  L   L+ 
Sbjct: 88  EAARQVQAEALEQSRAAAAELAEARARSQALAFDARAKANAEAAERSAAEEAKLAAHLAQ 147

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS 156
           A+  I  ++  A   V ++  +  + +V+KL   
Sbjct: 148 AETRIQGLRDSAMASVGAVASDTAQAIVQKLTGK 181


>gi|260590645|ref|ZP_05856103.1| ATP synthase F0, B subunit [Prevotella veroralis F0319]
 gi|260537386|gb|EEX20003.1| ATP synthase F0, B subunit [Prevotella veroralis F0319]
          Length = 170

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 72/153 (47%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ I+F + +++  R+  P +  ++  R+N I     K + A   + ++    EE 
Sbjct: 9   GLLFWMTIVFLVVFFILWRWGFPSIIKMVNERKNYIDESLAKAEEANLRLANIQKQGEEL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR    +I+ +     +  +E  +E   ++    LS A+ EI+  ++ A +++ S V
Sbjct: 69  LMEAREKQAQILREASQTRDSIVEQAQEKAHEESARILSEAKAEIESQKQAAIRDIRSQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
            E++  +  K+      + A+  +++D   D +
Sbjct: 129 AELSVQIAEKILRKQLTTSAEQAQLIDSLLDEV 161


>gi|148259412|ref|YP_001233539.1| H+-transporting two-sector ATPase, B/B' subunit [Acidiphilium
           cryptum JF-5]
 gi|226694379|sp|A5FVI8|ATPF2_ACICJ RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|146401093|gb|ABQ29620.1| H+-transporting two-sector ATPase, B/B' subunit [Acidiphilium
           cryptum JF-5]
          Length = 189

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/159 (25%), Positives = 77/159 (48%), Gaps = 2/159 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLS--QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           + + +    + P  D S  L+  Q  W+A+I  + Y+V  R+ LPR+  ++E R N I++
Sbjct: 16  TPAIAMAEGKMPQMDFSNPLTGAQVVWMAVIMVVLYFVLARWALPRIGGVIENRHNRIAT 75

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           D E    AK E E  +     ++  AR  ++  I + V AA++    Q       L  ++
Sbjct: 76  DLETARRAKAEAEHAVRELNLAIQNARESSQGAIAEAVNAAKERARAQTAALNDRLSAQI 135

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD 159
           ++A+ EID  ++ A   +  I  +V   L+++L     +
Sbjct: 136 ASAEAEIDSARRTAVGALAPIARDVASSLLQRLIGEAVE 174


>gi|27468622|ref|NP_765259.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis ATCC 12228]
 gi|57867660|ref|YP_189278.1| F0F1 ATP synthase subunit B [Staphylococcus epidermidis RP62A]
 gi|293366071|ref|ZP_06612759.1| ATP synthase F0 sector subunit B [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81673862|sp|Q5HMB5|ATPF_STAEQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81842667|sp|Q8CNJ3|ATPF_STAES RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|27316169|gb|AAO05303.1|AE016749_249 ATP synthase B chain [Staphylococcus epidermidis ATCC 12228]
 gi|57638318|gb|AAW55106.1| ATP synthase F0, B subunit [Staphylococcus epidermidis RP62A]
 gi|291319794|gb|EFE60152.1| ATP synthase F0 sector subunit B [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329734124|gb|EGG70442.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU045]
          Length = 171

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 65/148 (43%), Gaps = 1/148 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           F   + F I   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L  
Sbjct: 20  FVTLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKE 79

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
            +   ++I+D     A +  E       +     +  AQ+EI+  +++A  ++ + V E+
Sbjct: 80  TQDEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVSEL 139

Query: 146 TKDLVRK-LGFSVSDADVQKILDRKRDG 172
           +  +  K L   +S+ D ++++++    
Sbjct: 140 SVLIASKVLRKEISEQDQKELVEKYLKE 167


>gi|50954450|ref|YP_061738.1| F0F1 ATP synthase subunit B [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|81692686|sp|Q6AG62|ATPF_LEIXX RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|50950932|gb|AAT88633.1| ATP synthase, B chain [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 190

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/177 (19%), Positives = 76/177 (42%), Gaps = 4/177 (2%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           ++S   +    +  P       +      I F +  +   + +LPR+  +++ R   I  
Sbjct: 2   LSSVVIAASEEQHNPLIPE--PADIVGSLICFVVILFFFWKLVLPRVKKLLDERAEAIEG 59

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           +  K D A+ + E+++  Y   LA ARA A +I ++     ++ +   ++    +     
Sbjct: 60  NIAKADEAQHKAEALLEEYTAQLAEARADAAKIREQARTDGQKIVAEAKDTATAEAARVT 119

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           ++AQ +I+  ++ A   +   VG +  D+   +   V   D   Q I+DR    ++A
Sbjct: 120 ASAQAQIEAERQTALVSLRGEVGSLAIDIASGVVGEVLTEDKKAQAIVDRFLADLEA 176


>gi|226694481|sp|Q2S434|ATPF_SALRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 169

 Score = 85.2 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW  + F IF ++ +RF    ++  +E R   I    ++ + A  E +++ +  EE
Sbjct: 14  VGLIFWKTVAFLIFLYILYRFGWGPITESLEEREEEIEHSIQRAEEALEEAKAIQAENEE 73

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +   A   A++I+ +   +AE+  E ++    +++      AQ EI+  ++ A QE+   
Sbjct: 74  ARREAEQKAQQILREARDSAEELREEEKAKTRREIQEMKEQAQAEIEREKQAALQELRDE 133

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDG 172
           V ++  +  +K+    +     ++++D   D 
Sbjct: 134 VADLAIEAAQKIIENDLDADRHRQLVDDALDD 165


>gi|227535358|ref|ZP_03965407.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|227186954|gb|EEI67021.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
          Length = 162

 Score = 85.2 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 68/148 (45%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F +      +     +S +M  R+  IS D +  + ++++ +++ +  +E L  A+
Sbjct: 9   TLVTFLVLMLAVGKVAWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAKRQEELQHAQ 68

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+++     E+  +   +    ++     NAQ +ID  +K A     + V +++ 
Sbjct: 69  ADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASAKNDVADLSL 128

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            + +K +G  ++  D + ++D     + 
Sbjct: 129 TIAQKLIGKELNADDQKGLIDDYIKRLG 156


>gi|188587438|ref|YP_001918983.1| ATP synthase F0, B subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226694327|sp|B2A3G6|ATPF_NATTJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|179352125|gb|ACB86395.1| ATP synthase F0, B subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 162

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 73/148 (49%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             +   + +++  RF+   +   ME R+N I  + E  +  ++E E +   Y E L  A+
Sbjct: 12  TIVNILVLFYLLKRFLFKPIGEFMENRKNEIKQNLEDAEKERQEAEKLKEQYYEKLRGAK 71

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           + A+EII +     E+ ++  ++  +++    ++ A+ EI+  QKKA + + S V ++T 
Sbjct: 72  SEAQEIIQQARQREEEIIKEAKQEAKQEADDMIARAREEINQEQKKAIESLRSEVSDLTI 131

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            +  + L  ++     +K++ +    + 
Sbjct: 132 QITERVLNDTIDKDQQKKLVQKYLKEVG 159


>gi|260906203|ref|ZP_05914525.1| ATP synthase F0, B subunit [Brevibacterium linens BL2]
          Length = 183

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 66/153 (43%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W AI   I + V  +++LP  +  ++ R   I    EK +  + E +  ++ Y++ LA
Sbjct: 21  IVWSAICLLIVFLVVWKYVLPAFNKTLDERAERIQGGIEKAEKVQAEADEALAEYQKQLA 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             RA A  +  +      Q +   +     +    ++ AQ +I+  ++ A  ++ S VG 
Sbjct: 81  DGRAEAARLRAEAQEEGAQIIANMKTQAHAESERIVAQAQTQIEAERQSAMVQLRSEVGT 140

Query: 145 VTKDLVRKLGFSVSDADVQKI--LDRKRDGIDA 175
           +  DL  ++       D +    +DR    +++
Sbjct: 141 LATDLASRIVGESLTDDQRSANVVDRFITDLES 173


>gi|226360600|ref|YP_002778378.1| F0F1 ATP synthase subunit B [Rhodococcus opacus B4]
 gi|226239085|dbj|BAH49433.1| ATP synthase subunit b [Rhodococcus opacus B4]
          Length = 186

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 31/171 (18%), Positives = 72/171 (42%), Gaps = 4/171 (2%)

Query: 7   SDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMD 66
           +       P   +T+     W  +   I  +V  +++LP    ++  R   I    ++ +
Sbjct: 9   AAEEESHNPLLPATYD--IVWSIVCLVIVGFVFWKYVLPMFQKVLAERTEQIDGGIKRAE 66

Query: 67  SAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNE 126
            A+ E ++ +  Y   LA AR  A +I +      +Q +   +   +++    ++   N+
Sbjct: 67  EAQAEAKAALEQYRAQLAEARTEAAQIREDARTQGQQIIAEMKAQAQEESDRIVAAGNNQ 126

Query: 127 IDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGIDA 175
           +   +++   E+ + +G    DL  KL       DV++   +DR  + +D+
Sbjct: 127 LVAQRQQIVTELRADLGRTAVDLAEKLIGESLADDVKRAGTVDRFLNELDS 177


>gi|223043922|ref|ZP_03613963.1| ATP synthase F0, B subunit [Staphylococcus capitis SK14]
 gi|222442637|gb|EEE48741.1| ATP synthase F0, B subunit [Staphylococcus capitis SK14]
          Length = 171

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 61/146 (41%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F I   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L   +
Sbjct: 22  TLVTFVILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKETQ 81

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              + I+D     A +  E             +  AQ+EI+  +++A  ++ + V E++ 
Sbjct: 82  DEVQRILDDAKVQARKQHEEIIHEANVRANGMIETAQSEINSEKERALADINNQVSELSV 141

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
            +  K L   +S+ D + ++++    
Sbjct: 142 LIASKVLRKEISEQDQKDLVEKYLKE 167


>gi|191638157|ref|YP_001987323.1| ATP synthase B chain [Lactobacillus casei BL23]
 gi|239631741|ref|ZP_04674772.1| predicted protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|301066217|ref|YP_003788240.1| F0F1-type ATP synthase subunit b [Lactobacillus casei str. Zhang]
 gi|226741491|sp|B3WDL4|ATPF_LACCB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|190712459|emb|CAQ66465.1| ATP synthase B chain [Lactobacillus casei BL23]
 gi|239526206|gb|EEQ65207.1| predicted protein [Lactobacillus paracasei subsp. paracasei 8700:2]
 gi|300438624|gb|ADK18390.1| F0F1-type ATP synthase, subunit b [Lactobacillus casei str. Zhang]
 gi|327382188|gb|AEA53664.1| ATP synthase subunit b 2 [Lactobacillus casei LC2W]
 gi|327385385|gb|AEA56859.1| ATP synthase subunit b 2 [Lactobacillus casei BD-II]
          Length = 162

 Score = 84.8 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 68/148 (45%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F +      +     +S +M  R+  IS D +  + ++++ +++ +  +E L  ++
Sbjct: 9   TLVTFLVLMLAVGKVAWKPVSKMMADRQQKISGDLDYAEKSRKDADALAAKRQEELQHSQ 68

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+++     E+  +   +    ++     NAQ +ID  +K A     + V +++ 
Sbjct: 69  ADAVKIVNQAKENGEKQRQSLVDAANAEVTTMKKNAQTDIDQARKDALASAKNDVADLSL 128

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            + +K +G  ++  D + ++D     + 
Sbjct: 129 TIAQKLIGKELNADDQKGLIDDYIKRLG 156


>gi|198274972|ref|ZP_03207504.1| hypothetical protein BACPLE_01131 [Bacteroides plebeius DSM 17135]
 gi|198272419|gb|EDY96688.1| hypothetical protein BACPLE_01131 [Bacteroides plebeius DSM 17135]
          Length = 167

 Score = 84.8 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/154 (16%), Positives = 69/154 (44%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ I FG+ +++  ++  P +   +E R+  I +  +    A  ++ ++    E+
Sbjct: 8   PGLLFWMVITFGVVFFILAKYGFPVILKTVEDRKAYIDNSLKAAREANEQLANVKVEGEK 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR     I+ +  A  ++ ++  +E    +    +   + +I+  ++ A +++   
Sbjct: 68  LLAQAREEQHRILSEAAATRDRIIKDAQEKAFAEGNRLMEEMKKQIETEKESAIRDIRRQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++  +  K+  +    + +   ++DR  D +
Sbjct: 128 VAVLSVGIAEKIMRNKLADEKEQAALIDRLLDEM 161


>gi|10039448|dbj|BAB13356.1| H+-ATPase b subunit [Brevibacterium flavum]
          Length = 188

 Score = 84.8 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I   V  + +LP+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 30  IVWSLIPFLIILIVFWKLVLPKFQEVLTEREDRIKGGIQRAEAAQVEAKAALEKYNAQLA 89

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A EI ++     +Q     ++   ++    + +   ++   +++   E+   +G+
Sbjct: 90  EARTEAAEIREQARERGKQIEAELKDKANEESNRIIESGSKQLLAQREQVVNELRREMGQ 149

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L   L       +V++   +DR    +D
Sbjct: 150 NSINLAEHLLGDQLSDNVKRSGTIDRFLADLD 181


>gi|331695529|ref|YP_004331768.1| ATP synthase subunit b [Pseudonocardia dioxanivorans CB1190]
 gi|326950218|gb|AEA23915.1| ATP synthase subunit b [Pseudonocardia dioxanivorans CB1190]
          Length = 184

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 68/147 (46%), Gaps = 1/147 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            +IF +  +  +RF++P L+  M  R  ++    E+ D A R +      Y  SLA AR 
Sbjct: 27  IVIFLLVLFFFYRFVVPPLTKAMRERDEMVRKQVEERDRAVRTLREAEERYAASLAEARG 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  I D+  A A+Q  E  R   ++++       + E+   + + ++ + + +G ++ D
Sbjct: 87  EATAIRDEARADAQQIRETMRAETDREVARLREQGEAELAAQRAETARSLRAEIGGLSSD 146

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGID 174
           L  + LG  + D   +  ++     ++
Sbjct: 147 LASRVLGRPIDDGRHRSTVESFLADLE 173


>gi|162146973|ref|YP_001601434.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544037|ref|YP_002276266.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785550|emb|CAP55121.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531714|gb|ACI51651.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 203

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 37/172 (21%), Positives = 74/172 (43%), Gaps = 3/172 (1%)

Query: 1   MASSSSSDFSSRFPPFDTS--TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58
           MA ++    +   P  D +    + Q  W  +IF + Y +  R  LP++  ++  RR  I
Sbjct: 26  MAMAAPGARAVGMPQLDFANPLIIGQVVWGGVIFLVLYLLLSRSALPKVDRVLANRRQTI 85

Query: 59  SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLH 118
            +D +    AK E ++ +    ++   A A A+  ++KVV  A      + +     L  
Sbjct: 86  ENDLDIAHRAKDEADAAVDELHQARRAAMAEAQANVEKVVEDARLAALHETQNMNARLAA 145

Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRK 169
           ++ +A+  +   +  A   +  I  +  + LV +L G SV    + + +D  
Sbjct: 146 EIRDAEARVAAARAAALGSLRQIADDTAQALVHQLSGTSVPADQLARRVDDA 197


>gi|88657774|ref|YP_507873.1| ATP synthase F0, B' subunit [Ehrlichia chaffeensis str. Arkansas]
 gi|88599231|gb|ABD44700.1| ATP synthase F0, B' subunit [Ehrlichia chaffeensis str. Arkansas]
          Length = 168

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 70/154 (45%)

Query: 14  PPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVE 73
           P  D +++ SQ FW  + FGI Y++  + I+P+L ++++ R  +     + +++     +
Sbjct: 5   PQLDITSYPSQLFWFFLSFGILYFLISKNIIPKLENVLKKRYTVTIDSVDCVENNLILAQ 64

Query: 74  SMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKK 133
             +     +L  A+A A  II   +   ++       +  +++    S A   + +++++
Sbjct: 65  DELKKQLSNLEEAKAEADRIISSALQEVKRTNADLIVLLNEEIQGMFSIADEYMHNLKRQ 124

Query: 134 ASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILD 167
             QE+  +  E+      K+  +    D  K+ D
Sbjct: 125 TEQELIDLTCEIASMYYNKMLGTAEYVDKDKLRD 158


>gi|325855018|ref|ZP_08171734.1| ATP synthase F0, B subunit [Prevotella denticola CRIS 18C-A]
 gi|327313281|ref|YP_004328718.1| ATP synthase F0 subunit B [Prevotella denticola F0289]
 gi|325483996|gb|EGC86936.1| ATP synthase F0, B subunit [Prevotella denticola CRIS 18C-A]
 gi|326944310|gb|AEA20195.1| ATP synthase F0, B subunit [Prevotella denticola F0289]
          Length = 170

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 71/153 (46%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F + +++  R+  P +  ++  R+  I     K + A + + ++    EE 
Sbjct: 9   GLLFWMTLVFLVVFFILWRWGFPSIIKMVNERKEYIDESLAKAEEANQRLANIQKQGEEL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR    +I+ +     +  +   +E   ++    ++ A+ EI++ ++ A +++ S V
Sbjct: 69  LMEAREKQAQILREASDTRDAIVGQAQEKAHEESARIIAEAKAEIENQKQAAIRDIRSQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
            E++  +  K+        A+  +++D   D +
Sbjct: 129 AELSVQIAEKILHKELAGSAEQTRLIDSLLDEV 161


>gi|294084672|ref|YP_003551430.1| ATP synthase subunit B' [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664245|gb|ADE39346.1| ATP synthase subunit B', membrane-bound, F0 sector [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 201

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 39/170 (22%), Positives = 73/170 (42%), Gaps = 1/170 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           ++       P  D +T+ SQ FWL ++F I Y +  R + PR+ +++E RR  +  D  K
Sbjct: 26  AADAGKPGLPQLDVTTWPSQIFWLIVLFAIGYVIMSRIVTPRIGTVLEERRKRLDDDLAK 85

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
              +  +   + + YEE+L  ARA A          A Q+ E       K L  K   A+
Sbjct: 86  ARESSEDAAKIRAGYEETLETARAEAAAYAKDAAVKATQSAEAANAKLSKKLATKAQAAE 145

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
            ++   + +A + + ++  +      + L G   + A  +K +      +
Sbjct: 146 AKLAKARSEAMESLNAVAVDAAIAATQHLTGIKATKAQAEKTVKSLAKTM 195


>gi|28378942|ref|NP_785834.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum WCFS1]
 gi|254557147|ref|YP_003063564.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300769657|ref|ZP_07079540.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181150|ref|YP_003925278.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|81631034|sp|Q88UT9|ATPF_LACPL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28271779|emb|CAD64685.1| H(+)-transporting two-sector ATPase, B subunit [Lactobacillus
           plantarum WCFS1]
 gi|254046074|gb|ACT62867.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum JDM1]
 gi|300492700|gb|EFK27885.1| ATP synthase F0 sector subunit B [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308046641|gb|ADN99184.1| F0F1 ATP synthase subunit B [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 171

 Score = 84.4 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 67/157 (42%), Gaps = 1/157 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +L    ++ I F +   +        ++ +M  R + I++D +    +++E   +     
Sbjct: 13  YLGDMLFIGISFIVLMALISVVAWKPITKMMADRADKIANDIDSAQKSRQEASDLADQRR 72

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           ++L+ +RA A EI+     + E+         + +      NA+ +I+  ++ A + V S
Sbjct: 73  DALSHSRAEASEIVADAKKSGEKQRSSIVADAQNEATQYKQNARKDIEQERQDALKNVQS 132

Query: 141 IVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDAF 176
            V +++  +  K+    +     Q +++   +G+   
Sbjct: 133 DVADISVAIATKIIKKQLDPEGQQALINSYIEGLGKH 169


>gi|296536543|ref|ZP_06898630.1| ATP synthase F0 [Roseomonas cervicalis ATCC 49957]
 gi|296263139|gb|EFH09677.1| ATP synthase F0 [Roseomonas cervicalis ATCC 49957]
          Length = 204

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 43/161 (26%), Positives = 84/161 (52%), Gaps = 2/161 (1%)

Query: 12  RFPPFDTS--TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK 69
             P  D      L+Q  WL IIFG+FY+V    +LP+ +S++E RR+ I  D +   +AK
Sbjct: 38  GMPQLDFGNPLMLAQVVWLLIIFGVFYYVLSSIVLPKAASVLEERRSRIEGDLDAARAAK 97

Query: 70  REVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129
            E ++ +++++ + A ARA ++  I   V AA+ ++  +     + L  ++++A+  I  
Sbjct: 98  AEADAAMAAHQAATAKARAESQAAITAAVEAAQADVAARNAALNERLNQQIASAEARIAA 157

Query: 130 MQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKR 170
            +  A   +  +  +    LV++L  S ++A V   + R+ 
Sbjct: 158 ARDTAMGALREVATDTANALVQRLTGSSNEAAVSAAVQREL 198


>gi|229823979|ref|ZP_04450048.1| hypothetical protein GCWU000282_01283 [Catonella morbi ATCC 51271]
 gi|229786333|gb|EEP22447.1| hypothetical protein GCWU000282_01283 [Catonella morbi ATCC 51271]
          Length = 170

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 66/148 (44%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F I   +   F    L+ I+  R+ +I  D +   S K   +      + +L  AR
Sbjct: 20  TLVAFVILLLIVKHFAWGPLTKILSERKQVIDHDIQTAASEKAAAQDANRDAQLALRDAR 79

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +II +    + Q  +   +  +++++     AQ +I   +++   ++ + + +++ 
Sbjct: 80  AEATQIILQAKKQSLQVQDTMLKEAKEEVIRMKETAQKDIALERRRMLSDLRAELTDISI 139

Query: 148 DLVRKLG-FSVSDADVQKILDRKRDGID 174
           ++  K+    +   D  +++D   +G+D
Sbjct: 140 EIAEKIIQREIKPEDYHRLVDDFIEGMD 167


>gi|111018477|ref|YP_701449.1| F0F1 ATP synthase subunit B [Rhodococcus jostii RHA1]
 gi|123046537|sp|Q0SGP5|ATPF_RHOSR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|110818007|gb|ABG93291.1| H(+)-transporting two-sector ATPase subunit B [Rhodococcus jostii
           RHA1]
          Length = 185

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 30/162 (18%), Positives = 69/162 (42%), Gaps = 4/162 (2%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P    T+     W  +   I  +V  +++LP    ++  R   I    ++ + A+ E ++
Sbjct: 16  PLLPETYD--IVWSIVCLVIVGFVFWKYVLPMFQKVLAERTEQIDGGIKRAEEAQAEAKA 73

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
            +  Y   LA AR  A +I +      +Q +   +   +++    ++   N++   +++ 
Sbjct: 74  ALEQYRAQLAEARTEAAQIREDARTQGQQIIAEMKAQAQEESDRIVAAGNNQLVAQRQQI 133

Query: 135 SQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGID 174
             E+ + +G    DL  K+       DV++   +DR  + +D
Sbjct: 134 VAELRADLGRTAVDLAEKVIGESLADDVKRAGTVDRFLNELD 175


>gi|282878919|ref|ZP_06287683.1| ATP synthase F0, B subunit [Prevotella buccalis ATCC 35310]
 gi|281298918|gb|EFA91323.1| ATP synthase F0, B subunit [Prevotella buccalis ATCC 35310]
          Length = 168

 Score = 84.4 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 67/155 (43%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
              FFW+AI+F I   +  ++  P + +++  R+  I     K   A   + ++    E 
Sbjct: 8   FGLFFWMAIVFIIVLAILWKWGFPSIVNMVNSRKEFIDDSLRKAHEANERLANIQKEGET 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR    +I+       +  +   +E    +    L+ A+ EI+  ++ A +++ + 
Sbjct: 68  MLQNAREKQAQILKDAADTRDAIVVKAQEKATNEGSRLLNEAKAEIEAEKQNAIRDIRTQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V E++  +  K+      S+    +++++  + I 
Sbjct: 128 VAEISVQVAEKIVREKLSSNESQMELINKLLNDIS 162


>gi|117926950|ref|YP_867567.1| ATP synthase F0 subunit beta [Magnetococcus sp. MC-1]
 gi|226741506|sp|A0LDW8|ATPF_MAGSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117610706|gb|ABK46161.1| ATP synthase F0 subcomplex B subunit [Magnetococcus sp. MC-1]
          Length = 189

 Score = 84.1 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 40/166 (24%), Positives = 79/166 (47%), Gaps = 1/166 (0%)

Query: 11  SRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKR 70
           S  P FD+STF SQ FW  I F     +  +F++P +S ++E R + I  + +  ++ ++
Sbjct: 18  SGMPQFDSSTFSSQMFWTVISFVALLLLLKKFVVPAISDVLEARASRIEEELKAAENERK 77

Query: 71  EVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDM 130
           E  +++      +   R    ++++     A+   E ++   E +L    S A  +I+  
Sbjct: 78  EAAALLVDQRAEVKAEREKIAQLLESARKEADALREQEKAELEAELAKLKSQATQDIEQA 137

Query: 131 QKKASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           +++A  EV  +V EV   +  KL    +  A+  K+ D     ++A
Sbjct: 138 RRQAMSEVRGVVVEVALAVTEKLITKSIDKAEANKLADEAIRHLEA 183


>gi|307547038|ref|YP_003899517.1| F0F1 ATP synthase subunit B [Halomonas elongata DSM 2581]
 gi|307219062|emb|CBV44332.1| F0F1 ATP synthase subunit B [Halomonas elongata DSM 2581]
          Length = 156

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F  F W   RF+ P +   ++ R+  I+   +    A R++E      EE+L 
Sbjct: 7   LIGQAIAFAFFVWFCMRFVWPPVMQALQERQKKIADGLDAASRASRDLELAEQQAEETLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ++  A EI+++    + Q ++  RE   ++    ++NA++EI+    +A +E+   V  
Sbjct: 67  ESKEQAAEILEQAHKRSNQMIDEAREQARQEGERMITNAKSEIEQEVNRAKEELREQVSR 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      ++   S+ +    K++D+  D +
Sbjct: 127 LAIVGAERILESSIDEKQHAKLVDKLADEL 156


>gi|323463887|gb|ADX76040.1| ATP synthase F0, B subunit [Staphylococcus pseudintermedius ED99]
          Length = 172

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 61/154 (39%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +         F I   +  +F    L  +M+ R   I+ D +  + AK   + +     +
Sbjct: 17  IGDIIVTVATFLILLALLRKFAWGPLKKVMDDRERSINQDIDDAERAKLNAQRLEEENRQ 76

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L   +    +I++     A +  E       +     L  AQ+EI   +++A  E+ + 
Sbjct: 77  KLKETQDEVHKILEDAKLQARRQQEEILHEANQRANGMLETAQSEIKSEKERALAEINNQ 136

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
           V E++  +  K L   +S+ D + ++++    + 
Sbjct: 137 VSELSVLIASKVLRKEISEQDQKALIEKYVKEVG 170


>gi|295687786|ref|YP_003591479.1| H+transporting two-sector ATPase b/b' subunit [Caulobacter segnis
           ATCC 21756]
 gi|295429689|gb|ADG08861.1| H+transporting two-sector ATPase B/B' subunit [Caulobacter segnis
           ATCC 21756]
          Length = 179

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 38/159 (23%), Positives = 64/159 (40%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +    +     P      +  Q  WL +IF + Y V  + +LPR+S  +E R   I+ D 
Sbjct: 14  APQGHEGGGGLPQLQFEHWGGQIVWLLLIFAVLYAVLSKGLLPRVSGAIEERGAKIAGDI 73

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 K E E+   +    +A ARA A++      A A      ++   E  L  KL+ 
Sbjct: 74  ADARRLKDEAEAQARAAAAEVAEARAKAQKTAADAKAKASAEAAERQAKEEAVLAEKLAA 133

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDAD 161
           A+  I   + +A  +V  +  +    +V KL    + A 
Sbjct: 134 AEASIQTARDQAMSQVRVVAQDTAGAIVEKLTGKAATAA 172


>gi|312139174|ref|YP_004006510.1| ATP synthase subunit B [Rhodococcus equi 103S]
 gi|325673521|ref|ZP_08153212.1| ATP synthase F0 sector subunit B [Rhodococcus equi ATCC 33707]
 gi|311888513|emb|CBH47825.1| ATP synthase B chain AtpF [Rhodococcus equi 103S]
 gi|325555542|gb|EGD25213.1| ATP synthase F0 sector subunit B [Rhodococcus equi ATCC 33707]
          Length = 186

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 73/163 (44%), Gaps = 4/163 (2%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P   +T+     W  +   +  +V  +F+LP    ++  R   I    ++ + A+ E ++
Sbjct: 17  PLLPATYD--ITWSIVALVVVGFVFWKFVLPMFQKVLAERTEQIDGGIKRAEEAQAEAKA 74

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
            +  Y   LA AR  A +I ++     +Q +   +   +++    ++   +++   +++ 
Sbjct: 75  ALEQYHAQLAEARTEAAQIREEARTQGQQIISEMKAQAQEESDRIVAAGHSQLVAQRQQI 134

Query: 135 SQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGIDA 175
             E+ + +G+   DL  K+       DV++   +DR  + +DA
Sbjct: 135 VTELRADLGKTAVDLAEKVIGESLADDVKRAGTVDRFLNELDA 177


>gi|319441095|ref|ZP_07990251.1| F0F1 ATP synthase subunit B [Corynebacterium variabile DSM 44702]
          Length = 185

 Score = 84.1 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  + F I + +  +F+LP    ++  R   I    ++ ++A+ E ++ +  Y   LA
Sbjct: 28  IVWSLVCFIIIFVLFWKFVLPTFKRVLAEREEQIEGGIQRAEAAQEEAKAALEKYNSQLA 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A  ++ +       E ++  K ++ +  +   +     ++   +G 
Sbjct: 88  EARTEASQIRDDARAQGQKIIAEANTKAEAEVKRKAADGEKALLAQRDAVVSDLRKDLGA 147

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
            + +L  +L              +D    G+D+
Sbjct: 148 ASINLAEQLLGEDLADSTKKSGTIDSFLAGLDS 180


>gi|332671306|ref|YP_004454314.1| ATP synthase F0 subunit B [Cellulomonas fimi ATCC 484]
 gi|332340344|gb|AEE46927.1| ATP synthase F0, B subunit [Cellulomonas fimi ATCC 484]
          Length = 197

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 68/151 (45%), Gaps = 2/151 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW +++  I     +++ LP+  +I++ R   I     K ++A+ E  + ++ Y + L 
Sbjct: 33  IFWSSVVLLIIAIAFYKYALPKFQAILDERTAKIEGGLAKAETAQAEAAAALAEYHQQLQ 92

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A  I +   A   Q +   R    ++       A  +I+  +++A+ ++   VG 
Sbjct: 93  DARTEAARIREDARAEGGQIVADLRAKASEEAARITETAHRQIEAERQQAAVQLTQDVGT 152

Query: 145 VTKDLVRKLGFSVSDAD--VQKILDRKRDGI 173
           +  +L  K+     + +    +++DR  D +
Sbjct: 153 LATELASKIVGEALEDEVRQSRVVDRFLDEL 183


>gi|227513062|ref|ZP_03943111.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227524277|ref|ZP_03954326.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
 gi|227083637|gb|EEI18949.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus buchneri
           ATCC 11577]
 gi|227088508|gb|EEI23820.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus hilgardii
           ATCC 8290]
          Length = 169

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +     ++ I F I  ++        ++ +M+ R + I++D +   +++ +   +    +
Sbjct: 12  YTGDMIFVMISFLILMFLIKLIAWNPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQ 71

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
             L   R  A  +I+      ++  E   E    +  +  S+A+ +I+  +++A      
Sbjct: 72  AQLDKTREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRK 131

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            V  ++ ++  K+    +++ D + ++D   +G+  
Sbjct: 132 DVASLSIEIATKIISKELNEQDQKGLVDSYIEGLGK 167


>gi|325269438|ref|ZP_08136055.1| ATP synthase F0 sector subunit B [Prevotella multiformis DSM 16608]
 gi|324988359|gb|EGC20325.1| ATP synthase F0 sector subunit B [Prevotella multiformis DSM 16608]
          Length = 170

 Score = 84.1 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F + +++  R+  P +  ++  R+  I     K + A   + ++    EE 
Sbjct: 9   GLLFWMTLVFLVVFFILWRWGFPSIIKMVNERKEYIDESLAKAEEANLRLANIQKQGEEL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR    +I+ +     +  +   +E    +    L+ A+ EI++ ++ A +++ S V
Sbjct: 69  LMEAREKQAQILREAADTRDAIVGQAQEKAHGESARILAEAKAEIENQKQAAIRDIRSQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
            E++  +  K+        A+  +++D   D +
Sbjct: 129 AELSVQIAEKILHKELAGSAEQTRLIDSLLDEV 161


>gi|258647877|ref|ZP_05735346.1| ATP synthase F0, B subunit [Prevotella tannerae ATCC 51259]
 gi|260851709|gb|EEX71578.1| ATP synthase F0, B subunit [Prevotella tannerae ATCC 51259]
          Length = 168

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 25/156 (16%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ + FG+ +++  ++  P ++  +E R+N I    +        + ++    E 
Sbjct: 12  FGLLFWMLLAFGVVFFLLAKYGFPAITKAVEERKNYIDESLKNARETNERLANVKVESEN 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A      II + +A  +  +   R   + +       A+ +I   ++ A +++ S 
Sbjct: 72  ILKEAHEQQARIIKEAMATRDNIIAEARNKAQTEGQQLFEEAKKQIVAEKENALRDIRSQ 131

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           V +++  +  K+      +  + +K +DR  + ++ 
Sbjct: 132 VADLSVLIAEKVIRRQLDNAEEQEKYIDRILNDMNK 167


>gi|329955016|ref|ZP_08295997.1| ATP synthase F0, B subunit [Bacteroides clarus YIT 12056]
 gi|328526306|gb|EGF53321.1| ATP synthase F0, B subunit [Bacteroides clarus YIT 12056]
          Length = 166

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + +  ++  P ++ ++E RR  I    E    A  ++  +    E  
Sbjct: 9   GLLFWMLLSFGVVFVILAKYGFPIITKMVEGRRTYIDQSLEVARQANAQLAKLKEESEAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L + + +I   +++A +++   V
Sbjct: 69  IAAANKEQGRIMREAMHERDKIIVEARKHAEAVAQKELDDVKQQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D    +  ++DR  D +
Sbjct: 129 AVLSVDIAEKIIRRNLDEKQDQMEMIDRMLDEM 161


>gi|227510133|ref|ZP_03940182.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227190338|gb|EEI70405.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 169

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 22/156 (14%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +     ++ I F I  ++        ++ +M+ R + I++D +   +++ +   +    +
Sbjct: 12  YTGDMIFVMISFLILMYLIKLIAWNPITKMMQNRSDKIANDIDSAKNSRDKAAELAQQRQ 71

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
             L   R  A  +I+      ++  E   E    +  +  S+A+ +I+  +++A      
Sbjct: 72  AQLDKTREDANNLINTAKENGQRQREQIVEDARNEASNLKSSAEKDIEQQRQEALANSRK 131

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            V  ++ ++  K+    +++ D + ++D   +G+  
Sbjct: 132 DVASLSIEIATKIISKELNEQDQKGLVDSYIEGLGK 167


>gi|226307396|ref|YP_002767356.1| ATP synthase subunit b [Rhodococcus erythropolis PR4]
 gi|226186513|dbj|BAH34617.1| ATP synthase subunit b [Rhodococcus erythropolis PR4]
          Length = 185

 Score = 83.7 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 31/162 (19%), Positives = 70/162 (43%), Gaps = 4/162 (2%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P    T+     W A+   +  +V  + +LP+   ++  R   I    +K + A+ E  +
Sbjct: 17  PLLPETYD--IVWSAVALVVVGFVFWKLVLPKFQKVLAERTEQIEGGIKKAEDAQAEAAA 74

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
            +  Y   LA AR  A +I ++     +Q +   +   + +    ++   +++   +++ 
Sbjct: 75  ALEQYRAQLAEARTEAAQIREEARTQGQQIIADMKVQAQDESDRIVAAGHSQLVAQRQQI 134

Query: 135 SQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGID 174
             E+ S +G+   DL  K+       DV++   +DR  + +D
Sbjct: 135 VAELRSDLGKTAVDLAEKVIGESLADDVKRAGTVDRFLNELD 176


>gi|184200626|ref|YP_001854833.1| ATP synthase subunit b [Kocuria rhizophila DC2201]
 gi|226741490|sp|B2GLY6|ATPF_KOCRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|183580856|dbj|BAG29327.1| ATP synthase subunit b [Kocuria rhizophila DC2201]
          Length = 178

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 64/163 (39%), Gaps = 4/163 (2%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P     +        I F I  ++  ++I+P    + + R + I     K  +A+ E ++
Sbjct: 9   PLIPDVWEMLI--TGIGFVILLFIAIKYIVPAFEKVFKDRADAIEGGLAKAKAAQAEAKA 66

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
               Y + L  AR  A++I ++  +  E+ L   ++    +      NA   I+  +  A
Sbjct: 67  ARDEYNQQLESARLEAQKIREEARSEGEKILADFKDRANMESARITENAHKAIEAERAAA 126

Query: 135 SQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
              +   VG +   L  K+       D    +++DR    +DA
Sbjct: 127 VVSLRDEVGTLATQLASKIVGESLNDDDRANRVVDRFLADLDA 169


>gi|145295347|ref|YP_001138168.1| F0F1 ATP synthase subunit B [Corynebacterium glutamicum R]
 gi|226741418|sp|A4QDG9|ATPF_CORGB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|140845267|dbj|BAF54266.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 188

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I   V  + +LP+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 30  IVWSLIPFLIILIVFWKLVLPKFQEVLTEREDRIKGGIQRAEAAQAEAKAALEKYNAQLA 89

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A EI ++     +Q     ++   ++    + +   ++   +++   E+   +G+
Sbjct: 90  EARTEAAEIREQARERGKQIEAELKDKANEESNRIIESGSKQLLAQREQVVNELRREMGQ 149

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L   L       +V++   +DR    +D
Sbjct: 150 NSINLAEHLLGDQLSDNVKRSGTIDRFLADLD 181


>gi|15925097|ref|NP_372631.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927681|ref|NP_375214.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283760|ref|NP_646848.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49486900|ref|YP_044121.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57652129|ref|YP_186914.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           COL]
 gi|82751708|ref|YP_417449.1| F0F1 ATP synthase subunit B [Staphylococcus aureus RF122]
 gi|87162300|ref|YP_494708.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196011|ref|YP_500824.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|148268558|ref|YP_001247501.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150394622|ref|YP_001317297.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           JH1]
 gi|151222223|ref|YP_001333045.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156980422|ref|YP_001442681.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161510314|ref|YP_001575973.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141626|ref|ZP_03566119.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315775|ref|ZP_04838988.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|253731055|ref|ZP_04865220.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733059|ref|ZP_04867224.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006895|ref|ZP_05145496.2| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257426246|ref|ZP_05602661.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428904|ref|ZP_05605298.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431513|ref|ZP_05607886.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257434222|ref|ZP_05610572.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257437135|ref|ZP_05613175.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793865|ref|ZP_05642844.1| ATP synthase F0, B subunit [Staphylococcus aureus A9781]
 gi|258407033|ref|ZP_05680183.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9763]
 gi|258422055|ref|ZP_05684972.1| ATP synthase F0, B subunit [Staphylococcus aureus A9719]
 gi|258422893|ref|ZP_05685793.1| ATP synthase F0, B subunit [Staphylococcus aureus A9635]
 gi|258433576|ref|ZP_05688649.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9299]
 gi|258440471|ref|ZP_05690641.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A8115]
 gi|258445679|ref|ZP_05693857.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6300]
 gi|258450133|ref|ZP_05698228.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6224]
 gi|258453183|ref|ZP_05701174.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A5948]
 gi|258453412|ref|ZP_05701394.1| ATP synthase F0, B subunit [Staphylococcus aureus A5937]
 gi|262049274|ref|ZP_06022149.1| ATP synthase B chain [Staphylococcus aureus D30]
 gi|269203743|ref|YP_003283012.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894751|ref|ZP_06302977.1| ATP synthase F0, B subunit [Staphylococcus aureus A8117]
 gi|282911672|ref|ZP_06319471.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914956|ref|ZP_06322736.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M899]
 gi|282923095|ref|ZP_06330780.1| ATP synthase F0, B subunit [Staphylococcus aureus A9765]
 gi|282925496|ref|ZP_06333150.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282929031|ref|ZP_06336616.1| ATP synthase F0, B subunit [Staphylococcus aureus A10102]
 gi|284025141|ref|ZP_06379539.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           132]
 gi|293509024|ref|ZP_06667811.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510939|ref|ZP_06669638.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|293547541|ref|ZP_06672216.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294850077|ref|ZP_06790814.1| ATP synthase F0 [Staphylococcus aureus A9754]
 gi|295407037|ref|ZP_06816839.1| ATP synthase F0 [Staphylococcus aureus A8819]
 gi|296275414|ref|ZP_06857921.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297210072|ref|ZP_06926465.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297246036|ref|ZP_06929893.1| ATP synthase F0 [Staphylococcus aureus A8796]
 gi|300910435|ref|ZP_07127887.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304379288|ref|ZP_07362027.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|81648901|sp|Q6G7K3|ATPF_STAAS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81694059|sp|Q5HE93|ATPF_STAAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81704255|sp|Q7A0C4|ATPF_STAAW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81705321|sp|Q7A4E7|ATPF_STAAN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81781174|sp|Q99SF1|ATPF_STAAM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122540612|sp|Q2G2F8|ATPF_STAA8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123484936|sp|Q2FF20|ATPF_STAA3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123548233|sp|Q2YUJ7|ATPF_STAAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695871|sp|A7X4U9|ATPF_STAA1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695872|sp|A6U3J2|ATPF_STAA2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695874|sp|A5IUQ2|ATPF_STAA9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695875|sp|A6QIV1|ATPF_STAAE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695876|sp|A8YY74|ATPF_STAAT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13701901|dbj|BAB43193.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus N315]
 gi|14247880|dbj|BAB58269.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu50]
 gi|21205202|dbj|BAB95896.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus MW2]
 gi|49245343|emb|CAG43818.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57286315|gb|AAW38409.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           COL]
 gi|82657239|emb|CAI81680.1| ATP synthase B chain [Staphylococcus aureus RF122]
 gi|87128274|gb|ABD22788.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203569|gb|ABD31379.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741627|gb|ABQ49925.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947074|gb|ABR53010.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           JH1]
 gi|150375023|dbj|BAF68283.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722557|dbj|BAF78974.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus Mu3]
 gi|160369123|gb|ABX30094.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating
           F-type ATPase epsilon subunit subunit B [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|253725182|gb|EES93911.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728967|gb|EES97696.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257270951|gb|EEV03124.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274246|gb|EEV05763.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257277754|gb|EEV08424.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257280861|gb|EEV11006.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283528|gb|EEV13655.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787837|gb|EEV26177.1| ATP synthase F0, B subunit [Staphylococcus aureus A9781]
 gi|257841366|gb|EEV65810.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9763]
 gi|257841955|gb|EEV66387.1| ATP synthase F0, B subunit [Staphylococcus aureus A9719]
 gi|257846917|gb|EEV70931.1| ATP synthase F0, B subunit [Staphylococcus aureus A9635]
 gi|257849307|gb|EEV73286.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A9299]
 gi|257852540|gb|EEV76458.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A8115]
 gi|257855518|gb|EEV78455.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6300]
 gi|257856607|gb|EEV79513.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A6224]
 gi|257859129|gb|EEV81986.1| F0F1 ATP synthase subunit B [Staphylococcus aureus A5948]
 gi|257864393|gb|EEV87139.1| ATP synthase F0, B subunit [Staphylococcus aureus A5937]
 gi|259162639|gb|EEW47206.1| ATP synthase B chain [Staphylococcus aureus D30]
 gi|262076033|gb|ACY12006.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941706|emb|CBI50113.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282312897|gb|EFB43298.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C101]
 gi|282321159|gb|EFB51490.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324437|gb|EFB54750.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282589337|gb|EFB94429.1| ATP synthase F0, B subunit [Staphylococcus aureus A10102]
 gi|282593286|gb|EFB98283.1| ATP synthase F0, B subunit [Staphylococcus aureus A9765]
 gi|282762839|gb|EFC02973.1| ATP synthase F0, B subunit [Staphylococcus aureus A8117]
 gi|283471324|emb|CAQ50535.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           ST398]
 gi|285817771|gb|ADC38258.1| ATP synthase B chain [Staphylococcus aureus 04-02981]
 gi|290919661|gb|EFD96734.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291094728|gb|EFE25000.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466224|gb|EFF08751.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           M809]
 gi|294823025|gb|EFG39457.1| ATP synthase F0 [Staphylococcus aureus A9754]
 gi|294968062|gb|EFG44089.1| ATP synthase F0 [Staphylococcus aureus A8819]
 gi|296885272|gb|EFH24212.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297177035|gb|EFH36290.1| ATP synthase F0 [Staphylococcus aureus A8796]
 gi|298695381|gb|ADI98603.1| ATP synthase B chain [Staphylococcus aureus subsp. aureus ED133]
 gi|300888277|gb|EFK83468.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302333753|gb|ADL23946.1| ATP synthase subunit beta, AtpB_1 [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302751988|gb|ADL66165.1| ATP synthase subunit beta, AtpB_1 [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304342147|gb|EFM08047.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312437475|gb|ADQ76546.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312830459|emb|CBX35301.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315128778|gb|EFT84778.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315196959|gb|EFU27301.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140721|gb|EFW32573.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143697|gb|EFW35474.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323439344|gb|EGA97068.1| F0F1 ATP synthase subunit B [Staphylococcus aureus O11]
 gi|323442447|gb|EGB00076.1| F0F1 ATP synthase subunit B [Staphylococcus aureus O46]
 gi|329314792|gb|AEB89205.1| ATP synthase subunit b [Staphylococcus aureus subsp. aureus T0131]
 gi|329723970|gb|EGG60494.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21189]
 gi|329726377|gb|EGG62845.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21172]
 gi|329729274|gb|EGG65682.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           21193]
          Length = 173

 Score = 83.7 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 62/149 (41%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F +   +  +F    L  +M+ R   I+ D +  + AK   + +    ++ L 
Sbjct: 21  VIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLK 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   ++I++     A Q  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 81  ETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSE 140

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D + ++D+    
Sbjct: 141 LSVLIASKVLRKEISEQDQKALVDKYLKE 169


>gi|329726099|gb|EGG62571.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU144]
          Length = 171

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F I   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L   +
Sbjct: 22  TLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKETQ 81

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              ++I+D     A +  E       +     +  AQ+EI+  +++A  ++ + V E++ 
Sbjct: 82  DEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVSELSV 141

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
            +  K L   +S+ D ++++++    
Sbjct: 142 LIASKVLRKEISEQDQKELVEKYLKE 167


>gi|251812180|ref|ZP_04826653.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282876485|ref|ZP_06285351.1| ATP synthase F0, B subunit [Staphylococcus epidermidis SK135]
 gi|251804277|gb|EES56934.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281294737|gb|EFA87265.1| ATP synthase F0, B subunit [Staphylococcus epidermidis SK135]
 gi|329735666|gb|EGG71949.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU028]
          Length = 171

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F I   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L   +
Sbjct: 22  TLVTFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKETQ 81

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              ++I+D     A +  E       +     +  AQ+EI+  +++A  ++ + V E++ 
Sbjct: 82  DEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVSELSV 141

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
            +  K L   +S+ D ++++++    
Sbjct: 142 LIASKVLRKEISEQDQKELVEKYLKE 167


>gi|315608097|ref|ZP_07883090.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
 gi|315250566|gb|EFU30562.1| ATP synthase F0 sector subunit B [Prevotella buccae ATCC 33574]
          Length = 172

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 70/155 (45%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW+ + F + + V  +F  P + +++E R+  I     K   A   +E++    E 
Sbjct: 12  LGLLFWMLLAFLVVFGVLAKFGFPAIINMVEERKKYIDESLRKAHEASERLENIKQEGES 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR    +I+ +     +  +E  +E   ++    LS+A+ +I+  ++ A +++   
Sbjct: 72  MLKEAREKQAQIMKEAAGTRDAIVENAQEKAREESARLLSDAKRQIESEKQNAIRDIRMQ 131

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V E++  +  K+      SD     ++DR  D + 
Sbjct: 132 VAELSVQIAEKILREKLSSDDKQMDMVDRLLDEVS 166


>gi|325832082|ref|ZP_08165179.1| ATP synthase F0, B subunit [Eggerthella sp. HGA1]
 gi|325486403|gb|EGC88855.1| ATP synthase F0, B subunit [Eggerthella sp. HGA1]
          Length = 206

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 36/172 (20%), Positives = 78/172 (45%), Gaps = 3/172 (1%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
             + S           +++F  + +IF + + V  +F  P+  +++E R   I    EK 
Sbjct: 34  EGESSGGLSAILPD--MAEFIPMLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKS 91

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
           + A+ E E ++  Y+  L  A+A A +I+       E       +  + +    +  A N
Sbjct: 92  EQARVESERVLEEYKRQLEDAKAQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHN 151

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDAF 176
            I+  +K A  E+   V +++  +  + +G  ++DA+ +KI++R  +   +F
Sbjct: 152 AIEAEKKAAISELQGSVADLSISVASRLIGEDLNDAEHRKIIERYVNEAGSF 203


>gi|293627818|gb|ADE58440.1| ATP synthase beta-chain [Bartonella quintana]
          Length = 148

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 51/146 (34%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           FFWLAI FG+FY    R I+PR+  ++E RR+ I+SD ++    K+E ++++ +YE  LA
Sbjct: 1   FFWLAISFGLFYLFISRVIVPRIGDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLA 60

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR+ A  I        +Q +E +R   E  L  KL +A+ +I  ++ KA Q V SI  E
Sbjct: 61  QARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQIAKIRDKAMQNVGSIAEE 120

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRK 169
              ++V+K +   VS   V+  +   
Sbjct: 121 AALEIVKKMIDVDVSRESVRSAVKAA 146


>gi|227892674|ref|ZP_04010479.1| F0F1 ATP synthase subunit B [Lactobacillus ultunensis DSM 16047]
 gi|227865545|gb|EEJ72966.1| F0F1 ATP synthase subunit B [Lactobacillus ultunensis DSM 16047]
          Length = 169

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 65/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   +    +S +ME RR  + +D +   S +++ E++ +  
Sbjct: 13  IYLGNAIWYLICFAILMLLVKHYAWGPVSDMMEKRRQKVINDLDAAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+    + A+   +       +D       A  E    +  A     
Sbjct: 73  EAALKNSRQEATQILSDAKSNAQNTGKEIVASANEDAAAIRKKANEEAAKAKTDALNSAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+   G+D
Sbjct: 133 DQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|49484331|ref|YP_041555.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|282904776|ref|ZP_06312650.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906451|ref|ZP_06314302.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909420|ref|ZP_06317235.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282920285|ref|ZP_06328009.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|283958887|ref|ZP_06376332.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|295428694|ref|ZP_06821320.1| ATP synthase F0 [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297589826|ref|ZP_06948466.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus MN8]
 gi|81650653|sp|Q6GEW8|ATPF_STAAR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|49242460|emb|CAG41176.1| putative ATP synthase subunit b [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|282316145|gb|EFB46526.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C427]
 gi|282326690|gb|EFB56988.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330401|gb|EFB59919.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282594809|gb|EFB99786.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           C160]
 gi|283789605|gb|EFC28428.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|295127364|gb|EFG57004.1| ATP synthase F0 [Staphylococcus aureus subsp. aureus EMRSA16]
 gi|297576954|gb|EFH95668.1| ATP synthase F0 sector subunit B [Staphylococcus aureus subsp.
           aureus MN8]
 gi|315193272|gb|EFU23670.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 173

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 62/149 (41%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F +   +  +F    L  +M+ R   I+ D +  + AK   + +    ++ L 
Sbjct: 21  VIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLK 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   ++I++     A Q  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 81  ETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSE 140

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D + ++D+    
Sbjct: 141 LSVLIASKVLRKEISEQDQKALVDKYLKE 169


>gi|315038008|ref|YP_004031576.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1112]
 gi|325956461|ref|YP_004291873.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus 30SC]
 gi|312276141|gb|ADQ58781.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1112]
 gi|325333026|gb|ADZ06934.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus 30SC]
          Length = 169

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   +    +S +ME RR  + +D +   S +++ E++ +  
Sbjct: 13  IYLGNAIWYLICFAILLLLVKHYAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+      A+   +       +D       A  E    +  A     
Sbjct: 73  EAALKNSRQEATQILSDAKTNAQNTGKEIVASANEDAAAIRKKANEEAAKAKSDALNAAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+   G+D
Sbjct: 133 DQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|256825633|ref|YP_003149593.1| ATP synthase F0 subcomplex B subunit [Kytococcus sedentarius DSM
           20547]
 gi|256689026|gb|ACV06828.1| ATP synthase F0 subcomplex B subunit [Kytococcus sedentarius DSM
           20547]
          Length = 192

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 35/157 (22%), Positives = 70/157 (44%), Gaps = 2/157 (1%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +L +  +  I  GI Y+V  +F +P +      RR+ I     + + A+ E  +    YE
Sbjct: 26  YLPELIFGLIAIGIVYYVASKFFVPAMEKAYAERRDAIEGGMARAEEAEAEARAAQQKYE 85

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
             LA ARA A  I +K     +     +R+  + +    L  AQ +I   +++A  ++  
Sbjct: 86  SQLAEARAEANAIREKAREEGDAIRAEKRQQADAEAARVLETAQKQIASERQQAQVQLRG 145

Query: 141 IVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
            VG ++ DL  ++       +   + ++DR    +++
Sbjct: 146 EVGRLSTDLAGRIVGESLTDETRQKGLVDRFLSELES 182


>gi|115373534|ref|ZP_01460831.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1]
 gi|115369540|gb|EAU68478.1| ATP synthase F0, B subunit [Stigmatella aurantiaca DW4/3-1]
          Length = 200

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  + F +   V        + S++E R   ISS  E     + E E +++  + 
Sbjct: 35  PGLIFWTLVTFILVAVVLRWKAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKT 94

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           ++A AR  A E++ K     E+  +       K+       A+ EI+D + KA  EV ++
Sbjct: 95  AIAEARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTM 154

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
             ++  ++  KL    + DA  + + ++   G+ 
Sbjct: 155 AVDLAMEVAGKLLSERMDDAKHRALAEQFVQGLP 188


>gi|189465905|ref|ZP_03014690.1| hypothetical protein BACINT_02268 [Bacteroides intestinalis DSM
           17393]
 gi|224539740|ref|ZP_03680279.1| hypothetical protein BACCELL_04649 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189434169|gb|EDV03154.1| hypothetical protein BACINT_02268 [Bacteroides intestinalis DSM
           17393]
 gi|224518640|gb|EEF87745.1| hypothetical protein BACCELL_04649 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 168

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 71/153 (46%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P ++ ++E RR  I    E    A  +++ + +  E  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITKMVEGRRTYIDQSLEVAKEANAQLQRLKAESEAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L + + +I   +++A +++   V
Sbjct: 69  VAAANKEQGRILREAMHERDKIIVEARKQAEVAAQKELDDVKKQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D + ++  ++DR  D +
Sbjct: 129 AVLSVDIAEKVIRKNLDEEHEQMEMIDRMLDEV 161


>gi|288925058|ref|ZP_06418994.1| ATP synthase F0, B subunit [Prevotella buccae D17]
 gi|288338248|gb|EFC76598.1| ATP synthase F0, B subunit [Prevotella buccae D17]
          Length = 169

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 70/155 (45%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW+ + F + + V  +F  P + +++E R+  I     K   A   +E++    E 
Sbjct: 9   LGLLFWMLLAFLVVFGVLAKFGFPAIINMVEERKKYIDESLRKAHEASERLENIKQEGES 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR    +I+ +     +  +E  +E   ++    LS+A+ +I+  ++ A +++   
Sbjct: 69  MLKEAREKQAQIMKEAAGTRDAIVENAQEKAREESARLLSDAKRQIESEKQNAIRDIRMQ 128

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V E++  +  K+      SD     ++DR  D + 
Sbjct: 129 VAELSVQIAEKILREKLSSDDKQMDMVDRLLDEVS 163


>gi|108800843|ref|YP_641040.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. MCS]
 gi|119869983|ref|YP_939935.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. KMS]
 gi|126436441|ref|YP_001072132.1| F0F1 ATP synthase subunit delta [Mycobacterium sp. JLS]
 gi|123178312|sp|Q1B550|ATPFD_MYCSS RecName: Full=ATP synthase subunit b-delta; Includes: RecName:
           Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2; Includes: RecName: Full=ATP
           synthase subunit delta; AltName: Full=ATP synthase F(1)
           sector subunit delta; AltName: Full=F-type ATPase
           subunit delta; Short=F-ATPase subunit delta
 gi|226694392|sp|A3Q3B4|ATPFD_MYCSJ RecName: Full=ATP synthase subunit b-delta; Includes: RecName:
           Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2; Includes: RecName: Full=ATP
           synthase subunit delta; AltName: Full=ATP synthase F(1)
           sector subunit delta; AltName: Full=F-type ATPase
           subunit delta; Short=F-ATPase subunit delta
 gi|226694408|sp|A1UJY7|ATPFD_MYCSK RecName: Full=ATP synthase subunit b-delta; Includes: RecName:
           Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2; Includes: RecName: Full=ATP
           synthase subunit delta; AltName: Full=ATP synthase F(1)
           sector subunit delta; AltName: Full=F-type ATPase
           subunit delta; Short=F-ATPase subunit delta
 gi|108771262|gb|ABG09984.1| ATP synthase F0 subcomplex B subunit / ATP synthase F1 subcomplex
           delta subunit [Mycobacterium sp. MCS]
 gi|119696072|gb|ABL93145.1| ATP synthase F0 subcomplex B subunit / ATP synthase F1 subcomplex
           delta subunit [Mycobacterium sp. KMS]
 gi|126236241|gb|ABN99641.1| ATP synthase F1 subcomplex delta subunit / ATP synthase F0
           subcomplex B subunit [Mycobacterium sp. JLS]
          Length = 443

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 75/159 (47%), Gaps = 6/159 (3%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           STF+ Q     I F +  ++  RF++P +  +M  ++  +    E+  +A  +V      
Sbjct: 2   STFIGQL----IGFAVIVFLLVRFVVPPVRRMMTAQQETVRRQLEESSTAANKVAQADQQ 57

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
           + +++  A+A A+ ++D+  + AE+  E  R   + ++       Q ++  ++++  +E+
Sbjct: 58  HAKAVEEAKADARRVVDEARSDAEKIAEQMRAQADAEVERIKVQGQAQVQLLRQQLIREL 117

Query: 139 YSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
            S +G  +    R+L       D +    +DR  D +DA
Sbjct: 118 RSHLGTESVARARELVRDHVSDDDNRSATVDRFLDELDA 156


>gi|293627820|gb|ADE58441.1| ATP synthase beta-chain [Bartonella quintana]
          Length = 148

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 51/146 (34%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           FFWLAI FG+FY    R I+PR+  ++E RR+ I+SD ++    K+E ++++ +YE  LA
Sbjct: 1   FFWLAIFFGLFYLFISRVIVPRIGDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLA 60

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR+ A  I        +Q +E +R   E  L  KL +A+ +I  ++ KA Q V SI  E
Sbjct: 61  QARSQAHVIAQAAGEEIKQKVELERREIEASLEKKLKDAEKQIAKIRDKAMQNVGSIAEE 120

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRK 169
              ++V+K +   VS   V+  +   
Sbjct: 121 AALEIVKKMIDVDVSRESVRSAVKAA 146


>gi|149173279|ref|ZP_01851910.1| F0F1 ATP synthase subunit B [Planctomyces maris DSM 8797]
 gi|148848085|gb|EDL62417.1| F0F1 ATP synthase subunit B [Planctomyces maris DSM 8797]
          Length = 196

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 73/174 (41%), Gaps = 3/174 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
            ++        PP    T      W  I+F +F +V   F    L   ++ R   + +  
Sbjct: 22  YAAEGAEHPSGPPLHWKT--DLALWSLIVFVVFIFVLRAFAWGPLIQALDERELRVITAI 79

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
              +S ++E E ++  +   +  A+   + ++ +  + A++  +       ++     ++
Sbjct: 80  NTAESKQKESEELVKEHARKIEAAQDEIQAMMVEARSDADRIKQDVLAQARQEAESIKTH 139

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           A +EI+  ++ A ++++  +     D   + LG +++++D  ++++     I  
Sbjct: 140 AVDEIERARELALKDLFDQINGRVIDATEQVLGRALNESDRDRLINEALSQISG 193


>gi|124516449|gb|EAY57957.1| ATP synthase F0, subunit B [Leptospirillum rubarum]
          Length = 175

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 30/163 (18%), Positives = 68/163 (41%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD+  F S   W  + F +   +  + +LP L  ++E R+  + SD E     + E 
Sbjct: 1   MPQFDSRFFSSLGMWTVLSFLLMLAIVWKILLPSLVKVLEERKMRVVSDLEAARKNREES 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
            S++   +  L+ ARA A+EI+ +         E +++    ++  +L  A+ +I     
Sbjct: 61  ASILEEQKMLLSKARAQAEEILRQAEEMGRVVREEKQKEAMLEVETRLKKAEAQIKADVD 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKI-LDRKRDGID 174
           +   E+      +    +  +     +   + + ++R    ++
Sbjct: 121 RVRNELRKETVSLVVRGIESVLEESLNETQKMMFINRAIRAVE 163


>gi|19552431|ref|NP_600433.1| F0F1 ATP synthase subunit B [Corynebacterium glutamicum ATCC 13032]
 gi|62390096|ref|YP_225498.1| F0F1 ATP synthase subunit B [Corynebacterium glutamicum ATCC 13032]
 gi|81704080|sp|Q79VG9|ATPF_CORGL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|9757617|dbj|BAB08153.1| H+-ATPase b subunit [Corynebacterium glutamicum]
 gi|21323975|dbj|BAB98601.1| F0F1-type ATP synthase b subunit [Corynebacterium glutamicum ATCC
           13032]
 gi|41325432|emb|CAF19912.1| ATP synthase B chain [Corynebacterium glutamicum ATCC 13032]
          Length = 188

 Score = 83.3 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I   V  + +LP+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 30  IVWSLIPFLIILIVFWKLVLPKFQEVLTEREDRIKGGIQRAEAAQAEAKAALEKYNAQLA 89

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A EI ++     +Q     ++   ++    + +   ++   +++   E+   +G+
Sbjct: 90  EARTEAAEIREQARERGKQIEAELKDKANEESNRIIESGSKQLLAQREQVVNELRREMGQ 149

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L   L       +V++   +DR    +D
Sbjct: 150 NSINLAEHLLGDQLSDNVKRSGTIDRFLADLD 181


>gi|304382809|ref|ZP_07365292.1| ATP synthase F0 sector subunit B [Prevotella marshii DSM 16973]
 gi|304335994|gb|EFM02241.1| ATP synthase F0 sector subunit B [Prevotella marshii DSM 16973]
          Length = 170

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 2/154 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+AI+F I   V  ++  P +  ++  R+  I     K   A  ++ ++    E  
Sbjct: 9   GLLFWMAIVFIIVLAVLWKWGFPVIIKMVNDRKAYIDDSLRKAHEANEKLTNIQKESESI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR     I+ +     E  ++  +   + +    L+ A+ EI+  ++ A +++   V
Sbjct: 69  LQEAREKQATILKEAAETREAIVQATQAKAQAESSRLLAEAKAEIEGEKQNAIRDIRLQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            E++  +  K+     D +  +  ++DR  D I 
Sbjct: 129 AELSVQIAEKVLRQKLDTERSQMDMIDRLLDEIS 162


>gi|269216179|ref|ZP_06160033.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
 gi|269130438|gb|EEZ61516.1| ATP synthase F0, B subunit [Slackia exigua ATCC 700122]
          Length = 215

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 81/175 (46%), Gaps = 3/175 (1%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           + + ++ S           +++F  + + F I + +  +F  P    ++E R   I  D 
Sbjct: 40  AYAFAEESGGISAILPK--MNEFIPMLVAFVILWVILAKFGWPVFDRMLEKRATTIREDL 97

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
           +  ++A++E E +++ Y++ LA A+A A  I+ +     E      ++    +    +  
Sbjct: 98  KSAEAARQESEKLLAEYKQQLADAKAEASSIVAEAKKTGEAVKADIQKKAADEAAGMIEK 157

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDAF 176
           AQ  I+  +K+A  ++   V +++  +  K +G  +SD + + I+ R  +   +F
Sbjct: 158 AQAAIEAERKQAVSDLQKSVADISVSVASKLIGTDLSDDEHRAIIKRYVEEAGSF 212


>gi|198284883|ref|YP_002221204.1| ATP synthase F0 subunit B [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667443|ref|YP_002427563.1| ATP synthase F0, B subunit [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226694421|sp|B7JB88|ATPF_ACIF2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694422|sp|B5ER46|ATPF_ACIF5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|198249404|gb|ACH84997.1| ATP synthase F0, B subunit [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519656|gb|ACK80242.1| ATP synthase F0, B subunit [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 159

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 61/159 (38%), Gaps = 1/159 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +            + F I   + ++++   L  +M+ RR  I+      +  K E+   
Sbjct: 1   MNPVGINGTLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALA 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
                E L  A+  A EII        +  E  +    ++    +++A+ EID    +A 
Sbjct: 61  QKRATELLREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAR 120

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
           + +   V E+  +  +++    + D   + I+DR    +
Sbjct: 121 EVLRGQVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159


>gi|283771275|ref|ZP_06344164.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           H19]
 gi|283459480|gb|EFC06573.1| F0F1 ATP synthase subunit B [Staphylococcus aureus subsp. aureus
           H19]
          Length = 173

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 62/149 (41%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F +   +  +F    L  IM+ R   I+ D +  + AK   + +    ++ L 
Sbjct: 21  VIVQVLTFIVLLALLKKFAWGPLKDIMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLK 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   ++I++     A Q  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 81  ETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSE 140

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D + ++D+    
Sbjct: 141 LSVLIASKVLRKEISEQDQKALVDKYLKE 169


>gi|329962156|ref|ZP_08300165.1| ATP synthase F0, B subunit [Bacteroides fluxus YIT 12057]
 gi|328530561|gb|EGF57428.1| ATP synthase F0, B subunit [Bacteroides fluxus YIT 12057]
          Length = 168

 Score = 82.9 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P +++++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITNMVEGRKTYIDQSMEVAREANAQLAKLKEEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+        +L   + +I   +++A +++   V
Sbjct: 69  VAAANKEQGRILREAMHERDKIIVEARKQAAASAQKELDEVRKQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D   ++  ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKNLDEKHEQMEMIDRMLDEV 161


>gi|296268881|ref|YP_003651513.1| ATP synthase F0 subunit B [Thermobispora bispora DSM 43833]
 gi|296091668|gb|ADG87620.1| ATP synthase F0, B subunit [Thermobispora bispora DSM 43833]
          Length = 181

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 64/147 (43%), Gaps = 2/147 (1%)

Query: 31  IFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHA 90
            F + + V  + + PR+   +  R   I    ++    + E +  +  Y   LA AR  A
Sbjct: 29  AFLVVFLVVGKILTPRIQKTLAERTEAIEGGIKRAQELQAEAQRTLEQYRAQLAEARHEA 88

Query: 91  KEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLV 150
             + ++      +     R+  E +    +  AQ +I+  +++A  ++   +G ++ +L 
Sbjct: 89  ARLREEAREQGARIKAELRQEAEAEARRIIEAAQAQIEAERRQALIQLRGEIGRLSVELA 148

Query: 151 RKLGFSV--SDADVQKILDRKRDGIDA 175
            ++       +A  ++I+DR  + ++A
Sbjct: 149 SRIVGESLEDEARQRRIIDRFLEELEA 175


>gi|288803184|ref|ZP_06408619.1| ATP synthase F0, B subunit [Prevotella melaninogenica D18]
 gi|288334445|gb|EFC72885.1| ATP synthase F0, B subunit [Prevotella melaninogenica D18]
          Length = 170

 Score = 82.9 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F + +++  ++  P +  ++  R+  I     K + A   + ++    E+ 
Sbjct: 9   GLLFWMTLVFLVVFFILWKWGFPSIIKMVNERKEYIDESLAKAEEANLRLANIQKQGEDL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR    +I+ +     +  +   +E    +    LS A+ EI+  ++ A +++ S V
Sbjct: 69  LMEAREKQAQILREASETRDTIVGQAQEKARDESARILSEAKAEIESQKQAAIRDIRSQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
            E++  +  K+      + A+  ++++   D +
Sbjct: 129 AELSVQIAEKILHKELATSAEQTQLINSLLDEV 161


>gi|327183288|gb|AEA31735.1| F0F1 ATP synthase subunit B [Lactobacillus amylovorus GRL 1118]
          Length = 169

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   +    +S +ME RR  + +D +   S +++ E++ +  
Sbjct: 13  IYLGNAIWYLICFAILLLLVKHYAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+      A+   +       +D       A  E    +  A     
Sbjct: 73  EAALKNSRQEATQILSDAKTNAQNTGKEIVASANEDAAAIRKKANEEAAKAKSDALNAAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+   G+D
Sbjct: 133 DQVADISIAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|226947197|ref|YP_002802270.1| F0 sector of membrane-bound ATP synthase subunit B [Azotobacter
           vinelandii DJ]
 gi|226722124|gb|ACO81295.1| F0 sector of membrane-bound ATP synthase, subunit B [Azotobacter
           vinelandii DJ]
          Length = 152

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   I F IF W   +++ P L+  M+ R+  I+   +    A+++++        +L 
Sbjct: 3   LFGQTIAFAIFVWFCMKYVWPPLTQAMQERQKKIAEGLDAAGRAQQDLKLAQEKVSNTLR 62

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A +II++    A   +E  ++  + +    ++ A+ EI+    +A +E+   V  
Sbjct: 63  ESREQATQIIEQANKQANAIIEDAKQQAQSEGERLIAGAKAEIEQEVNRAREELRKQVAA 122

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    V      K++++    +
Sbjct: 123 LAILGAEKILESKVDTKAHNKLVEKLASQL 152


>gi|227877277|ref|ZP_03995350.1| F0F1 ATP synthase subunit B [Lactobacillus crispatus JV-V01]
 gi|256842840|ref|ZP_05548328.1| ATP synthase F0, B subunit [Lactobacillus crispatus 125-2-CHN]
 gi|256848796|ref|ZP_05554230.1| H+-transporting ATP synthase chain b [Lactobacillus crispatus
           MV-1A-US]
 gi|262045806|ref|ZP_06018770.1| ATP synthase F0, B subunit [Lactobacillus crispatus MV-3A-US]
 gi|293381675|ref|ZP_06627656.1| ATP synthase F0, B subunit [Lactobacillus crispatus 214-1]
 gi|295692629|ref|YP_003601239.1| ATP synthase subunit b [Lactobacillus crispatus ST1]
 gi|312977640|ref|ZP_07789387.1| ATP synthase F0, B subunit [Lactobacillus crispatus CTV-05]
 gi|227863133|gb|EEJ70579.1| F0F1 ATP synthase subunit B [Lactobacillus crispatus JV-V01]
 gi|256614260|gb|EEU19461.1| ATP synthase F0, B subunit [Lactobacillus crispatus 125-2-CHN]
 gi|256714335|gb|EEU29322.1| H+-transporting ATP synthase chain b [Lactobacillus crispatus
           MV-1A-US]
 gi|260573765|gb|EEX30321.1| ATP synthase F0, B subunit [Lactobacillus crispatus MV-3A-US]
 gi|290921722|gb|EFD98743.1| ATP synthase F0, B subunit [Lactobacillus crispatus 214-1]
 gi|295030735|emb|CBL50214.1| ATP synthase subunit B [Lactobacillus crispatus ST1]
 gi|310895379|gb|EFQ44446.1| ATP synthase F0, B subunit [Lactobacillus crispatus CTV-05]
          Length = 168

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   F    +S +ME RR  +  D +   S +++ E++ +  
Sbjct: 12  IYLGNAIWYLICFAILMLLIKHFAWGPVSDMMEKRRQKVIDDLDSAASERKKAETLANER 71

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+    + A+   +       +D       A  +    +  A     
Sbjct: 72  EAALKNSRQEATQILSDAKSNAQNTSKEIVANANEDAAAIRKKANEDAAQAKADALNSAR 131

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+   G+D
Sbjct: 132 DQVADISVAIAEKVIAKNLSAKDQKDLVDQFIKGLD 167


>gi|150005514|ref|YP_001300258.1| ATP synthase B subunit [Bacteroides vulgatus ATCC 8482]
 gi|212695021|ref|ZP_03303149.1| hypothetical protein BACDOR_04559 [Bacteroides dorei DSM 17855]
 gi|237710543|ref|ZP_04541024.1| ATP synthase B subunit [Bacteroides sp. 9_1_42FAA]
 gi|237727039|ref|ZP_04557520.1| ATP synthase B subunit [Bacteroides sp. D4]
 gi|254884063|ref|ZP_05256773.1| ATP synthase B subunit [Bacteroides sp. 4_3_47FAA]
 gi|265750319|ref|ZP_06086382.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_33FAA]
 gi|294778716|ref|ZP_06744135.1| ATP synthase F0, B subunit [Bacteroides vulgatus PC510]
 gi|319640737|ref|ZP_07995450.1| ATP synthase subunit B [Bacteroides sp. 3_1_40A]
 gi|226741355|sp|A6L4M2|ATPF_BACV8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149933938|gb|ABR40636.1| ATP synthase B subunit [Bacteroides vulgatus ATCC 8482]
 gi|212662337|gb|EEB22911.1| hypothetical protein BACDOR_04559 [Bacteroides dorei DSM 17855]
 gi|229433895|gb|EEO43972.1| ATP synthase B subunit [Bacteroides dorei 5_1_36/D4]
 gi|229455265|gb|EEO60986.1| ATP synthase B subunit [Bacteroides sp. 9_1_42FAA]
 gi|254836856|gb|EET17165.1| ATP synthase B subunit [Bacteroides sp. 4_3_47FAA]
 gi|263237215|gb|EEZ22665.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_33FAA]
 gi|294447372|gb|EFG15953.1| ATP synthase F0, B subunit [Bacteroides vulgatus PC510]
 gi|317387549|gb|EFV68415.1| ATP synthase subunit B [Bacteroides sp. 3_1_40A]
          Length = 166

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ I+FGI + +  ++  P ++ +++ R+  I         A  ++ ++ +  E  
Sbjct: 9   GLLFWMVIVFGIVFVILAKYGFPVITRMVDERKQYIDKSLLAAREANEQLANIKADSEMI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA A      I+++ VA  E+ L+  +   + +    L  A+ +I   +  A  ++   V
Sbjct: 69  LAKAHEEQARILNEAVATRERILKEAKTQAQVEGQKLLDEAKKQIQAEKDSAISDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+       + +  +++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKNLDDEKEQMEMIDRLLDEL 161


>gi|295697751|ref|YP_003590989.1| ATP synthase F0, B subunit [Bacillus tusciae DSM 2912]
 gi|295413353|gb|ADG07845.1| ATP synthase F0, B subunit [Bacillus tusciae DSM 2912]
          Length = 161

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 57/147 (38%), Gaps = 1/147 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I  W   +F    L  ++  RR  I +     +  + E E ++  +   +  AR 
Sbjct: 12  LIAFLILLWFLSKFAWKPLVKMLNDRREYIENQLSSAEREREEAERVLEEHRALVEKARQ 71

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E ++     +E+         E +       A  EI   ++KA  E+   VGE++  
Sbjct: 72  DAHEWMENARRTSERQAAEILAAAETEARRIKEEALAEIQSEKEKALAELRDQVGELSVM 131

Query: 149 LVRKL-GFSVSDADVQKILDRKRDGID 174
           L  ++    +     ++++DR    + 
Sbjct: 132 LAGRILAKELDAKSHRELVDRALAEMG 158


>gi|158312874|ref|YP_001505382.1| F0F1 ATP synthase subunit B [Frankia sp. EAN1pec]
 gi|226741457|sp|A8L3W1|ATPF_FRASN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|158108279|gb|ABW10476.1| ATP synthase F0, B subunit [Frankia sp. EAN1pec]
          Length = 193

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L++     + FG+        I P++      R   I     + + A+RE ++++  Y  
Sbjct: 25  LAELIVGLLAFGLLVGFFFWKIYPQIRKTYAERAERIEGGLNRAERAEREAQALLEQYRS 84

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR+ A  I +   A   Q +E  R   ++++      A   +   + +    V   
Sbjct: 85  QLAEARSEAARIREDAQAQGRQIVEELRTQVQQEVAEIRERADAALVAERAQVVASVRRE 144

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +GE+  +L  ++      +D   ++++D    G+D 
Sbjct: 145 IGEIALELATRIVGRELENDTRQRQLVDDFIAGLDE 180


>gi|325291358|ref|YP_004267539.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324966759|gb|ADY57538.1| ATP synthase F0 subcomplex B subunit [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 185

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 35/175 (20%), Positives = 72/175 (41%), Gaps = 6/175 (3%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +AS ++S        FD +          + F I  ++  +F    L  +ME RR  I  
Sbjct: 12  VASEAASGEGGALIGFDYTLPA-----QMLSFLILVYILAKFAWRPLMDMMEKRRQFIED 66

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           +  + ++ ++E E +   Y+E +  AR  A+EII+K    +E+           D     
Sbjct: 67  NLSRAENERKEAEKIKKEYQEEMRKARQEAQEIINKATKISEERASEILAEARIDSEKTK 126

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
             A  +I   +  A  EV + V +++  +  K+    ++    + ++D+    + 
Sbjct: 127 QAALADIQRERDNAVLEVKAQVADMSVAVAEKILRAKLNLEGQETLIDQFIQEVG 181


>gi|229489993|ref|ZP_04383846.1| ATP synthase F0, B subunit [Rhodococcus erythropolis SK121]
 gi|229323094|gb|EEN88862.1| ATP synthase F0, B subunit [Rhodococcus erythropolis SK121]
          Length = 186

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 77/176 (43%), Gaps = 8/176 (4%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A+  +++ +    P    T+     W A+   +  +V  + +LP+   ++  R   I  
Sbjct: 8   LAAEGTTEHN----PLIPETYD--IVWSAVALVVVGFVFWKLVLPKFQKVLAERTEQIEG 61

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             +K + A+ E  + +  Y   LA AR  A +I ++     +Q +   +   + +    +
Sbjct: 62  GIKKAEDAQAEAAAALEQYRAQLAEARTEAAQIREEARTQGQQIIADMKVQAQDESDRIV 121

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGID 174
           +   +++   +++   E+ S +G+   DL  K+       DV++   +DR  + +D
Sbjct: 122 AAGHSQLVAQRQQIVAELRSDLGKTAVDLAEKVIGESLADDVKRAGTVDRFLNELD 177


>gi|218130972|ref|ZP_03459776.1| hypothetical protein BACEGG_02574 [Bacteroides eggerthii DSM 20697]
 gi|317476283|ref|ZP_07935533.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|217986844|gb|EEC53176.1| hypothetical protein BACEGG_02574 [Bacteroides eggerthii DSM 20697]
 gi|316907557|gb|EFV29261.1| ATP synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 166

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P ++ ++E RR  I    E    A  ++  +    E  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITKMVEGRRTYIDQSLEVARQANIQLAKLKEESEAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L + + +I   +++A +++   V
Sbjct: 69  IAAANKEQGRIMREAMHERDKIIIEARKHAEAVAQKELDDVKQQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D   ++  ++DR  D +
Sbjct: 129 AVLSVDIAEKIIRRNLDEKHEQMEMIDRMLDEM 161


>gi|728929|sp|P41172|ATPF_THIFE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|154670|gb|AAA53123.1| F1F0-ATPase b subunit [Acidithiobacillus ferrooxidans]
          Length = 159

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 61/159 (38%), Gaps = 1/159 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +            + F I   + ++++   L  +M+ RR  I+      +  K E+   
Sbjct: 1   MNPVGINGTLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALA 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
                E +  A+  A EII        +  E  +    ++    +++A+ EID    +A 
Sbjct: 61  QKRATELVREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAR 120

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
           + +   V E+  +  +++    + D   + I+DR    +
Sbjct: 121 EVLRGQVVELVVNGTQRILHREIDDQTHRDIIDRMVGQL 159


>gi|314934176|ref|ZP_07841537.1| ATP synthase F0, B subunit [Staphylococcus caprae C87]
 gi|313653081|gb|EFS16842.1| ATP synthase F0, B subunit [Staphylococcus caprae C87]
          Length = 171

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 59/146 (40%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
               F I   +  +F    L  +M+ R   I+   +  + AK   + +     ++L   +
Sbjct: 22  TLATFVILLALLKKFAWGPLKEVMDKRERDINKYIDDAEQAKINAQKLEEENRKTLKETQ 81

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              + I+D     A +  E             +  AQ+EI+  +++A  ++ + V E++ 
Sbjct: 82  DEVQRILDDAKIQARKQHEEIIHEANVRANGMIETAQSEINSEKERALADINNQVSELSV 141

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
            +  K L   +S+ D + ++++    
Sbjct: 142 LIASKVLRKEISEQDQKDLVEKYLKE 167


>gi|92115403|ref|YP_575331.1| F0F1 ATP synthase subunit B [Chromohalobacter salexigens DSM 3043]
 gi|122419022|sp|Q1QSC6|ATPF_CHRSD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91798493|gb|ABE60632.1| ATP synthase F0 subcomplex B subunit [Chromohalobacter salexigens
           DSM 3043]
          Length = 156

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +F+ P +   ++ R+  I+   +    A R++E       E L 
Sbjct: 7   LIGQAIAFAVFVWFCMKFVWPPVMQALQERQKKIADGLDAASRATRDLELAQEQAAEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ++  A +II++    A Q +E  R+    +    + +A+ EI+   ++A +E+ + V  
Sbjct: 67  ESKEQAAQIIEQAHKRANQMIEEARDNARLEGERMIESARGEIEQETQRAKEELRTQVAA 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      ++   S+ +A  ++++D+    +
Sbjct: 127 LAIQGAERILDSSIDEAKHRELVDKLAAEL 156


>gi|242371598|ref|ZP_04817172.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis M23864:W1]
 gi|242350665|gb|EES42266.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis M23864:W1]
          Length = 171

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 61/146 (41%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
               F +   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L   +
Sbjct: 22  TIATFVVLLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKVNAQKLEEENRKTLKETQ 81

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              ++I+D     A +  E             +  AQ+EI+  +++A  ++ + V E++ 
Sbjct: 82  DEVQKILDDAKIQARKQHEEIIHEANVRANGMIETAQSEINSQKERALADINNQVSELSV 141

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
            +  K L   +S+ D + ++++    
Sbjct: 142 LIASKVLRKEISEQDQKALVEKYLKE 167


>gi|257790795|ref|YP_003181401.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|317488493|ref|ZP_07947044.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
 gi|257474692|gb|ACV55012.1| ATP synthase F0, B subunit [Eggerthella lenta DSM 2243]
 gi|316912425|gb|EFV33983.1| ATP synthase [Eggerthella sp. 1_3_56FAA]
          Length = 206

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
           + +IF + + V  +F  P+  +++E R   I    EK + A+ E E ++  Y+  L  A+
Sbjct: 54  MLVIFILLWIVLAKFGWPKFEAMLEKREMTIKDSLEKSEQARVESERVLEEYKRQLEDAK 113

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+       E       +  + +    +  A N I+  +K A  E+   V +++ 
Sbjct: 114 AQAAQIVADAKKTGEAVKADITDKAQSEATAMIEKAHNAIEAEKKAAISELQGSVADLSV 173

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGIDAF 176
            +  + +G  ++DA+ +KI++R  +   +F
Sbjct: 174 SVASRLIGEDLNDAEHRKIIERYVNEAGSF 203


>gi|226326993|ref|ZP_03802511.1| hypothetical protein PROPEN_00853 [Proteus penneri ATCC 35198]
 gi|225204830|gb|EEG87184.1| hypothetical protein PROPEN_00853 [Proteus penneri ATCC 35198]
          Length = 165

 Score = 82.5 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 64/133 (48%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               A+ F +F     +F+ P + + +E R+  I+      + AK++++   +   + LA
Sbjct: 7   ILGQAVAFVLFVLFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAKADAGDQLA 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II+       Q +E  +   E++    ++ AQ+E+D  +K+A +E+   V  
Sbjct: 67  KAKAEAQAIIESANKQRTQMIEDAKAEAEQERSKIVAQAQSELDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGFSV 157
           +      K+  +V
Sbjct: 127 LAIAGAEKILLNV 139


>gi|284038094|ref|YP_003388024.1| ATP synthase F0 subunit beta [Spirosoma linguale DSM 74]
 gi|283817387|gb|ADB39225.1| ATP synthase F0, B subunit [Spirosoma linguale DSM 74]
          Length = 164

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 61/153 (39%), Gaps = 2/153 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW  ++F   + +   F    ++  +  R N I S  +  +  + E+ ++ +  E+
Sbjct: 8   LGLLFWQVVVFLGLFLILRAFAWKPITESLNERENNIQSALDLAEKTRLEMTALKADNEK 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR+  + I+      A++ +   RE    +    L  A+  + + +     ++   
Sbjct: 68  LLAQARSEREAILRGAKETADKLMAETREKASAEGQRILEQARESMQNERLALVAQMKKE 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDG 172
           V  ++ D+  K+        A  +K++      
Sbjct: 128 VVTLSLDIAEKVLRKELSDKASQEKLVTDLVSN 160


>gi|313903640|ref|ZP_07837030.1| ATP synthase F0, B subunit [Thermaerobacter subterraneus DSM 13965]
 gi|313466193|gb|EFR61717.1| ATP synthase F0, B subunit [Thermaerobacter subterraneus DSM 13965]
          Length = 160

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
            +  W  I F +F  V  RF    +  +++ RR  I  +    + A+ E     + Y + 
Sbjct: 5   PELIWAFINFFLFVIVLARFFWRPVMELLDRRREEIEVNLAAAERAREEAARAEAEYRQR 64

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA+A+  A+ I+++    AEQ  + + E   ++    L  A+  I+  +++A   +   V
Sbjct: 65  LAVAQREAQSILERATQLAEQERQERLEAARREAEQLLERARATIEREKEQAIAALRREV 124

Query: 143 GEVTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
            ++T     + LG  +   D ++++    + +
Sbjct: 125 ADLTLLATERVLGRVLDAEDQRRLVTEAVEEV 156


>gi|281423285|ref|ZP_06254198.1| ATP synthase F0, B subunit [Prevotella oris F0302]
 gi|299140475|ref|ZP_07033613.1| ATP synthase F0, B subunit [Prevotella oris C735]
 gi|281402621|gb|EFB33452.1| ATP synthase F0, B subunit [Prevotella oris F0302]
 gi|298577441|gb|EFI49309.1| ATP synthase F0, B subunit [Prevotella oris C735]
          Length = 172

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/156 (18%), Positives = 67/156 (42%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW+ + F + +    RF  P +  +++ R+  I     K   A   + ++    E 
Sbjct: 12  LGLLFWMLLAFLVVFICLARFGFPVIIKMVDERKQYIDESLNKAHEASERLANIKQEGET 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR    +I+ +     +  +E  ++   ++    +S A+ +I+  ++ A +++ S 
Sbjct: 72  LLQEAREQQAKIMKEAATTRDAIIEQAQDKAREESTRIISEAKKQIEVEKQSAIRDIRSQ 131

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           V E++  +  K+      +D     ++DR  D +  
Sbjct: 132 VAELSIQVAEKILREKLSNDKAQMDMIDRLLDEVSE 167


>gi|302869582|ref|YP_003838219.1| ATP synthase F0 subunit B [Micromonospora aurantiaca ATCC 27029]
 gi|315503956|ref|YP_004082843.1| ATP synthase f0, b subunit [Micromonospora sp. L5]
 gi|302572441|gb|ADL48643.1| ATP synthase F0, B subunit [Micromonospora aurantiaca ATCC 27029]
 gi|315410575|gb|ADU08692.1| ATP synthase F0, B subunit [Micromonospora sp. L5]
          Length = 179

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 66/148 (44%), Gaps = 2/148 (1%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F +  +V  +F+ PR+    + R + I    ++ ++A+ E   ++  Y   LA AR  
Sbjct: 28  IAFIVLCFVLMKFVFPRMEQTFQARVDAIEGGIKRAEAAQAEANQLLEQYRAQLAEARTD 87

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A +I D   A AE   +       ++    ++  + ++   +    +E+ + VG +  DL
Sbjct: 88  AAKIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLAAERATIVRELRTEVGTIAVDL 147

Query: 150 VRKLGFS--VSDADVQKILDRKRDGIDA 175
             K+       +A  +  +DR   G+++
Sbjct: 148 ASKIVGESLADEARRKGTVDRFLSGLES 175


>gi|114567892|ref|YP_755046.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|122317241|sp|Q0AUC9|ATPF_SYNWW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114338827|gb|ABI69675.1| F0F1-type ATP synthase subunit b-like protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 173

 Score = 82.1 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 66/149 (44%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W A+ F +   + ++F    +++++E R N I    +  +  K EVE M      +LA
Sbjct: 19  IGWSAVNFLVLLALMYKFAYGPINNMLEQRTNAIEGSLKHAEEVKLEVEQMRKETASNLA 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A+EI+ +   AAE++        +++     + A  EI    ++A  E+      
Sbjct: 79  ESRKEAQEIVARATKAAEESKNEIIAKAKEESTLIKNKAAAEIQAATEQAKLELKDSAVS 138

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           +      K L  +++D D + ++ +  + 
Sbjct: 139 LAILAAEKVLSRAINDDDHKNLVKQFVNE 167


>gi|312882257|ref|ZP_07742003.1| F0F1 ATP synthase subunit B [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370101|gb|EFP97607.1| F0F1 ATP synthase subunit B [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 156

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 65/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+   +  + A ++++   ++  + L  A+ 
Sbjct: 11  AISFALFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EIID+      Q ++  RE  + +  + L+ A+ EI+  + +A  E+   V  +   
Sbjct: 71  TATEIIDQANKRKAQIIDEAREEAQTERQNILTQAEAEIEAERNRARDELRKQVATLAVA 130

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D QK +    
Sbjct: 131 GAEKILERSIDKDAQKDILDNI 152


>gi|282917456|ref|ZP_06325209.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           D139]
 gi|282318658|gb|EFB49015.1| ATP synthase F0, B subunit [Staphylococcus aureus subsp. aureus
           D139]
          Length = 173

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 62/149 (41%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F +   +  +F    L  +M+ R   I+ D +  + AK   + +    ++ L 
Sbjct: 21  VIVQVLTFIVLLALLEKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLK 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   ++I++     A Q  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 81  ETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSE 140

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D + ++D+    
Sbjct: 141 LSVLIASKVLRKEISEQDQKALVDKYLKE 169


>gi|160890318|ref|ZP_02071321.1| hypothetical protein BACUNI_02759 [Bacteroides uniformis ATCC 8492]
 gi|156860050|gb|EDO53481.1| hypothetical protein BACUNI_02759 [Bacteroides uniformis ATCC 8492]
          Length = 168

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P ++ ++E R+  I    E    A  ++  +    E  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITKMVEGRKTYIDQSLEVAREANAQLSKLKEESEAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   +++A +++   V
Sbjct: 69  IAAANKEQGRILREAMHERDKIIVEARKQAEAAAQKELDEVKKQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D   ++  ++DR  D +
Sbjct: 129 AVLSVDIAEKIIRKNLDEKHEQMEMIDRMLDEV 161


>gi|15642761|ref|NP_232394.1| F0F1 ATP synthase subunit B [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591532|ref|ZP_01678795.1| ATP synthase F0, B subunit [Vibrio cholerae 2740-80]
 gi|147674150|ref|YP_001218417.1| F0F1 ATP synthase subunit B [Vibrio cholerae O395]
 gi|153820050|ref|ZP_01972717.1| ATP synthase F0, B subunit [Vibrio cholerae NCTC 8457]
 gi|153821985|ref|ZP_01974652.1| ATP synthase F0, B subunit [Vibrio cholerae B33]
 gi|229508281|ref|ZP_04397785.1| ATP synthase B chain [Vibrio cholerae BX 330286]
 gi|229508633|ref|ZP_04398128.1| ATP synthase B chain [Vibrio cholerae B33]
 gi|229517151|ref|ZP_04406597.1| ATP synthase B chain [Vibrio cholerae RC9]
 gi|229606555|ref|YP_002877203.1| F0F1 ATP synthase subunit B [Vibrio cholerae MJ-1236]
 gi|254851559|ref|ZP_05240909.1| F0F1 ATP synthase subunit B [Vibrio cholerae MO10]
 gi|15213932|sp|Q9KNH1|ATPF_VIBCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696197|sp|A5F475|ATPF_VIBC3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|9657369|gb|AAF95907.1| ATP synthase F0, B subunit [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121546617|gb|EAX56809.1| ATP synthase F0, B subunit [Vibrio cholerae 2740-80]
 gi|126509407|gb|EAZ72001.1| ATP synthase F0, B subunit [Vibrio cholerae NCTC 8457]
 gi|126520524|gb|EAZ77747.1| ATP synthase F0, B subunit [Vibrio cholerae B33]
 gi|146316033|gb|ABQ20572.1| ATP synthase F0, B subunit [Vibrio cholerae O395]
 gi|227012004|gb|ACP08214.1| ATP synthase F0, B subunit [Vibrio cholerae O395]
 gi|229346214|gb|EEO11186.1| ATP synthase B chain [Vibrio cholerae RC9]
 gi|229354347|gb|EEO19275.1| ATP synthase B chain [Vibrio cholerae B33]
 gi|229354554|gb|EEO19476.1| ATP synthase B chain [Vibrio cholerae BX 330286]
 gi|229369210|gb|ACQ59633.1| ATP synthase B chain [Vibrio cholerae MJ-1236]
 gi|254847264|gb|EET25678.1| F0F1 ATP synthase subunit B [Vibrio cholerae MO10]
          Length = 156

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 68/146 (46%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 11  AISFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EI+  + +A  E+   V  +   
Sbjct: 71  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+     + ILD     +
Sbjct: 131 GAEKILERSIDKDTHKDILDNITAKL 156


>gi|199597580|ref|ZP_03211009.1| F0F1-type ATP synthase, subunit b [Lactobacillus rhamnosus HN001]
 gi|258508174|ref|YP_003170925.1| ATP synthase subunit B [Lactobacillus rhamnosus GG]
 gi|199591603|gb|EDY99680.1| F0F1-type ATP synthase, subunit b [Lactobacillus rhamnosus HN001]
 gi|257148101|emb|CAR87074.1| ATP synthase B chain [Lactobacillus rhamnosus GG]
 gi|259649492|dbj|BAI41654.1| F0F1-type ATP synthase subunit B [Lactobacillus rhamnosus GG]
          Length = 162

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 68/148 (45%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F +      +     +S +M  R+  IS D +  + ++++ E++ +   E+L  A+
Sbjct: 9   TLVTFLVLMIAVGKVAWKPVSKMMAERQQKISGDLDYAEKSRKDAEALAAKRREALQHAQ 68

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+++     E+  +   +    ++     NAQ +ID  +K A     + V +++ 
Sbjct: 69  ADAVKIVNQAKENGEKQRQSLVDAANTEVATLKKNAQADIDQARKDALASAKNDVADLSL 128

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            + +K +G  ++  D + ++D     + 
Sbjct: 129 TIAQKLIGKELNADDQKDLIDDYIKRLG 156


>gi|311748677|ref|ZP_07722462.1| ATP synthase F0, B subunit [Algoriphagus sp. PR1]
 gi|126577210|gb|EAZ81458.1| ATP synthase F0, B subunit [Algoriphagus sp. PR1]
          Length = 164

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 68/154 (44%), Gaps = 2/154 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
               W  + F    ++  +F    + + +E R + I +  +  ++A+ E+ ++ +  E+ 
Sbjct: 9   GLIIWQLLGFLALLFILIKFAWKPMLAALEERESSIENALKAAETARNEMANLKAENEKL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA ARA    I+ K   A+ + +E  +E   K     + NA+  I+  +K A  +V + V
Sbjct: 69  LAEARAERDTILKKAHDASNKMIEEAKEEAVKTGAQMIENAKEVIETEKKAALADVKTQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
             +T ++  KL       D   + ++D     + 
Sbjct: 129 ATLTLEVTEKLLRKNLSDDKSQKTLVDEFIKDLK 162


>gi|197124854|ref|YP_002136805.1| ATP synthase F0 subunit beta [Anaeromyxobacter sp. K]
 gi|226741291|sp|B4UJU5|ATPF_ANASK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|196174703|gb|ACG75676.1| ATP synthase F0, B subunit [Anaeromyxobacter sp. K]
          Length = 179

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W AI F +   V  +F    +  ++  R   I    +     + E E ++++ +E
Sbjct: 21  PGLTLWTAITFLVMLVVLGKFAWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKE 80

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           SLA A+  A E+  +     E   +       K+    ++ A+ +I +   KA  E+ + 
Sbjct: 81  SLAKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELGKAKTELKAQ 140

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           V ++  D   +L   ++ +   + +++     + A
Sbjct: 141 VVDLAIDAASRLVKANLDEKAQRALVEEYIAQLPA 175


>gi|330720624|gb|EGG98882.1| ATP synthase B chain [gamma proteobacterium IMCC2047]
          Length = 156

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 69/145 (47%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F +F W   +F+ P ++S +  R+  I+      D A+ ++E   +   E LA A+  
Sbjct: 12  LTFVVFVWFCMKFVWPPITSALAERKKKIADGLSAADRAEHDLELAQAKAVERLAEAKQQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
             EII++    A Q ++  +E   ++    ++ AQ EI+    +A +E+ + V  V    
Sbjct: 72  GAEIIEQANKRAAQLVDEAKEQAREEGARLVAAAQAEIEQDTNRAREELRTQVAAVAIAG 131

Query: 150 VRK-LGFSVSDADVQKILDRKRDGI 173
             K LG +V+  +   +LD+    +
Sbjct: 132 AEKVLGSTVNADEHNAMLDKLASEL 156


>gi|167762920|ref|ZP_02435047.1| hypothetical protein BACSTE_01284 [Bacteroides stercoris ATCC
           43183]
 gi|167699260|gb|EDS15839.1| hypothetical protein BACSTE_01284 [Bacteroides stercoris ATCC
           43183]
          Length = 166

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P ++ ++E RR  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITKMVEERRAYIDQSLEVARQANAQLAKLKEESDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L + + +I   +++A +++   V
Sbjct: 69  IAAANKEQGRIMREAMHERDKIIVEARKHAEALAQKELDDVKQQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D +  +  ++DR  D +
Sbjct: 129 AVLSVDIAEKIIRHNLDKEQDQMEMIDRMLDEM 161


>gi|296134377|ref|YP_003641624.1| ATP synthase F0, B subunit [Thermincola sp. JR]
 gi|296032955|gb|ADG83723.1| ATP synthase F0, B subunit [Thermincola potens JR]
          Length = 168

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 65/152 (42%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           F W  + F I  ++ ++ +   +  +++ R+  I       ++AK E E++   YE  LA
Sbjct: 14  FVWQIVNFLILLFILNKLLYKPMLQMLDDRKKSIEDAINSAETAKAEAEALRKEYETRLA 73

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A++II K     E+  +      +++    +  AQ EI   +  A   +   V  
Sbjct: 74  EAKKEAQDIIAKATKLGEEMKKEIVANAQEEANKAIRKAQEEIAREKDAAVAALRDEVAT 133

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +      K LG ++S  D +K++      +  
Sbjct: 134 LAVMAAGKVLGKAISVEDHEKLVKDFVQEVGG 165


>gi|323339968|ref|ZP_08080235.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
 gi|323092610|gb|EFZ35215.1| ATP synthase F0 sector subunit B [Lactobacillus ruminis ATCC 25644]
          Length = 174

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 72/148 (48%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F +       F    ++ +ME R N I++D +  + A+++ E + +  EE+L  +  
Sbjct: 22  LLTFVVLIAAVKHFAWGPVTEMMEKRANKIANDIDSAEDARKKAEELAAQREEALKDSHV 81

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +IID+     EQ      +  + +++    NA+ +I+  +++A   + + V E++ +
Sbjct: 82  EASKIIDRAKQNGEQQKASIVDSAQSEVMTMKDNAKKDIEQQRQEAMSGIKNDVAELSIE 141

Query: 149 LVRKLG-FSVSDADVQKILDRKRDGIDA 175
           +  K+    ++  D + ++D   +G+  
Sbjct: 142 IASKIIQKELNAEDQKALVDSYIEGLGK 169


>gi|159039544|ref|YP_001538797.1| ATP synthase F0, B subunit [Salinispora arenicola CNS-205]
 gi|226694462|sp|A8M2J7|ATPF_SALAI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157918379|gb|ABV99806.1| ATP synthase F0, B subunit [Salinispora arenicola CNS-205]
          Length = 179

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + FG+  +V  +F+ PR+    + R + I    ++ ++A+ E   ++  Y   L+
Sbjct: 23  IVVGLVAFGLLAFVLMKFVFPRMEQTFQARVDAIEGGIKRAEAAQAEANQLLEQYRAQLS 82

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR+ A +I D   A AE   +       ++    ++  + ++   +    +E+ + VG 
Sbjct: 83  EARSDAAKIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERATIVRELRTEVGT 142

Query: 145 VTKDLVRKLGFSVSDADVQKI--LDRKRDGIDA 175
           +  DL  K+       + ++   +DR  DG+++
Sbjct: 143 LAVDLASKIVGESLADEARRAGTVDRFLDGLES 175


>gi|58337086|ref|YP_193671.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus NCFM]
 gi|227903654|ref|ZP_04021459.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus ATCC 4796]
 gi|75420243|sp|Q9RGY5|ATPF_LACAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6652829|gb|AAF22494.1|AF098522_4 F1F0-ATPase subunit b [Lactobacillus acidophilus]
 gi|58254403|gb|AAV42640.1| H+-transporting ATP synthase chain b [Lactobacillus acidophilus
           NCFM]
 gi|227868541|gb|EEJ75962.1| F0F1 ATP synthase subunit B [Lactobacillus acidophilus ATCC 4796]
          Length = 169

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 64/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  + F I   +   +    +S +ME RR  I SD +   S +++ E++ +  
Sbjct: 13  IYLGNAIWYLLCFAILMLLIKHYAWGPVSDMMEKRRQKIISDLDSAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+      A+   +       +D       A  E    +  A     
Sbjct: 73  EAALKNSRQEATQILSDAKTNAQNTSKEIVASANEDAAAIRKKANEEAAKAKSDALDAAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+   G+D
Sbjct: 133 DQVADISVAIAEKVIAKNLSAEDQKDLVDQFIKGLD 168


>gi|297192044|ref|ZP_06909442.1| F0F1 ATP synthase subunit B [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197719506|gb|EDY63414.1| F0F1 ATP synthase subunit B [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 184

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 67/148 (45%), Gaps = 2/148 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ ++E RR  I    EK D+AK E ES++  Y+  LA AR 
Sbjct: 27  LIAFVIVFGFLAKKLLPNINKVLEERREAIEGGIEKADAAKTEAESVLEQYKAQLAEARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        ++  +   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 87  EAARLRQEATEQGTAIIQEMKAEGQRQREEIIAAGHAQIEADRKAAASALRQDVGKLATD 146

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGID 174
           L  KL        A   + +DR  D ++
Sbjct: 147 LAGKLVGESLEDHARQSRTIDRFLDSLE 174


>gi|218461930|ref|ZP_03502021.1| F0F1 ATP synthase subunit B' [Rhizobium etli Kim 5]
          Length = 150

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 61/113 (53%), Gaps = 1/113 (0%)

Query: 5   SSSDFSSR-FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           +  + +   FPPFD++TF SQ  WL I FG+FY +  + I PR+ +I++ R   IS D E
Sbjct: 37  AEGEHARGPFPPFDSTTFSSQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHTRISQDLE 96

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDL 116
           +    K E ++ + +YE  LA ARA +  I      AA+   E +R   E  L
Sbjct: 97  EAGRLKAEADAAVQTYEGELAAARAKSNAIGSAARDAAKAKAEEERRTVEASL 149


>gi|161507272|ref|YP_001577226.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus DPC 4571]
 gi|226741493|sp|A8YUJ7|ATPF_LACH4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|160348261|gb|ABX26935.1| H+-transporting ATP synthase subunit b [Lactobacillus helveticus
           DPC 4571]
          Length = 169

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/156 (19%), Positives = 65/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   F    +S +ME RR  + +D +   S +++ E++ +  
Sbjct: 13  IYLGNALWYLICFAILLLLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+    A A++  +       +D       A  E    +  A     
Sbjct: 73  EAALKNSRQEATQILSDAKANAQKTGKEIVASANEDAAAIRKKANEEAAKAKSDALDSAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+    +D
Sbjct: 133 DQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELD 168


>gi|255746822|ref|ZP_05420768.1| ATP synthase B chain [Vibrio cholera CIRS 101]
 gi|262155902|ref|ZP_06029024.1| ATP synthase B chain [Vibrio cholerae INDRE 91/1]
 gi|262167084|ref|ZP_06034799.1| ATP synthase B chain [Vibrio cholerae RC27]
 gi|255735579|gb|EET90978.1| ATP synthase B chain [Vibrio cholera CIRS 101]
 gi|262024470|gb|EEY43156.1| ATP synthase B chain [Vibrio cholerae RC27]
 gi|262030354|gb|EEY48996.1| ATP synthase B chain [Vibrio cholerae INDRE 91/1]
          Length = 154

 Score = 82.1 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 68/146 (46%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 9   AISFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EI+  + +A  E+   V  +   
Sbjct: 69  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+     + ILD     +
Sbjct: 129 GAEKILERSIDKDTHKDILDNITAKL 154


>gi|206575827|ref|YP_002241283.1| ATP synthase F0, B subunit [Klebsiella pneumoniae 342]
 gi|288937922|ref|YP_003441981.1| ATP synthase F0 subunit beta [Klebsiella variicola At-22]
 gi|290511662|ref|ZP_06551030.1| ATP synthase F0, B subunit [Klebsiella sp. 1_1_55]
 gi|226741489|sp|B5XZM0|ATPF_KLEP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|206564885|gb|ACI06661.1| ATP synthase F0, B subunit [Klebsiella pneumoniae 342]
 gi|288892631|gb|ADC60949.1| ATP synthase F0, B subunit [Klebsiella variicola At-22]
 gi|289775452|gb|EFD83452.1| ATP synthase F0, B subunit [Klebsiella sp. 1_1_55]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF W   +++ P L + +E R+  IS      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|224024067|ref|ZP_03642433.1| hypothetical protein BACCOPRO_00784 [Bacteroides coprophilus DSM
           18228]
 gi|224017289|gb|EEF75301.1| hypothetical protein BACCOPRO_00784 [Bacteroides coprophilus DSM
           18228]
          Length = 167

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 69/154 (44%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ I+FG+ +++  ++  P +  ++E R+  I    +    A  ++ S+    E 
Sbjct: 8   PGLLFWMIIVFGVVFFILAKYGFPVIIRMVEDRKAYIDQSLKAAREANEKLASVKQEGER 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A      I+++  A  ++ +   +E    +    +   + +I+  ++ A +++   
Sbjct: 68  ILAQANEEQVRILNEAAATRDRIINEAKERARLEGDRLMEEMKKQIETEKESAIRDIRRQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++  +  K+  S    + +  +++DR  D +
Sbjct: 128 VAVLSVGIAEKVMRSKLADEKEQMELIDRMLDEM 161


>gi|317494639|ref|ZP_07953051.1| ATP synthase F0 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917241|gb|EFV38588.1| ATP synthase F0 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P +   +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVWFCMKYVWPPIMDAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKADAQVIIEQANKRKAQIIDEAKVEAEQERNKIVAQAQAEIDAERKRAREELRKQVAT 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|222152830|ref|YP_002562007.1| F0F1 ATP synthase subunit B [Streptococcus uberis 0140J]
 gi|222113643|emb|CAR41544.1| ATP synthase B chain [Streptococcus uberis 0140J]
          Length = 164

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 65/155 (41%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     + Y +  +F    +S I+E R   ISSD ++ + A+ E E++    E 
Sbjct: 9   IGNFILVTGSILVLYLLLKKFAWGSISGILEERSAKISSDIDRAEQARIEAENLAQKREN 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A+  A +II       +   E        ++      AQ +I   +  A   V S 
Sbjct: 69  ELAGAKQEASKIITDAKELGQVKGEQLVAEASAEVSRLKEKAQADIQQSKTDAISSVKSE 128

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           + ++T  L  K LG ++  +   +++D   D +  
Sbjct: 129 MTDLTVLLAEKVLGANLDKSAQSQLIDSYLDDLGE 163


>gi|110636606|ref|YP_676813.1| F0F1 ATP synthase subunit B [Cytophaga hutchinsonii ATCC 33406]
 gi|123354860|sp|Q11YP3|ATPF_CYTH3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|110279287|gb|ABG57473.1| ATP synthase F0 subcomplex B subunit [Cytophaga hutchinsonii ATCC
           33406]
          Length = 167

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 64/155 (41%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
              FFW  +IF +  ++  +F    + S M+ R + I+      D A+ ++E + ++ E 
Sbjct: 11  FGLFFWQTVIFLVTLYLLSKFAWGPIMSAMKEREDSITDALSAADKARADIEKLQATNEA 70

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR    +I+     AA   +E  +     +    +  A+  I   +  A  EV + 
Sbjct: 71  LLAEARIERDKILADAHKAATTMMEDAKVKASTEGNRLMEAARVSIQTEKNAALHEVKNY 130

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
              +  ++  K+      +  + +K++      ++
Sbjct: 131 AATLAVEIAEKILRKELNNAEEQKKLVSEYIKEVN 165


>gi|237714630|ref|ZP_04545111.1| ATP synthase B subunit [Bacteroides sp. D1]
 gi|262406495|ref|ZP_06083044.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_22]
 gi|294646113|ref|ZP_06723776.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CC 2a]
 gi|294808292|ref|ZP_06767050.1| ATP synthase F0, B subunit [Bacteroides xylanisolvens SD CC 1b]
 gi|229445399|gb|EEO51190.1| ATP synthase B subunit [Bacteroides sp. D1]
 gi|262355198|gb|EEZ04289.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_22]
 gi|292638557|gb|EFF56912.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CC 2a]
 gi|294444511|gb|EFG13220.1| ATP synthase F0, B subunit [Bacteroides xylanisolvens SD CC 1b]
          Length = 167

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  ++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFLSFGIVFVILAKYGFPVIIKMVEGRKTYIDQSLEVAREANAQLSKLKQEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQMEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKSLEDKDAQMGMIDRMLDEV 161


>gi|229515965|ref|ZP_04405422.1| ATP synthase B chain [Vibrio cholerae TMA 21]
 gi|229347065|gb|EEO12027.1| ATP synthase B chain [Vibrio cholerae TMA 21]
          Length = 156

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 67/146 (45%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 11  TIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EI+  + +A  E+   V  +   
Sbjct: 71  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+     + ILD     +
Sbjct: 131 GAEKILERSIDKDTHKDILDNITAKL 156


>gi|220932620|ref|YP_002509528.1| ATP synthase F0, B subunit [Halothermothrix orenii H 168]
 gi|219993930|gb|ACL70533.1| ATP synthase F0, B subunit [Halothermothrix orenii H 168]
          Length = 166

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 60/152 (39%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  + F +  W+  RF+   L+  ++ R   I ++ +     K E + +   YE  L 
Sbjct: 8   LLWQVVNFLVLMWLLKRFLYGPLTEFLDKRSQKIKNELDSAARKKEEADKLKKEYESKLQ 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A+EII+     A+Q  E        +          EI   ++ A  E+   V  
Sbjct: 68  QARDKAQEIIEDAEKRAQQRAEEIIAEARVEAKKVKERNMEEIAQAKRDALDELRKEVAS 127

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           ++  +  K +   +     + ++++  + +D 
Sbjct: 128 ISLMVAGKFIKEKIDKKQQEALINQYIENLDQ 159


>gi|313884674|ref|ZP_07818430.1| ATP synthase F0, B subunit [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620042|gb|EFR31475.1| ATP synthase F0, B subunit [Eremococcus coleocola ACS-139-V-Col8]
          Length = 169

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 65/149 (43%), Gaps = 1/149 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             I F I  +  HRF    L ++++ R+ LI+ +  +    K   E      +  L  +R
Sbjct: 16  TLISFLILIFCVHRFAWTPLMNVLDQRKRLITKELNEGHDLKAASEKANKEAQAKLTQSR 75

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
             A +I++      E+     ++   +D+    + AQ  I+  +++   E+   +  V+ 
Sbjct: 76  VEANKIVNDAKKQGEELKMRLKQEANQDIDAMKAQAQRRIERERQEVLAEMEDTIASVSV 135

Query: 148 DLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           ++  K+    +++ D +++++     ++ 
Sbjct: 136 EIAEKIIKHEINEEDHRRLINDFIHRLEE 164


>gi|62318459|dbj|BAD94433.1| b subunit of F1F0-ATP synthase [Acidithiobacillus ferrooxidans]
          Length = 159

 Score = 81.8 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 61/159 (38%), Gaps = 1/159 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +            + F I   + ++++   L  +M+ RR  I+      +  K E+   
Sbjct: 1   MNPVGINGTLIVQLVTFVILVALLYKYMYGPLRKVMDDRRAKIADGLAAAERGKEEMALA 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
                E +  A+  A EII        +  E  +    ++    +++A+ EID    +A 
Sbjct: 61  QKRATELVREAKDKAAEIIANAERRGVELREEAQGKAREEADRIIASARAEIDVETNRAR 120

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
           + +   V E+  +  +++    + D   + I+DR    +
Sbjct: 121 EVLRGQVVELVVNGTQRILHREIDDQAHRDIIDRMVGQL 159


>gi|260642519|ref|ZP_05416185.2| ATP synthase F0, B subunit [Bacteroides finegoldii DSM 17565]
 gi|260621785|gb|EEX44656.1| ATP synthase F0, B subunit [Bacteroides finegoldii DSM 17565]
          Length = 167

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  ++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFLSFGIVFVILAKYGFPVIIKMVEGRKTYIDQSLEVAREANAQLSRLKEEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKNLADKEAQMGMIDRMLDEV 161


>gi|206603290|gb|EDZ39770.1| ATP synthase F0, subunit B [Leptospirillum sp. Group II '5-way CG']
          Length = 175

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 29/163 (17%), Positives = 68/163 (41%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD+  F S   W  + F +   +  + +LP L  ++E R+  + SD E     + E 
Sbjct: 1   MPQFDSRFFSSLGMWTVLSFLLMLAIVWKILLPSLVKVLEERKMRVVSDLEAARKNREES 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
            S++   +  L+ ARA A+EI+ +         E +++    ++  +L  A+ +I     
Sbjct: 61  ASILEEQKMLLSKARAQAEEILRQAEEMGRVVREEKQKEAMLEVETRLKKAEAQIKADID 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKI-LDRKRDGID 174
           +   E+      +    +  +     +   + + +++    ++
Sbjct: 121 RVRNELRKETVSLVVRGIESVLEESLNETQKMMFINKAIRAVE 163


>gi|229551975|ref|ZP_04440700.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus rhamnosus
           LMS2-1]
 gi|258539389|ref|YP_003173888.1| ATP synthase subunit B [Lactobacillus rhamnosus Lc 705]
 gi|229314710|gb|EEN80683.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus rhamnosus
           LMS2-1]
 gi|257151065|emb|CAR90037.1| ATP synthase B chain [Lactobacillus rhamnosus Lc 705]
          Length = 162

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 68/148 (45%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             + F +      +     +S +M  R+  IS D +  + ++++ E++ +   E+L  ++
Sbjct: 9   TLVTFLVLMIAVGKVAWKPVSKMMAERQQKISGDLDYAEKSRKDAEALAAKRREALQHSQ 68

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+++     E+  +   +    ++     NAQ +ID  +K A     + V +++ 
Sbjct: 69  ADAVKIVNQAKENGEKQRQSLVDAANTEVATLKKNAQADIDQARKDALASAKNDVADLSL 128

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            + +K +G  ++  D + ++D     + 
Sbjct: 129 AIAQKLIGKELNADDQKDLIDDYIKRLG 156


>gi|298481156|ref|ZP_06999350.1| ATP synthase F0, B subunit [Bacteroides sp. D22]
 gi|298272730|gb|EFI14297.1| ATP synthase F0, B subunit [Bacteroides sp. D22]
          Length = 167

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  ++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFLSFGIVFVILAKYGFPVIIKMVEGRKTYIDQSLEVAREANAQLSKLKQEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQMEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AMLSVDIAEKVLRKSLEDKDAQMGMIDRMLDEV 161


>gi|152972645|ref|YP_001337791.1| F0F1 ATP synthase subunit B [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238897243|ref|YP_002921991.1| F0F1 ATP synthase subunit B [Klebsiella pneumoniae NTUH-K2044]
 gi|262040359|ref|ZP_06013605.1| ATP synthase F0 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|330005177|ref|ZP_08305139.1| ATP synthase F0, B subunit [Klebsiella sp. MS 92-3]
 gi|226741524|sp|A6TG40|ATPF_KLEP7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150957494|gb|ABR79524.1| ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238549573|dbj|BAH65924.1| ATP synthase subunit B [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259042300|gb|EEW43325.1| ATP synthase F0 [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|328536383|gb|EGF62742.1| ATP synthase F0, B subunit [Klebsiella sp. MS 92-3]
          Length = 154

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF W   +++ P L + +E R+  IS      + AK++++   ++  + L 
Sbjct: 5   ILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQANATDQLK 64

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 65  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRKQVAI 124

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 125 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 154


>gi|307327915|ref|ZP_07607097.1| ATP synthase F0, B subunit [Streptomyces violaceusniger Tu 4113]
 gi|306886433|gb|EFN17437.1| ATP synthase F0, B subunit [Streptomyces violaceusniger Tu 4113]
          Length = 187

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I ++   + +LP ++ ++E RR  I    EK ++ + E + ++  Y   LA AR 
Sbjct: 27  LIAFAIVFFFLAKKLLPNINRVLEERREAIEGGMEKAEATQAEAQQVLEDYRAQLADARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K+A+Q +   VG +  D
Sbjct: 87  EAARLRQEAQEQGAALIAEMRAEGQRQREEVIAAGHAQIEADRKQAAQTLRQDVGRLATD 146

Query: 149 LVRKLGFSVSD--ADVQKILDRKRDGIDA 175
           L  ++     +  A   + +DR  D ++A
Sbjct: 147 LAGRIVGESLEDVARQSRTIDRFLDELEA 175


>gi|332687032|ref|YP_004456806.1| ATP synthase subunit B [Melissococcus plutonius ATCC 35311]
 gi|332371041|dbj|BAK21997.1| ATP synthase B chain [Melissococcus plutonius ATCC 35311]
          Length = 175

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 25/159 (15%), Positives = 68/159 (42%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            ST L     +   F I   +  +F    ++ +++ R + I++D +  + ++     M  
Sbjct: 12  PSTTLGTIIVVTGAFLILMLLLKKFAWGAVTDMLKKREDKIANDLDSAEQSRIAAAKMEQ 71

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             ++ L  +++ A EII     + EQ  +        ++ H    A+ +I     +A   
Sbjct: 72  ERQQQLLSSKSDAAEIIKNAKESGEQTRQKLLNEANGEISHLKEKARGDISQEHDEAMAS 131

Query: 138 VYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           + + V +++ ++  K+    +S+A  + +++   + +  
Sbjct: 132 IKTDVSKLSIEIAEKILNKELSEASHEALINSYIESLGK 170


>gi|294673896|ref|YP_003574512.1| ATP synthase F0 subunit B [Prevotella ruminicola 23]
 gi|294473943|gb|ADE83332.1| ATP synthase F0, B subunit [Prevotella ruminicola 23]
          Length = 171

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 65/155 (41%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW+ + F + ++V  ++  P +  ++E R   I    +K   A+  + ++    E 
Sbjct: 14  LGLLFWMLLAFAVVFFVLAKYGFPAIVGMVEERNRYIEDSLKKAHEAQERLANIEKEGES 73

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  ARA   +I+ +     +  +E  +E    +    L +A+  ID  +K A  ++   
Sbjct: 74  ILQEARAKQAQILKEAAETRDAIVEQAQEKARAEGARLLEDARVAIDQEKKAAIADIRQQ 133

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
           V  ++  +  K+       D     ++DR  D + 
Sbjct: 134 VAALSVGIAEKVLKQSLKDDKAQMDLIDRMLDDVS 168


>gi|291560275|emb|CBL39075.1| ATP synthase, F0 subunit b [butyrate-producing bacterium SSC/2]
          Length = 160

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 69/149 (46%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  +   +FY +  +F+   +S +ME R+ +ISSD +     K E E +   YE++LA
Sbjct: 9   IIWPIVNIVVFYLLLRKFLFGPVSEVMEKRKKMISSDLDDAAQTKAEAEEIKQEYEKNLA 68

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A +I+      A+   + + +  ++++     NA+ +I+  ++K    + + +  
Sbjct: 69  QAKDEAGQIVSDARTRAKNEYQNKMDQTKEEIALMRENARKDIEAEKQKTIAGLQTEIAG 128

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDG 172
           +      K+     +D   +K+LD     
Sbjct: 129 IALMAASKVVEKEANDKGNEKLLDDFLKE 157


>gi|328468720|gb|EGF39702.1| F0F1 ATP synthase subunit B [Lactobacillus helveticus MTCC 5463]
          Length = 169

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 65/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   F    +S +ME RR  + +D +   S +++ E++ +  
Sbjct: 13  IYLGNALWYLICFAILLLLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+    A A++ ++       +        A  E    +  A     
Sbjct: 73  EAALKNSRQEATKILSDAKANAQKTVKEIVASANEYAAAIRKKANEEAAKAKSDALDSAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+    +D
Sbjct: 133 DQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELD 168


>gi|81428739|ref|YP_395739.1| H(+)-transporting two-sector ATPase (ATP synthase), B subunit
           [Lactobacillus sakei subsp. sakei 23K]
 gi|123564149|sp|Q38WK1|ATPF_LACSS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|78610381|emb|CAI55431.1| H(+)-transporting two-sector ATPase (ATP synthase), B subunit
           [Lactobacillus sakei subsp. sakei 23K]
          Length = 173

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/158 (17%), Positives = 74/158 (46%), Gaps = 1/158 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +++L    ++ ++F I   +  +F    +S +M+ R N I++D +    ++ +   + + 
Sbjct: 11  ASYLGDSLFVLVVFIILVALVGKFAFGPVSKMMQERSNKITNDLDSAAQSREDAAKLAAQ 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
               L  +++ A EI++      E+  E    + ++++     NA+ +I+  +  A    
Sbjct: 71  RATELKSSKSEAVEIVNTAKQNGEKQREGMVTLAQEEVQTLKQNAKKDIEQSRLDALNSA 130

Query: 139 YSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
              V +++ ++  KL    +S  D + +++   +G+D 
Sbjct: 131 RDDVAQLSIEIASKLIKKELSVTDQKSLINSYIEGLDK 168


>gi|237785861|ref|YP_002906566.1| ATP synthase B chain [Corynebacterium kroppenstedtii DSM 44385]
 gi|237758773|gb|ACR18023.1| ATP synthase B chain [Corynebacterium kroppenstedtii DSM 44385]
          Length = 185

 Score = 81.8 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  + F +  W+  +F+LP+   ++  R + I    ++ ++A+ E ++ +  Y + LA
Sbjct: 28  LVWSIVCFVLILWLFWKFVLPKFQEVLSEREDRIEGGIQRAEAAQSEAKAALQKYNDQLA 87

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A  I D+  A  ++ +   +    ++    ++  + ++   +     ++   +G+
Sbjct: 88  EARAAAARIRDEARADGQKIVADMKTEATEESNRIIAQGEKQLAAQRDAVVADLRKDMGQ 147

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
            + DL  KL  S    DA   + +D     +D
Sbjct: 148 NSVDLAEKLLGSHLSDDAKRAETVDSFLSSLD 179


>gi|323345606|ref|ZP_08085829.1| ATP synthase F0 sector subunit B [Prevotella oralis ATCC 33269]
 gi|323093720|gb|EFZ36298.1| ATP synthase F0 sector subunit B [Prevotella oralis ATCC 33269]
          Length = 172

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 69/156 (44%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ + F + + V   F  P +  ++E R+  I     K   A   ++++    + 
Sbjct: 12  FGLLFWMFLAFLVVFGVLATFGFPAIIKMVEGRKQYIDDSLRKAHEASERLDNIKQEGDA 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR    ++I++     +  +E  +    ++    +S+A+ +I++ ++ A +++ + 
Sbjct: 72  ILQEAREKQAQVINEAAVTRDAIVEKAQAKAHEESARIISDAKAQIENDKQNAVRDIRTQ 131

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           V E++  +   +      S+    +++DR  D +  
Sbjct: 132 VAELSIQIAENILREKLSSNDMQMEMIDRLLDEVSK 167


>gi|121729378|ref|ZP_01682045.1| ATP synthase F0, B subunit [Vibrio cholerae V52]
 gi|153212960|ref|ZP_01948554.1| ATP synthase F0, B subunit [Vibrio cholerae 1587]
 gi|153803701|ref|ZP_01958287.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-3]
 gi|153827185|ref|ZP_01979852.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-2]
 gi|153829657|ref|ZP_01982324.1| ATP synthase F0, B subunit [Vibrio cholerae 623-39]
 gi|227082880|ref|YP_002811431.1| ATP synthase F0, B subunit [Vibrio cholerae M66-2]
 gi|229520157|ref|ZP_04409584.1| ATP synthase B chain [Vibrio cholerae TM 11079-80]
 gi|229524897|ref|ZP_04414302.1| ATP synthase B chain [Vibrio cholerae bv. albensis VL426]
 gi|229530220|ref|ZP_04419609.1| ATP synthase B chain [Vibrio cholerae 12129(1)]
 gi|254226936|ref|ZP_04920502.1| ATP synthase F0, B subunit [Vibrio cholerae V51]
 gi|254291144|ref|ZP_04961941.1| ATP synthase F0, B subunit [Vibrio cholerae AM-19226]
 gi|297581986|ref|ZP_06943906.1| ATP synthase F0 [Vibrio cholerae RC385]
 gi|298501180|ref|ZP_07010979.1| ATP synthase F0, B subunit [Vibrio cholerae MAK 757]
 gi|121628659|gb|EAX61131.1| ATP synthase F0, B subunit [Vibrio cholerae V52]
 gi|124116186|gb|EAY35006.1| ATP synthase F0, B subunit [Vibrio cholerae 1587]
 gi|124120763|gb|EAY39506.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-3]
 gi|125620541|gb|EAZ48909.1| ATP synthase F0, B subunit [Vibrio cholerae V51]
 gi|148874833|gb|EDL72968.1| ATP synthase F0, B subunit [Vibrio cholerae 623-39]
 gi|149738908|gb|EDM53232.1| ATP synthase F0, B subunit [Vibrio cholerae MZO-2]
 gi|150422989|gb|EDN14939.1| ATP synthase F0, B subunit [Vibrio cholerae AM-19226]
 gi|227010768|gb|ACP06980.1| ATP synthase F0, B subunit [Vibrio cholerae M66-2]
 gi|229332353|gb|EEN97840.1| ATP synthase B chain [Vibrio cholerae 12129(1)]
 gi|229338478|gb|EEO03495.1| ATP synthase B chain [Vibrio cholerae bv. albensis VL426]
 gi|229342751|gb|EEO07742.1| ATP synthase B chain [Vibrio cholerae TM 11079-80]
 gi|297533853|gb|EFH72694.1| ATP synthase F0 [Vibrio cholerae RC385]
 gi|297540052|gb|EFH76114.1| ATP synthase F0, B subunit [Vibrio cholerae MAK 757]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 68/146 (46%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 11  AIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EI+  + +A  E+   V  +   
Sbjct: 71  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+     + ILD     +
Sbjct: 131 GAEKILERSIDKDTHKDILDNITAKL 156


>gi|157368253|ref|YP_001476242.1| F0F1 ATP synthase subunit B [Serratia proteamaculans 568]
 gi|270264090|ref|ZP_06192357.1| ATP synthase subunit b [Serratia odorifera 4Rx13]
 gi|226694474|sp|A8G7M4|ATPF_SERP5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157320017|gb|ABV39114.1| ATP synthase F0, B subunit [Serratia proteamaculans 568]
 gi|270041739|gb|EFA14836.1| ATP synthase subunit b [Serratia odorifera 4Rx13]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  TAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|270296888|ref|ZP_06203087.1| ATP synthase F0, B subunit [Bacteroides sp. D20]
 gi|317479136|ref|ZP_07938276.1| ATP synthase B/B' CF(0) [Bacteroides sp. 4_1_36]
 gi|270272875|gb|EFA18738.1| ATP synthase F0, B subunit [Bacteroides sp. D20]
 gi|316904708|gb|EFV26522.1| ATP synthase B/B' CF(0) [Bacteroides sp. 4_1_36]
          Length = 168

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + V  ++  P ++ ++E R+  I    E    A  ++  +    E  
Sbjct: 9   GLLFWMLLSFGVVFVVLAKYGFPVITKMVEGRKTYIDQSLEVAREANAQLSKLKEESEAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   +++A +++   V
Sbjct: 69  IAAANKEQGRILREAMHERDKIIVEARKQAEAAAQKELDEVKKQIQQEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D   ++  ++DR  D +
Sbjct: 129 AVLSVDIAEKIIRKNLDEKHEQMEMIDRMLDEV 161


>gi|16124621|ref|NP_419185.1| ATP synthase F0, B' subunit [Caulobacter crescentus CB15]
 gi|221233310|ref|YP_002515746.1| ATP synthase B' chain [Caulobacter crescentus NA1000]
 gi|13421521|gb|AAK22353.1| ATP synthase F0, B' subunit [Caulobacter crescentus CB15]
 gi|220962482|gb|ACL93838.1| ATP synthase B' chain [Caulobacter crescentus NA1000]
          Length = 177

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 64/157 (40%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           +    S   P      +  Q  WL IIF + Y V  + +LPR+S  ++ R   I+ D   
Sbjct: 14  APKHESGGLPQLQFEHWGGQIVWLLIIFAVLYAVLSKALLPRVSGAIDERGAKIAGDIAD 73

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
               K E E+   +    +A ARA A++      A A      ++   E  L  KL+ A+
Sbjct: 74  ARRMKDEAEAQARAAAAEVAEARAKAQKTAADAKAKASAEAAERQAKEEAVLAEKLAAAE 133

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDAD 161
             I   + +A  +V  +  E    +V KL    + A 
Sbjct: 134 ASIQTARDQAMSQVRVVAEETAGAIVEKLTGKAASAA 170


>gi|260102576|ref|ZP_05752813.1| ATP synthase F0 [Lactobacillus helveticus DSM 20075]
 gi|260083603|gb|EEW67723.1| ATP synthase F0 [Lactobacillus helveticus DSM 20075]
          Length = 169

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 64/156 (41%), Gaps = 1/156 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
            +L    W  I F I   +   F    +S +ME RR  + +D +   S +++ E++ +  
Sbjct: 13  IYLGNALWYLICFAILLLLIKHFAWGPVSDMMEKRRQKVINDLDSAASDRKKAETLANER 72

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E +L  +R  A +I+    A A++  +       +        A  E    +  A     
Sbjct: 73  EAALKNSRQEATKILSDAKANAQKTGKEIVASANEYAAAIRKKANEEAAKAKSDALDSAR 132

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             V +++  +  K +  ++S  D + ++D+    +D
Sbjct: 133 DQVADISLAIAEKVIAKNLSAEDQKDLVDQFIKELD 168


>gi|311281699|ref|YP_003943930.1| ATP synthase F0, B subunit [Enterobacter cloacae SCF1]
 gi|308750894|gb|ADO50646.1| ATP synthase F0, B subunit [Enterobacter cloacae SCF1]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF W   +++ P L + +E R+  IS      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVIFVWFCMKYVWPPLMAAIEKRQKEISDGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERSKIVAQAQAEIDAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|302346241|ref|YP_003814539.1| ATP synthase F0, B subunit [Prevotella melaninogenica ATCC 25845]
 gi|302150336|gb|ADK96597.1| ATP synthase F0, B subunit [Prevotella melaninogenica ATCC 25845]
          Length = 170

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F + +++  ++  P +  ++  R+  I     K + A   + ++    EE 
Sbjct: 9   GLLFWMTLVFLVVFFILWKWGFPSIIKMVNERKEYIDESLAKAEEANLRLANIQKQGEEL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR    +I+ +     E  +   +E    +    LS A+ EI+  ++ A +++ S V
Sbjct: 69  LMEAREKQAQILREASETRETIVGQAQEKARDESARILSEAKAEIESQKQAAIRDIRSQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
            E++  +  K+        A+  ++++   D +
Sbjct: 129 AELSVQIAEKILHKELSGSAEQTQLINSLLDEV 161


>gi|322835098|ref|YP_004215125.1| ATP synthase F0 B subunit [Rahnella sp. Y9602]
 gi|321170299|gb|ADW75998.1| ATP synthase F0, B subunit [Rahnella sp. Y9602]
          Length = 156

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  IS      + AK+E++   +   + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEISEGLSSAERAKKELDLAQADATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ IID+      Q ++  +   E++    +S A+ EID  +++A +E+   VG 
Sbjct: 67  KAKAEAQVIIDQANKRKAQIVDEAKAEAEQERNKIVSQAKAEIDAERQRAREELRKQVGI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|149277104|ref|ZP_01883246.1| ATP synthase, subunit B (H(+)-transporting two-sector ATPase)
           [Pedobacter sp. BAL39]
 gi|149231981|gb|EDM37358.1| ATP synthase, subunit B (H(+)-transporting two-sector ATPase)
           [Pedobacter sp. BAL39]
          Length = 164

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 64/155 (41%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW +I F     +  +F    + + ++ R   I     K + AK E+  + S  EE
Sbjct: 8   IGLVFWTSIAFVCLLILLKKFAWKPILAAIQEREQSIEDALNKAELAKTEMARLTSQNEE 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  ARA    I+ +  A  +  +   +     +    +  A+ EI++ +K A  E+ + 
Sbjct: 68  LLKEARAERDLILKEAKALKDNIVNEAKTQAHNEGAKLIEKAKIEIENQKKAALSELKNQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V  ++ D+  ++  +     A  Q ++      ++
Sbjct: 128 VSSLSLDIAERVLRNQLQDKATQQDLVTNLLKDVE 162


>gi|114619|sp|P26681|ATPF_ENTHR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|153569|gb|AAA26855.1| H+ ATPase [Enterococcus faecalis]
 gi|153577|gb|AAA26862.1| F1F0-ATPase beta subunit [Enterococcus faecalis]
          Length = 174

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 69/156 (44%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
            L     ++  F I  ++   F    +S I++ R + I++D +  + ++     M    E
Sbjct: 14  MLGNIIVVSGSFLILMFLLKHFAWGPISDILKKREDKIANDLDSAEKSRINSAKMEQERE 73

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  +R+ A +II     + E + +   +  ++++    S AQ +I   +  A   V  
Sbjct: 74  QQLLASRSDAADIIKNAKESGELSRQNILKETQEEVARLKSKAQTDIMLERDTALNSVKD 133

Query: 141 IVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
            V +++  +  K+    +S    + ++++  +G+ +
Sbjct: 134 DVADLSLQIAAKILNKELSPEMHESLINQYIEGLGS 169


>gi|262190637|ref|ZP_06048872.1| ATP synthase B chain [Vibrio cholerae CT 5369-93]
 gi|262033475|gb|EEY51978.1| ATP synthase B chain [Vibrio cholerae CT 5369-93]
 gi|327485236|gb|AEA79643.1| ATP synthase B chain [Vibrio cholerae LMA3894-4]
          Length = 154

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 68/146 (46%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 9   AIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EI+  + +A  E+   V  +   
Sbjct: 69  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+     + ILD     +
Sbjct: 129 GAEKILERSIDKDTHKDILDNITAKL 154


>gi|288922991|ref|ZP_06417148.1| ATP synthase F0, B subunit [Frankia sp. EUN1f]
 gi|288345667|gb|EFC80039.1| ATP synthase F0, B subunit [Frankia sp. EUN1f]
          Length = 192

 Score = 81.4 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/174 (18%), Positives = 69/174 (39%), Gaps = 8/174 (4%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
            ++ + S   PP       ++     + FG+        I P++      R   I    +
Sbjct: 12  GAAHEDSVLVPPL------AELIVGLLAFGLLVGFFFWKIYPQVRKTYAERTERIEGGLK 65

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           + ++A+ E + ++  Y   LA AR  A  I +   A   Q +E  R   ++++      A
Sbjct: 66  RAETAQAEAQVLLEQYRSQLAEARTEAARIREDAQAQGRQIVEELRAQAQQEVAEIRERA 125

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
              +   + +    V   +GE+  +L  ++      SDA  ++++D    G+D 
Sbjct: 126 DATLVAERAQVVASVRREIGEIALELATRIVGHELESDASQRQLVDDFIAGLDE 179


>gi|302521944|ref|ZP_07274286.1| ATP synthase F0, B subunit [Streptomyces sp. SPB78]
 gi|318075501|ref|ZP_07982833.1| F0F1 ATP synthase subunit B [Streptomyces sp. SA3_actF]
 gi|333024396|ref|ZP_08452460.1| putative F0F1 ATP synthase subunit B [Streptomyces sp. Tu6071]
 gi|302430839|gb|EFL02655.1| ATP synthase F0, B subunit [Streptomyces sp. SPB78]
 gi|332744248|gb|EGJ74689.1| putative F0F1 ATP synthase subunit B [Streptomyces sp. Tu6071]
          Length = 181

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F I + +    +LP ++ +++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 27  ALAFVIVFGLLAWKLLPNINKVLDERREAIEGGMEKAEAARTEADSVLEQYKAQLAEARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+  +   VG +  +
Sbjct: 87  EAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHTQIEADRKAAATTLRQDVGRLATE 146

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   + +DR  D +DA
Sbjct: 147 LAGKLVGESLEDHARQSRTIDRFLDELDA 175


>gi|282881588|ref|ZP_06290257.1| ATP synthase F0, B subunit [Prevotella timonensis CRIS 5C-B1]
 gi|281304574|gb|EFA96665.1| ATP synthase F0, B subunit [Prevotella timonensis CRIS 5C-B1]
          Length = 172

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 68/155 (43%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L   FW+ + F + ++V  ++  P + +++E R++ I     K   A   +  +    + 
Sbjct: 12  LGLLFWMFLAFLVVFFVLSKYGFPVIINMVEKRKSYIDDSLRKAHEASERLAKIQQEGDA 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR     ++ +  A  +  +E      + +    +S A+ EID  ++ A +++ S 
Sbjct: 72  ILHDAREKQAVMLKEAAATRDSIVEKAHVKAKDESSRLISEARTEIDIEKQNAIRDIRSQ 131

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V E++  +  K+      S     +++++  + I 
Sbjct: 132 VAELSVQIAEKVIREELASKDSQMELINKLLNDIS 166


>gi|296105470|ref|YP_003615616.1| F0F2 ATP synthase subunit B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059929|gb|ADF64667.1| F0F2 ATP synthase subunit B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 156

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF W   +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFIIFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVTQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|227832896|ref|YP_002834603.1| ATP synthase B chain [Corynebacterium aurimucosum ATCC 700975]
 gi|262182615|ref|ZP_06042036.1| ATP synthase B chain [Corynebacterium aurimucosum ATCC 700975]
 gi|227453912|gb|ACP32665.1| ATP synthase B chain [Corynebacterium aurimucosum ATCC 700975]
          Length = 190

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 70/152 (46%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I   V  + +LP  + +++ R + I    ++ ++ + E ++ +  Y   LA
Sbjct: 32  LVWSIIPFTIILIVFWKLVLPAYNKMLQEREDRIEGGLKRAEAQQAEAKAALEKYNAQLA 91

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI ++     +      +E  E++    L+  + +++  + +   E+ S +G+
Sbjct: 92  DARAEAAEIREQARERGKLIEAEAKEAAEEESRRILTAGEKQLEASRAQVVSELRSDIGQ 151

Query: 145 VTKDLVRK-LGFSVSDAD-VQKILDRKRDGID 174
            + +L  K LG  +SDA      +D     +D
Sbjct: 152 NSINLAEKLLGGELSDATKQSSTIDNFLSELD 183


>gi|167768298|ref|ZP_02440351.1| hypothetical protein CLOSS21_02854 [Clostridium sp. SS2/1]
 gi|167709822|gb|EDS20401.1| hypothetical protein CLOSS21_02854 [Clostridium sp. SS2/1]
          Length = 160

 Score = 81.4 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 69/149 (46%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  +   +FY +  +F+   +S +ME R+ +ISSD +     K E E +   YE++LA
Sbjct: 9   IIWPIVNIVVFYLLLRKFLFGPVSEVMEKRKKMISSDLDDAAQTKAEAEEIKQEYEKNLA 68

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A +I+      A+   + + +  ++++     NA+ +I+  ++K    + + +  
Sbjct: 69  QAKDEAGQIVSDARTRAKNEYQNKMDQTKEEIALMRENARKDIEAEKQKTIAGLQTEIAG 128

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDG 172
           +      K+     +D   +K+LD     
Sbjct: 129 IALMATSKVVEKEANDKGNEKLLDDFLKE 157


>gi|282853798|ref|ZP_06263135.1| ATP synthase F0, B subunit [Propionibacterium acnes J139]
 gi|282583251|gb|EFB88631.1| ATP synthase F0, B subunit [Propionibacterium acnes J139]
 gi|314981460|gb|EFT25554.1| ATP synthase F0, B subunit [Propionibacterium acnes HL110PA3]
 gi|315092124|gb|EFT64100.1| ATP synthase F0, B subunit [Propionibacterium acnes HL110PA4]
          Length = 184

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 32/155 (20%), Positives = 65/155 (41%), Gaps = 2/155 (1%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +  +     I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++ +  Y+
Sbjct: 15  YPVEIIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAEKAQAEAKAALEKYQ 74

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
             LA AR  A +I D   +   Q +   R   +++       A  +I   + +A +EV +
Sbjct: 75  AQLASARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRA 134

Query: 141 IVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
            +G +   L  ++       D  VQ  +DR    +
Sbjct: 135 EIGGLATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|329115988|ref|ZP_08244705.1| ATP synthase F0, B subunit [Streptococcus parauberis NCFD 2020]
 gi|326906393|gb|EGE53307.1| ATP synthase F0, B subunit [Streptococcus parauberis NCFD 2020]
          Length = 164

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 67/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     + Y +  +F   ++S I++ R   IS+D +K ++A+   E++    ++
Sbjct: 9   IGNFILVTGSILVLYLLLKKFAWGQISGILDERAAKISNDIDKAENARINAENLQVERQK 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A++ A +II       +       E    +       A  +I+  + +A  +V + 
Sbjct: 69  ELDGAKSEASQIIVDAKEIGQAQSTKLIEEANDEASRLKEKADIDIERSKAEALSDVKNQ 128

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           + +++  L  K +G ++      K++D   + +  
Sbjct: 129 MSDLSISLAEKIIGANLDKDAQSKLIDSYLNDLGE 163


>gi|51891225|ref|YP_073916.1| ATP synthase B subunit [Symbiobacterium thermophilum IAM 14863]
 gi|81692259|sp|Q67TC1|ATPF_SYMTH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|51854914|dbj|BAD39072.1| ATP synthase B subunit [Symbiobacterium thermophilum IAM 14863]
          Length = 162

 Score = 81.0 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 66/155 (42%), Gaps = 1/155 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           ++  W  I F +  W  HRF+   L   ++ R + I+++ +K    + E E +   +E  
Sbjct: 8   NELIWTIINFAVLLWGMHRFLYKPLLGAIQAREDEINANLKKAAEDRAEAERLRREFEAQ 67

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A+  A+EII+K V  A    E             L  A   I+  + KA  E+   V
Sbjct: 68  IANAQREAQEIINKAVKNATAVKEQIEAEARARAAEILEQATQTIEREKAKAVAELRREV 127

Query: 143 GEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDAF 176
            ++   +  K+    + DA+ +++ D     +   
Sbjct: 128 ADLAVAVAGKVIEKSLDDAEHRRLADSFVTEVTKH 162


>gi|88860633|ref|ZP_01135270.1| membrane-bound ATP synthase, F0 sector, subunit b
           [Pseudoalteromonas tunicata D2]
 gi|88817228|gb|EAR27046.1| membrane-bound ATP synthase, F0 sector, subunit b
           [Pseudoalteromonas tunicata D2]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 68/146 (46%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +F W   +++ P L+  +E R+  I       D A++++E       E L  A+A
Sbjct: 11  LIAFIVFVWFCMKYVWPPLNGAIEARQKKIEDGLAASDKAEKDLELARHKATEQLKEAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +II++    A Q ++ +     ++  + ++  ++E++  + +A +E+   V  +   
Sbjct: 71  QAADIIEQAKKRATQIVDEETTRGHEERENIIAQGRSEVEAERNRAKEELRKQVSALAIL 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              ++    +++A    I+++    +
Sbjct: 131 GAERILEREINEAAHSDIVEKLVTEL 156


>gi|327329865|gb|EGE71619.1| ATP synthase F0, B subunit [Propionibacterium acnes HL097PA1]
          Length = 184

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++ +  Y+  LA
Sbjct: 19  IIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLA 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   +   Q +   R   +++       A  +I   + +A +EV + +G 
Sbjct: 79  SARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQTERDQAVREVRAEIGG 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
           +   L  ++       D  VQ  +DR    +
Sbjct: 139 LATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|189462114|ref|ZP_03010899.1| hypothetical protein BACCOP_02794 [Bacteroides coprocola DSM 17136]
 gi|189431195|gb|EDV00180.1| hypothetical protein BACCOP_02794 [Bacteroides coprocola DSM 17136]
          Length = 167

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 71/154 (46%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW+ I+FG+ +++  ++  P +  ++E R+  I +  +    A  ++ ++ +  E+
Sbjct: 8   PGLLFWMIIVFGVVFFILAKYGFPVIIKMVEDRKAYIDNSLKAACEANEQLANVKAEGEK 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA A      I+ +  A  ++ ++  +     +    +   + +I+  ++ A +++   
Sbjct: 68  ILAQAHEEQARILAEAAATRDRIIKDAQNRAISEGDRLMIEIKKQIETEKESAIRDIRRQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++  +  K+  +      + ++++DR  D +
Sbjct: 128 VAVLSVGIAEKIMRNKLADAKEQEELIDRMLDEM 161


>gi|237718123|ref|ZP_04548604.1| ATP synthase B subunit [Bacteroides sp. 2_2_4]
 gi|229452544|gb|EEO58335.1| ATP synthase B subunit [Bacteroides sp. 2_2_4]
          Length = 167

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 61/153 (39%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  ++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFLSFGIVFVILAKYGFPVIIKMVEGRKTYIDQSLEVAREANAQLSKLKEEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+   +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILRDAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKSLEDKEAQMGMIDRMLDEV 161


>gi|150006930|ref|YP_001301673.1| ATP synthase subunit B [Parabacteroides distasonis ATCC 8503]
 gi|255016048|ref|ZP_05288174.1| ATP synthase B subunit [Bacteroides sp. 2_1_7]
 gi|256842071|ref|ZP_05547576.1| ATP synthase F0, B subunit [Parabacteroides sp. D13]
 gi|262384327|ref|ZP_06077462.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_33B]
 gi|298377355|ref|ZP_06987308.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_19]
 gi|301308755|ref|ZP_07214707.1| ATP synthase F0, B subunit [Bacteroides sp. 20_3]
 gi|226694340|sp|A6L8N7|ATPF_PARD8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149935354|gb|ABR42051.1| ATP synthase B subunit [Parabacteroides distasonis ATCC 8503]
 gi|256736387|gb|EEU49716.1| ATP synthase F0, B subunit [Parabacteroides sp. D13]
 gi|262294030|gb|EEY81963.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_33B]
 gi|298265769|gb|EFI07429.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_19]
 gi|300833279|gb|EFK63897.1| ATP synthase F0, B subunit [Bacteroides sp. 20_3]
          Length = 166

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 71/154 (46%), Gaps = 2/154 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +   +E R+  I +  E    A   +  + +  E+ 
Sbjct: 9   GLLFWMIVSFGIVFVILSKYGFPVIVKAIEQRKAYIDNSLETARQANERLAHIQAEGEKM 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA A+     ++ +  A  E+ +E  R+    +   ++  A   I + ++KA +EV S +
Sbjct: 69  LAEAKEKQNAVLKEAFAEKERIIEEARKKAVSEAHLQIEEATRRIREEKEKAIREVRSEI 128

Query: 143 GEVTKDLVRKLGFSVS--DADVQKILDRKRDGID 174
            +++  +  K+       D + Q+++DR  D + 
Sbjct: 129 ADLSIAIAEKVMKEKIGRDKEQQQMIDRLLDEVS 162


>gi|318060710|ref|ZP_07979433.1| F0F1 ATP synthase subunit B [Streptomyces sp. SA3_actG]
          Length = 176

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F I + +    +LP ++ +++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 22  ALAFVIVFGLLAWKLLPNINKVLDERREAIEGGMEKAEAARTEADSVLEQYKAQLAEARH 81

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+  +   VG +  +
Sbjct: 82  EAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHTQIEADRKAAATTLRQDVGRLATE 141

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   + +DR  D +DA
Sbjct: 142 LAGKLVGESLEDHARQSRTIDRFLDELDA 170


>gi|242241513|ref|ZP_04795958.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis W23144]
 gi|242235056|gb|EES37367.1| F-ATPase superfamily proton( H+)- or sodium (Na+)-translocating F
           family ATPase epsilon subunit subunit B [Staphylococcus
           epidermidis W23144]
 gi|319399590|gb|EFV87845.1| ATP synthase F0, B subunit [Staphylococcus epidermidis FRI909]
          Length = 171

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
               F I   +  +F    L  +M+ R   I+ D +  + AK   + +     ++L   +
Sbjct: 22  TLATFVILIILLKKFAWGPLKEVMDKRERDINKDIDDAEQAKINAQKLEEENRKTLKETQ 81

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              ++I+D     A +  E       +     +  AQ+EI+  +++A  ++ + V E++ 
Sbjct: 82  DEVQKILDDAKIQARKQHEEIIHEANEKANGMIETAQSEINSQKERAISDINNQVSELSV 141

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
            +  K L   +S+ D ++++++    
Sbjct: 142 LIASKVLRKEISEQDQKELVEKYLKE 167


>gi|310825289|ref|YP_003957647.1| ATP synthase B chain [Stigmatella aurantiaca DW4/3-1]
 gi|309398361|gb|ADO75820.1| ATP synthase B chain [Stigmatella aurantiaca DW4/3-1]
          Length = 182

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  + F +   V        + S++E R   ISS  E     + E E +++  + 
Sbjct: 17  PGLIFWTLVTFILVAVVLRWKAWGPILSLVEEREKQISSAIESAKRERSEAEKLLADQKT 76

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           ++A AR  A E++ K     E+  +       K+       A+ EI+D + KA  EV ++
Sbjct: 77  AIAEARREAAEMMRKNQQDMEKYRDELMNKSRKEAEELKVQARREIEDQKLKAIAEVRTM 136

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
             ++  ++  KL    + DA  + + ++   G+ 
Sbjct: 137 AVDLAMEVAGKLLSERMDDAKHRALAEQFVQGLP 170


>gi|295836490|ref|ZP_06823423.1| ATP synthase F0, beta subunit [Streptomyces sp. SPB74]
 gi|197699017|gb|EDY45950.1| ATP synthase F0, beta subunit [Streptomyces sp. SPB74]
          Length = 180

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F I + +    +LP ++ +++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 26  ALAFVIVFGLLAWKLLPNINKVLDERREAIEGGMEKAEAARTEADSVLEQYKAQLAEARH 85

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+  +   VG +  +
Sbjct: 86  EAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIEADRKAAATTLRQDVGRLATE 145

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   + +DR  D +DA
Sbjct: 146 LAGKLVGESLEDHARQSRTIDRFLDELDA 174


>gi|90415390|ref|ZP_01223324.1| ATP synthase B chain [marine gamma proteobacterium HTCC2207]
 gi|90332713|gb|EAS47883.1| ATP synthase B chain [marine gamma proteobacterium HTCC2207]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   + F  F W   +F+ P +   ME R+  I+   +  D A R++E   +   + + 
Sbjct: 7   LFGQMVTFAFFVWFCMKFVWPVIIESMEERQKKIADGLDAADRALRDLELAQNKATDQMK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  I+D+    A Q ++  +     +       A+ EI+    +A +E+ + V  
Sbjct: 67  EAKQEAAGIVDQANKRANQIVDEAKVQARTEGDRLKVAAEAEIEQEINRAKEELRTTVAG 126

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           +      + L  S+ D   + ++D   + +
Sbjct: 127 LALAGAEEVLEASIDDKANRALVDNLAEQL 156


>gi|50842723|ref|YP_055950.1| F0F1 ATP synthase subunit B [Propionibacterium acnes KPA171202]
 gi|289425215|ref|ZP_06426992.1| ATP synthase F0, B subunit [Propionibacterium acnes SK187]
 gi|289428508|ref|ZP_06430192.1| ATP synthase F0, B subunit [Propionibacterium acnes J165]
 gi|81611638|sp|Q6A8C3|ATPF_PROAC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|50840325|gb|AAT82992.1| ATP synthase B chain [Propionibacterium acnes KPA171202]
 gi|289154193|gb|EFD02881.1| ATP synthase F0, B subunit [Propionibacterium acnes SK187]
 gi|289158202|gb|EFD06421.1| ATP synthase F0, B subunit [Propionibacterium acnes J165]
 gi|313764225|gb|EFS35589.1| ATP synthase F0, B subunit [Propionibacterium acnes HL013PA1]
 gi|313791917|gb|EFS40018.1| ATP synthase F0, B subunit [Propionibacterium acnes HL110PA1]
 gi|313801601|gb|EFS42841.1| ATP synthase F0, B subunit [Propionibacterium acnes HL110PA2]
 gi|313807744|gb|EFS46231.1| ATP synthase F0, B subunit [Propionibacterium acnes HL087PA2]
 gi|313812720|gb|EFS50434.1| ATP synthase F0, B subunit [Propionibacterium acnes HL025PA1]
 gi|313818781|gb|EFS56495.1| ATP synthase F0, B subunit [Propionibacterium acnes HL046PA2]
 gi|313820553|gb|EFS58267.1| ATP synthase F0, B subunit [Propionibacterium acnes HL036PA1]
 gi|313822642|gb|EFS60356.1| ATP synthase F0, B subunit [Propionibacterium acnes HL036PA2]
 gi|313825425|gb|EFS63139.1| ATP synthase F0, B subunit [Propionibacterium acnes HL063PA1]
 gi|313827388|gb|EFS65102.1| ATP synthase F0, B subunit [Propionibacterium acnes HL063PA2]
 gi|313838314|gb|EFS76028.1| ATP synthase F0, B subunit [Propionibacterium acnes HL086PA1]
 gi|314915703|gb|EFS79534.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA4]
 gi|314917928|gb|EFS81759.1| ATP synthase F0, B subunit [Propionibacterium acnes HL050PA1]
 gi|314920311|gb|EFS84142.1| ATP synthase F0, B subunit [Propionibacterium acnes HL050PA3]
 gi|314924918|gb|EFS88749.1| ATP synthase F0, B subunit [Propionibacterium acnes HL036PA3]
 gi|314931531|gb|EFS95362.1| ATP synthase F0, B subunit [Propionibacterium acnes HL067PA1]
 gi|314955542|gb|EFS99945.1| ATP synthase F0, B subunit [Propionibacterium acnes HL027PA1]
 gi|314957916|gb|EFT02019.1| ATP synthase F0, B subunit [Propionibacterium acnes HL002PA1]
 gi|314960557|gb|EFT04659.1| ATP synthase F0, B subunit [Propionibacterium acnes HL002PA2]
 gi|314962573|gb|EFT06673.1| ATP synthase F0, B subunit [Propionibacterium acnes HL082PA1]
 gi|314967564|gb|EFT11663.1| ATP synthase F0, B subunit [Propionibacterium acnes HL037PA1]
 gi|314978728|gb|EFT22822.1| ATP synthase F0, B subunit [Propionibacterium acnes HL072PA2]
 gi|314987896|gb|EFT31987.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA2]
 gi|314989707|gb|EFT33798.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA3]
 gi|315077787|gb|EFT49838.1| ATP synthase F0, B subunit [Propionibacterium acnes HL053PA2]
 gi|315080414|gb|EFT52390.1| ATP synthase F0, B subunit [Propionibacterium acnes HL078PA1]
 gi|315084743|gb|EFT56719.1| ATP synthase F0, B subunit [Propionibacterium acnes HL027PA2]
 gi|315085427|gb|EFT57403.1| ATP synthase F0, B subunit [Propionibacterium acnes HL002PA3]
 gi|315088515|gb|EFT60491.1| ATP synthase F0, B subunit [Propionibacterium acnes HL072PA1]
 gi|315098762|gb|EFT70738.1| ATP synthase F0, B subunit [Propionibacterium acnes HL059PA2]
 gi|315101468|gb|EFT73444.1| ATP synthase F0, B subunit [Propionibacterium acnes HL046PA1]
 gi|315105841|gb|EFT77817.1| ATP synthase F0, B subunit [Propionibacterium acnes HL030PA1]
 gi|315108760|gb|EFT80736.1| ATP synthase F0, B subunit [Propionibacterium acnes HL030PA2]
 gi|327331716|gb|EGE73453.1| ATP synthase F0, B subunit [Propionibacterium acnes HL096PA3]
 gi|327450554|gb|EGE97208.1| ATP synthase F0, B subunit [Propionibacterium acnes HL087PA3]
 gi|327453364|gb|EGF00019.1| ATP synthase F0, B subunit [Propionibacterium acnes HL092PA1]
 gi|327454107|gb|EGF00762.1| ATP synthase F0, B subunit [Propionibacterium acnes HL083PA2]
 gi|328753190|gb|EGF66806.1| ATP synthase F0, B subunit [Propionibacterium acnes HL025PA2]
 gi|328753971|gb|EGF67587.1| ATP synthase F0, B subunit [Propionibacterium acnes HL087PA1]
 gi|328754704|gb|EGF68320.1| ATP synthase F0, B subunit [Propionibacterium acnes HL020PA1]
 gi|332675647|gb|AEE72463.1| ATP synthase subunit b [Propionibacterium acnes 266]
          Length = 184

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++ +  Y+  LA
Sbjct: 19  IIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLA 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   +   Q +   R   +++       A  +I   + +A +EV + +G 
Sbjct: 79  SARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRAEIGG 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
           +   L  ++       D  VQ  +DR    +
Sbjct: 139 LATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|149183574|ref|ZP_01861996.1| ATP synthase (subunit b) [Bacillus sp. SG-1]
 gi|148848715|gb|EDL62943.1| ATP synthase (subunit b) [Bacillus sp. SG-1]
          Length = 170

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 28/158 (17%), Positives = 63/158 (39%), Gaps = 1/158 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
              S       +  ++F +   +  +F    L  IM+ R + I+S+    + ++ E  ++
Sbjct: 8   LGASFNGGDILFQLVMFIVLLALLKKFAWGPLMGIMKEREDHIASEINAAEESRTEANNL 67

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
           +    + L  AR  A+ +I+      EQ  E        +       A+ EI+  +++A 
Sbjct: 68  LEEQRQLLKEARQEAQTMIENSKKQGEQQREEIIATARAEGERLKEAAKREIETQKEQAV 127

Query: 136 QEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
             +   V  ++  +  K +   +S  D QK+++     
Sbjct: 128 TALREQVSSLSVLIASKVIEKELSAEDQQKLINDYIQE 165


>gi|83951211|ref|ZP_00959944.1| ATP synthase F0, B' subunit [Roseovarius nubinhibens ISM]
 gi|83839110|gb|EAP78406.1| ATP synthase F0, B' subunit [Roseovarius nubinhibens ISM]
          Length = 152

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 75/150 (50%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           +Q FWL +   + Y+V  R  LPR+ +I+  R+  I++D    +  K + E    +Y+++
Sbjct: 3   NQIFWLLLTLVVLYFVLSRVALPRIEAILAERQGTITNDLAAAEDLKVKAEEAEQAYQKA 62

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA ARA A+ I+ +  A  + +L+      +  +  K +  + +I ++++ A   V ++ 
Sbjct: 63  LADARAEAQAIVAEAKAEIQADLDAATAKADAQIAAKAAEGEKKIAEIRETALDNVKAVA 122

Query: 143 GEVTKDLVRKLGFSVSDADVQKILDRKRDG 172
            +  K++V  +G       V   ++ +  G
Sbjct: 123 KDTAKEIVAAMGGKADARTVTAAINARMKG 152


>gi|315649874|ref|ZP_07902956.1| ATP synthase F0, B subunit [Paenibacillus vortex V453]
 gi|315274673|gb|EFU38055.1| ATP synthase F0, B subunit [Paenibacillus vortex V453]
          Length = 162

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 72/154 (46%), Gaps = 2/154 (1%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
                 + FG+ Y + H+F   +L +IME RR L+ +  ++    + +    +   +++L
Sbjct: 7   NIVISILAFGVLYVLLHKFAFGKLFAIMEQRRELVINQIDEASKTREQAHVYVEEQKQAL 66

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  A +II++    + +  E   E+ +++      +A  +I+  + KA  E+ S +G
Sbjct: 67  NQARQEAHDIIERSRQTSNKQAEQIVELAKEEADRIKVDALRDIESEKNKAVAELRSELG 126

Query: 144 EVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
            V+  +  KL      +D   ++++D+    +  
Sbjct: 127 SVSVRIASKLIEREVKNDKAQEELVDQYLKEVGG 160


>gi|302334939|ref|YP_003800146.1| ATP synthase F0 subcomplex B subunit [Olsenella uli DSM 7084]
 gi|301318779|gb|ADK67266.1| ATP synthase F0 subcomplex B subunit [Olsenella uli DSM 7084]
          Length = 201

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 66/148 (44%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F + + V  +F  P +  +ME R+  I  D E  + ++ +      +Y   +  A  
Sbjct: 50  LLAFLVIWIVLAKFAWPSILGMMEERQQKIQDDLEAAEESRAQAAEEAKNYTAQITEAHR 109

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A+ II K    A +         +++    +S A   +   +KKA  E+   V +++ +
Sbjct: 110 EAEAIISKARKDATEERTQILAKAQREAADIISKAHGAVGSERKKAMIELSGQVVDLSVE 169

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +  K +G  +S+A+ +K+ ++    + A
Sbjct: 170 IAGKIIGNDLSEAEQRKLAEKYLAEVSA 197


>gi|254491191|ref|ZP_05104372.1| ATP synthase F0, B subunit [Methylophaga thiooxidans DMS010]
 gi|224463704|gb|EEF79972.1| ATP synthase F0, B subunit [Methylophaga thiooxydans DMS010]
          Length = 156

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 60/150 (40%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F +F     +++ P +   +E R+  I+      +  + E E      ++ + 
Sbjct: 7   LIGQMIAFAVFVAFCMKYVWPPIMQALEERKKKIADGLAAAERGRHEQELAEKRAQQVIH 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A +II +      + ++  ++    +    L++A+ EID    +A  E+ + VG 
Sbjct: 67  EAKDQANDIISQAQKRGNEIVDESKDNARVEGERILNSAKAEIDQEANRARDELKTQVGG 126

Query: 145 VTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
           +      K+ G  + +     +LD     I
Sbjct: 127 IALAGAGKILGREIDEKAHTDLLDELVSRI 156


>gi|189183293|ref|YP_001937078.1| ATP synthase B chain [Orientia tsutsugamushi str. Ikeda]
 gi|189180064|dbj|BAG39844.1| ATP synthase B chain [Orientia tsutsugamushi str. Ikeda]
          Length = 165

 Score = 81.0 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 64/150 (42%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  D   F +Q FWL I F     + +  I+P    I   R + ISS  +K +    ++
Sbjct: 1   MPQLDYVFFPTQLFWLVITFTFLLLMVNFIIVPLAERIFSKRNDHISSYIKKAEQTNIQI 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           + +         ++   A+EII++   + E+    +     + +  K+++   EI+ M  
Sbjct: 61  QQINDEISRIARMSELEAEEIINQAKKSTEEIYNQRLMKHSQKIDQKVTDCIAEIEKMTI 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADV 162
                    V + ++DL++KL    ++ D 
Sbjct: 121 NFQNSYKEQVIKYSQDLIKKLTNHEANIDH 150


>gi|88855322|ref|ZP_01129986.1| ATP synthase subunit B [marine actinobacterium PHSC20C1]
 gi|88815229|gb|EAR25087.1| ATP synthase subunit B [marine actinobacterium PHSC20C1]
          Length = 185

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 4/176 (2%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           A  +++       P   + +     W A+ F I  +   +  LP L+  ++ R + I   
Sbjct: 4   ALLAAAGEGEVINPLLPANYD--IVWSAVCFAIILFFFWKKFLPALTKTLDARADAIEGG 61

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
            +K + A+ E  + +  Y+  LA  RA A +I ++        +   +E    +      
Sbjct: 62  IKKAEIAQAEAAAALEQYKTQLAEGRAEAAKIREQARLEGTAIVNELKEQATIEAARITV 121

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           NAQ  I+  ++ A   + + VG +  DL   +       D     ++D+    ++A
Sbjct: 122 NAQATIEAERQAALVSLRTEVGSMAIDLASGVIGQSLSDDKKSSALVDQFLADLEA 177


>gi|160884434|ref|ZP_02065437.1| hypothetical protein BACOVA_02418 [Bacteroides ovatus ATCC 8483]
 gi|260174640|ref|ZP_05761052.1| ATP synthase B subunit [Bacteroides sp. D2]
 gi|293369737|ref|ZP_06616313.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CMC 3f]
 gi|315922904|ref|ZP_07919144.1| ATP synthase B subunit [Bacteroides sp. D2]
 gi|156110173|gb|EDO11918.1| hypothetical protein BACOVA_02418 [Bacteroides ovatus ATCC 8483]
 gi|292635159|gb|EFF53675.1| ATP synthase F0, B subunit [Bacteroides ovatus SD CMC 3f]
 gi|313696779|gb|EFS33614.1| ATP synthase B subunit [Bacteroides sp. D2]
          Length = 167

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  ++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFLSFGIVFVILAKYGFPVIIKMVEGRKTYIDQSLEVAREANAQLSKLKEEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKSLEDKEAQMGMIDRMLDEV 161


>gi|153806527|ref|ZP_01959195.1| hypothetical protein BACCAC_00791 [Bacteroides caccae ATCC 43185]
 gi|149131204|gb|EDM22410.1| hypothetical protein BACCAC_00791 [Bacteroides caccae ATCC 43185]
          Length = 167

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  ++E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFVAFGIVFVILAKYGFPIIIRMVEDRKVYIDQSLEVAREANAQLSKLKQEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILKEAMEERDKIVHEARKQAEIAAQKELDAVRQQIQVEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKSLQDKEAQMGMIDRMLDEV 161


>gi|295095363|emb|CBK84453.1| ATP synthase F0 subcomplex B subunit [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 154

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 5   ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 64

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 65  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVTQAQAEIEAERKRAREELRKQVAI 124

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 125 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 154


>gi|291543820|emb|CBL16929.1| ATP synthase, F0 subunit b [Ruminococcus sp. 18P13]
          Length = 165

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/154 (14%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +    +  +   I + V   F+  R+ +++E R+  ++   +  + A R    +   Y  
Sbjct: 9   VGSLLFTLLNTLILFLVIKHFLFGRVHAVLEARQQEVAKTYQDAEDASRHASELEEEYTG 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +  A+  ++++I      A+   E       KD    L +A  +I+  +K+A  ++   
Sbjct: 69  LMQNAKTESEQLIRNATRTAQSRSEEILAQARKDSGDMLEHAAAQIEQDKKRARNQLRGE 128

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
           + ++  ++ +K+    ++ +D  +++    D + 
Sbjct: 129 ISDLAVEIAQKVVERDLNQSDHDRLISDFIDSVG 162


>gi|313816318|gb|EFS54032.1| ATP synthase F0, B subunit [Propionibacterium acnes HL059PA1]
          Length = 184

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 62/151 (41%), Gaps = 2/151 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++ +  Y+  LA
Sbjct: 19  IIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLA 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             R  A +I D   +   Q +   R   +++       A  +I   + +A +EV + +G 
Sbjct: 79  STRDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRAEIGG 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
           +   L  ++       D  VQ  +DR    +
Sbjct: 139 LATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|255530308|ref|YP_003090680.1| ATP synthase F0 subunit B [Pedobacter heparinus DSM 2366]
 gi|255343292|gb|ACU02618.1| ATP synthase F0, B subunit [Pedobacter heparinus DSM 2366]
          Length = 165

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 64/155 (41%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW AI F     +  +F    + + +  R   I     K + AK+E+  + +  EE
Sbjct: 9   IGLVFWTAIAFICLLILLKKFAWKPILASIHEREQSIDEALNKAELAKQEMARLTTQNEE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR+    I+ +  A  +  +   +     +    +  A+ EI++ +K A  E+ + 
Sbjct: 69  LLKQARSERDLILKEAKALKDSIVNEAKTQAHNEGAKLIEKAKIEIENQKKAALAELKTQ 128

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V  ++ D+  ++  +     A  + ++      ++
Sbjct: 129 VSTLSLDIAERVLRNQLQDKAKQEDLVANLLKDVE 163


>gi|333030310|ref|ZP_08458371.1| ATP synthase subunit b [Bacteroides coprosuis DSM 18011]
 gi|332740907|gb|EGJ71389.1| ATP synthase subunit b [Bacteroides coprosuis DSM 18011]
          Length = 165

 Score = 81.0 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 66/157 (42%), Gaps = 2/157 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW+ + FGI +W+  ++  P +  ++E R+  I    +    A  ++ S+      
Sbjct: 8   VGLLFWMLLSFGIVFWILAKYGFPVIIDMVEGRKKYIDESLKVAKEANEKLASLKEEASR 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +A A      I+ +        +   R    K    +L + + +I   +++A + +   
Sbjct: 68  IVAEANREQGRILRQAQEEKNSIIYEARGEARKLAQKELDDMKIQIQKEKEEAIRSIRKQ 127

Query: 142 VGEVTKDLVRKLGFSVSDADVQK--ILDRKRDGIDAF 176
           V  ++ D+  K+     D + Q+  ++DR  D I A 
Sbjct: 128 VAVLSVDIAEKVIRKNLDEENQQMDMIDRMLDEILAH 164


>gi|183597133|ref|ZP_02958626.1| hypothetical protein PROSTU_00372 [Providencia stuartii ATCC 25827]
 gi|188023443|gb|EDU61483.1| hypothetical protein PROSTU_00372 [Providencia stuartii ATCC 25827]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+ +E   +   + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTDATDRLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q +E  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKQRNQMIEEAKAEAEAERTKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|299146009|ref|ZP_07039077.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_23]
 gi|298516500|gb|EFI40381.1| ATP synthase F0, B subunit [Bacteroides sp. 3_1_23]
          Length = 167

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +  I+E R+  I    E    A  ++  +    +  
Sbjct: 9   GLLFWMFLSFGIVFVILAKYGFPVIIKIVEGRKTYIDQSLEVAREANAQLSKLKEEGDAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILREAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKSLEDKEAQMGMIDRMLDEV 161


>gi|182435960|ref|YP_001823679.1| F0F1 ATP synthase subunit B [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|226695879|sp|B1W0A7|ATPF_STRGG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|178464476|dbj|BAG18996.1| putative ATP synthase B chain [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 189

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I FGI ++V  + +LP ++  +E RR  I    EK +SA+ E +S++  Y+  LA AR 
Sbjct: 35  LICFGIVFFVFSKKLLPVINKTLEERREAIEGGIEKAESAQIEAQSVLEQYKAQLAEARH 94

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        ++  +   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 95  EAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKLATD 154

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A     +DR  D ++A
Sbjct: 155 LAGKLVGESLQDHARQSGTVDRFLDELEA 183


>gi|296119528|ref|ZP_06838086.1| ATP synthase F0, B subunit [Corynebacterium ammoniagenes DSM 20306]
 gi|295967411|gb|EFG80678.1| ATP synthase F0, B subunit [Corynebacterium ammoniagenes DSM 20306]
          Length = 189

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 31/153 (20%), Positives = 71/153 (46%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F I   V   F++P+   +++ R + I    ++ ++ + E ++ +  Y   LA
Sbjct: 31  IVWSLIPFVIILIVFAMFVIPKFQELLQEREDRIEGGIKRAEAQQAEAKAALEKYNAQLA 90

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI ++     +Q     +   E++    ++  + +++  + +   E+ S +G+
Sbjct: 91  DARAEAAEIREQARERGKQIEAEAKTQAEEEAQRIVAGGEKQLEASRAQVVSELRSEIGQ 150

Query: 145 VTKDLVRK-LGFSVSDAD-VQKILDRKRDGIDA 175
            + +L  K LG  +S++      +D     +D+
Sbjct: 151 NSINLAEKLLGGELSESTKQSSTIDNFLSELDS 183


>gi|293393685|ref|ZP_06637994.1| ATP synthase F0 sector subunit B [Serratia odorifera DSM 4582]
 gi|291423807|gb|EFE97027.1| ATP synthase F0 sector subunit B [Serratia odorifera DSM 4582]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  TAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|153002865|ref|YP_001368546.1| F0F1 ATP synthase subunit B [Shewanella baltica OS185]
 gi|160877612|ref|YP_001556928.1| F0F1 ATP synthase subunit B [Shewanella baltica OS195]
 gi|217975452|ref|YP_002360203.1| F0F1 ATP synthase subunit B [Shewanella baltica OS223]
 gi|304412691|ref|ZP_07394294.1| ATP synthase F0, B subunit [Shewanella baltica OS183]
 gi|307305844|ref|ZP_07585590.1| ATP synthase F0, B subunit [Shewanella baltica BA175]
 gi|226694477|sp|A6WUJ4|ATPF_SHEB8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694478|sp|A9KX10|ATPF_SHEB9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|151367483|gb|ABS10483.1| ATP synthase F0, B subunit [Shewanella baltica OS185]
 gi|160863134|gb|ABX51668.1| ATP synthase F0, B subunit [Shewanella baltica OS195]
 gi|217500587|gb|ACK48780.1| ATP synthase F0, B subunit [Shewanella baltica OS223]
 gi|304348901|gb|EFM13316.1| ATP synthase F0, B subunit [Shewanella baltica OS183]
 gi|306911337|gb|EFN41763.1| ATP synthase F0, B subunit [Shewanella baltica BA175]
 gi|315269810|gb|ADT96663.1| ATP synthase F0, B subunit [Shewanella baltica OS678]
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +      + F IF W   +F+ P L + +E R+  I+      D A +++E   +   
Sbjct: 3   FNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+  A EII++      Q +E  +   + +    ++  + EI+  + +  +++  
Sbjct: 63  DQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRK 122

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
            V  +      K+   S+  A    I+++    I
Sbjct: 123 QVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|183220211|ref|YP_001838207.1| F0F1 ATP synthase subunit B [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910329|ref|YP_001961884.1| F0F1 ATP synthase subunit B [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|226741498|sp|B0SDA1|ATPF_LEPBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741499|sp|B0SLC4|ATPF_LEPBP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167775005|gb|ABZ93306.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167778633|gb|ABZ96931.1| ATP synthase F0, B subunit [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 174

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  + F +  +V  +F   ++   +E R + I  D  K +S + E E  +  Y++
Sbjct: 16  PGLVIWTLVTFSVVVFVLKKFAWDKILHALEERASGIQGDINKAESLRVEAEKSLKEYKD 75

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A   A  I+D+    A        E    ++     +A  EI+  + +A  E+ + 
Sbjct: 76  QLFKATEEAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQ 135

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           + E++  +  ++    +   D    ++++   +D 
Sbjct: 136 IVEMSVLIASEILEKQLKKEDYASFVEKEIAKLDK 170


>gi|226741485|sp|A1WZT5|ATPF_HALHL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 156

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 63/150 (42%), Gaps = 2/150 (1%)

Query: 26  FWL-AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           FW   I F +F W T +F+ P +   +  R+  I+      +  K E++   +  E  L 
Sbjct: 7   FWGPMISFALFVWFTMKFVWPPIQQALADRQKQIADGLAAGERGKEELDKAQAEVEAMLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +II++      + +E  R     +    L++A+ EID   ++A +++   V  
Sbjct: 67  DAREQASQIINQANKRQAEMIEEARAEARSEADRILASAREEIDQEIQRAREDLRKQVST 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      ++    V     + ++D     I
Sbjct: 127 IAVQASSQILKREVDAKAHKDLIDELATQI 156


>gi|302558372|ref|ZP_07310714.1| ATP synthase F0, B subunit [Streptomyces griseoflavus Tu4000]
 gi|302475990|gb|EFL39083.1| ATP synthase F0, B subunit [Streptomyces griseoflavus Tu4000]
          Length = 183

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 35/149 (23%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 29  LIAFVIVFGFLAKKLLPTINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 88

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 89  EAARLRQEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIEADRKAAASALRQDVGKLATD 148

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   +++DR  D +D 
Sbjct: 149 LAGKLVGESLEDHARQSRVIDRFLDELDQ 177


>gi|313676659|ref|YP_004054655.1| ATP synthase f0 subcomplex b subunit [Marivirga tractuosa DSM 4126]
 gi|312943357|gb|ADR22547.1| ATP synthase F0 subcomplex B subunit [Marivirga tractuosa DSM 4126]
          Length = 166

 Score = 80.6 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 66/164 (40%), Gaps = 2/164 (1%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                       FF    IFG+   +  +F    + + ++ R   I+   +  ++AK E+
Sbjct: 1   MEQLVNDFSPGLFFMQLFIFGVLLLLLSKFAWKPILNSLKAREGSIADALQSAENAKEEM 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
             + +  ++ L  AR    +++ +    A +  E  +    K     +S+A+N I+  + 
Sbjct: 61  AKLQADNQKLLQEARLERDKLLKEATDIANKIKEEAKSDAAKQADKMISDAKNVIEVEKN 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
            A +EV + V E++ ++  KL       D   + + +     + 
Sbjct: 121 AALKEVTTKVAELSLEIAEKLIRKNLSDDKAQKALAEDFMKDLK 164


>gi|329939835|ref|ZP_08289136.1| F0F1 ATP synthase subunit B [Streptomyces griseoaurantiacus M045]
 gi|329301405|gb|EGG45300.1| F0F1 ATP synthase subunit B [Streptomyces griseoaurantiacus M045]
          Length = 186

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 67/148 (45%), Gaps = 2/148 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +   ++ ++P ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 26  LIAFVIVFGFLYKKLIPNINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 85

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+  +   VG +  D
Sbjct: 86  EAARLRQEAQEQGAALIAEMRAEGQRQREEIIAAGHAQIEADRKAAAHTLRQDVGRLATD 145

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGID 174
           L  KL        A   +++DR  D ++
Sbjct: 146 LAGKLVGESLQDHARQSRVIDRFLDDLE 173


>gi|91795101|ref|YP_564752.1| F0F1 ATP synthase subunit B [Shewanella denitrificans OS217]
 gi|122968365|sp|Q12HP7|ATPF_SHEDO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|91717103|gb|ABE57029.1| ATP synthase F0, B subunit [Shewanella denitrificans OS217]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +     ++ F IF W   +F+ P L + +E R+  I+      D A +++E   S   
Sbjct: 3   FNATLIGQSVAFLIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELARSKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+A A EII++      Q ++  +   + +    ++  + EI+  + +  +++  
Sbjct: 63  DQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRK 122

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
            V  +      K+   S+  A    I+++    I
Sbjct: 123 QVATLAILGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|83591198|ref|YP_431207.1| ATP synthase F0, B subunit [Moorella thermoacetica ATCC 39073]
 gi|123523801|sp|Q2RFX5|ATPF_MOOTA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|1929509|gb|AAB51462.1| ATP synthase subunit b [Moorella thermoacetica]
 gi|83574112|gb|ABC20664.1| ATP synthase F0 subcomplex B subunit [Moorella thermoacetica ATCC
           39073]
          Length = 168

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 69/160 (43%), Gaps = 5/160 (3%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
           F+  TFL Q   L ++ G+ Y   ++     L  ++  R   I  +     +A+ + E++
Sbjct: 10  FNPWTFLFQTLNLLVVMGLLYVFLYK----PLGKVLADREARIEGNLNDAAAAREKAENI 65

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
           ++ Y + L  AR  A+ I+D+    AE+          ++    L+ A+ EI+  + KA 
Sbjct: 66  LAEYRQQLQGARQEAQAILDRATKMAEETRAEIINRAREEAERTLAQARREIEGEKSKAL 125

Query: 136 QEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
             + S    +      K L  S++  D +++       ++
Sbjct: 126 AAIRSEAASLAILAAGKVLERSLTPDDQERLAREAIAEVE 165


>gi|262402098|ref|ZP_06078662.1| ATP synthase B chain [Vibrio sp. RC586]
 gi|262351744|gb|EEZ00876.1| ATP synthase B chain [Vibrio sp. RC586]
          Length = 154

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 65/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 9   AIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EID  + +A  E+   V  +   
Sbjct: 69  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIDAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 129 GAEKILERSIDKDAHKDILDNI 150


>gi|146313758|ref|YP_001178832.1| F0F1 ATP synthase subunit B [Enterobacter sp. 638]
 gi|226741447|sp|A4WGF1|ATPF_ENT38 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145320634|gb|ABP62781.1| ATP synthase F0 subcomplex B subunit [Enterobacter sp. 638]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|94501606|ref|ZP_01308123.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65]
 gi|94426289|gb|EAT11280.1| F0F1-type ATP synthase, subunit b [Oceanobacter sp. RED65]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F  F     +F+ P L + M+ R   I+   +  + A R+++         L 
Sbjct: 7   LIGQIIAFAFFVAFCWKFVWPPLMNAMQERAKKIADGLDAANRADRDLKLAQEKAGSQLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A +II++    A Q ++  ++   ++     + AQ EID    +A + + S V E
Sbjct: 67  EAKEQAAQIIEQANKRANQIIDEAKDAAHQEGERLKAAAQAEIDQEVNRAKETLRSQVSE 126

Query: 145 VTKDLVRKLGFSVSD-ADVQKILDRKRDGI 173
           +      K+  +  D      +LD+  + +
Sbjct: 127 LAVAGASKILETSIDVEKHNALLDKLAEEL 156


>gi|24376223|ref|NP_720267.1| F0F1 ATP synthase subunit B [Shewanella oneidensis MR-1]
 gi|81744607|sp|Q8E8B6|ATPF_SHEON RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24351283|gb|AAN57710.1|AE015907_8 ATP synthase F0, B subunit [Shewanella oneidensis MR-1]
          Length = 156

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +      + F IF W   +F+ P L + +E R+  I+      D A +++E   +   
Sbjct: 3   FNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+  A EII++      Q +E  +   + +    ++  + EI+  + +  +++  
Sbjct: 63  DQLKEAKVTANEIIEQANKRKAQIVEEAKTEADAERAKIIAQGKAEIEAERNRVKEDLRK 122

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
            V  +      K+   S+  A    I+++    I
Sbjct: 123 QVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|145596146|ref|YP_001160443.1| ATP synthase F0, B subunit [Salinispora tropica CNB-440]
 gi|226694473|sp|A4XAW6|ATPF_SALTO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145305483|gb|ABP56065.1| ATP synthase F0, B subunit [Salinispora tropica CNB-440]
          Length = 175

 Score = 80.6 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 68/149 (45%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +  +V  +F++PR+ ++ + R + I    ++ ++A+ E   ++  Y   LA  R 
Sbjct: 23  TIAFALLVFVLLKFVMPRMETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVRT 82

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  I D   A AE   +       ++    ++  + ++   +    +E+ + VG +  D
Sbjct: 83  EAARIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLVAERTTIVRELRTEVGTLAVD 142

Query: 149 LVRKLGFSVSDADVQKI--LDRKRDGIDA 175
           L  K+       + ++   +DR  +G+++
Sbjct: 143 LAGKIVGESLADEARRAGTVDRFLNGLES 171


>gi|239637400|ref|ZP_04678382.1| ATP synthase F0, B subunit [Staphylococcus warneri L37603]
 gi|239597000|gb|EEQ79515.1| ATP synthase F0, B subunit [Staphylococcus warneri L37603]
 gi|330684786|gb|EGG96479.1| ATP synthase F0, B subunit [Staphylococcus epidermidis VCU121]
          Length = 173

 Score = 80.6 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 25/149 (16%), Positives = 63/149 (42%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F I   +  +F    L  +M+ R   I+ D +  + AK   + +    +++L 
Sbjct: 21  VIVQIVTFIILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKLNAQKLEEENKQTLK 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   + I++     A +  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 81  ETQDEVQRILEDAKVQARKQHEEIIHEANVRANGMIETAQSEINSQKERAIADINNQVSE 140

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D ++++++    
Sbjct: 141 LSVLIASKVLRKEISEQDQKELVEKYLKE 169


>gi|256372562|ref|YP_003110386.1| ATP synthase F0, B subunit [Acidimicrobium ferrooxidans DSM 10331]
 gi|256009146|gb|ACU54713.1| ATP synthase F0, B subunit [Acidimicrobium ferrooxidans DSM 10331]
          Length = 173

 Score = 80.6 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 64/153 (41%), Gaps = 1/153 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
            +  W  I F I   V  +   P ++ +M  R + I +D E  D+A+RE E++ +  E  
Sbjct: 18  GEIVWSVISFVILLVVLAKVAYPPVARMMAQRSDRIRADLEAADAARREAEALRAERERE 77

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR  A+ I+D     AE   +   E    +     +  + ++   + +  + + S V
Sbjct: 78  LQGAREDARRILDDARRTAEALRQEASERARAEAEAIRAQVEAQLAAERVQLLRSLRSEV 137

Query: 143 GEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
            ++  +L  K+    +  +    +++      +
Sbjct: 138 ADLAVELAGKIVARELEQSSFDPLIEAFLREAE 170


>gi|89897662|ref|YP_521149.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219670791|ref|YP_002461226.1| ATP synthase F0 subunit beta [Desulfitobacterium hafniense DCB-2]
 gi|122480523|sp|Q24MN7|ATPF_DESHY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|89337110|dbj|BAE86705.1| ATP synthase F0 B subunit [Desulfitobacterium hafniense Y51]
 gi|219541051|gb|ACL22790.1| ATP synthase F0, B subunit [Desulfitobacterium hafniense DCB-2]
          Length = 164

 Score = 80.6 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 27/161 (16%), Positives = 66/161 (40%), Gaps = 1/161 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +   F        + F +  ++  RF    L ++ME RR+ I ++    +  + + E +
Sbjct: 1   MNPIHFDLTLVVQVLSFLLLVYILRRFAWNPLINMMEERRSQIEANIANAEKERLQAEQI 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
              Y+E +  AR  A+E+I K    +EQ           +      +A  +I+  + +A 
Sbjct: 61  KREYQEEMRKARQEAQEVIAKATKLSEQRAAEILAAAHGEAEKIKQSALADIERERDRAI 120

Query: 136 QEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
            +V + V +++  +  K+    +     + ++++    +  
Sbjct: 121 AQVQAQVADLSVAVAEKIIRKNLDVRGQEDMIEQFIQEVGE 161


>gi|328885068|emb|CCA58307.1| ATP synthase B chain [Streptomyces venezuelae ATCC 10712]
          Length = 181

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 72/171 (42%), Gaps = 4/171 (2%)

Query: 7   SDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMD 66
           +      PP        +     I F I +    + +LP ++ ++E RR  I    EK +
Sbjct: 7   AAAEEPQPPLIPH--ADELVIGLIAFVIVFGFLAKKLLPNINKVLEQRREAIEGGIEKAE 64

Query: 67  SAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNE 126
           SA+ E +S++  Y+  LA AR  A  +  +        ++  +   ++     ++    +
Sbjct: 65  SAQIEAQSVLEQYKAQLAEARHEAARLRQEATEQGTAIIQEMKAEGQRQREEIIAAGHTQ 124

Query: 127 IDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD--ADVQKILDRKRDGIDA 175
           I+  +K AS  +   VG++  DL  KL     +  A   + +DR  D ++ 
Sbjct: 125 IEADRKAASASLRQDVGKLATDLAGKLVGESLEDVARQSRTIDRFLDELEE 175


>gi|126176551|ref|YP_001052700.1| F0F1 ATP synthase subunit B [Shewanella baltica OS155]
 gi|226694476|sp|A3DAR8|ATPF_SHEB5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125999756|gb|ABN63831.1| ATP synthase F0, B subunit [Shewanella baltica OS155]
          Length = 156

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 64/154 (41%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +      + F IF W   +F+ P L + +E R+  I+      D A +++E   +   
Sbjct: 3   FNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+  A EII++      Q +E  +     +    ++  + EI+  + +  +++  
Sbjct: 63  DQLKEAKVTANEIIEQANKRKAQIVEEAKTEANAERAKIIAQGKAEIEAERNRVKEDLRK 122

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
            V  +      K+   S+  A    I+++    I
Sbjct: 123 QVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|269219860|ref|ZP_06163714.1| ATP synthase F0, B subunit [Actinomyces sp. oral taxon 848 str.
           F0332]
 gi|269210765|gb|EEZ77105.1| ATP synthase F0, B subunit [Actinomyces sp. oral taxon 848 str.
           F0332]
          Length = 182

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 27/153 (17%), Positives = 58/153 (37%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  + F I      +F  P    +++ R   I     + + A+ E     ++  + + 
Sbjct: 17  LVWGTVSFVIVALAIFKFAWPTFMRLLDERTQKIDEGLNQAERAREETARERAALADEVN 76

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I +   + A   +E  ++    +       AQ +ID   K A  ++   VG 
Sbjct: 77  EARREAAQIRETAQSNAAAIVEDAKKNASVEAKRVADAAQRQIDADAKLARTQLRRDVGS 136

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +  +L  ++     +       ++D   D ++A
Sbjct: 137 LAAELAGRIVGEQALDPKVSSAVVDSFLDELEA 169


>gi|225352597|ref|ZP_03743620.1| hypothetical protein BIFPSEUDO_04222 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156791|gb|EEG70185.1| hypothetical protein BIFPSEUDO_04222 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 173

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  +I  I     ++F LP+  ++ + R   I     K + A+++ +   + YE  L+
Sbjct: 18  IFWSLVILIIVAVFFYKFFLPKFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D     A   +   R   E D     + AQ  I+  Q++A   +   VG 
Sbjct: 78  KARVEASKIRDDARTEASHIIADARTRAENDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  S   +D     ++D+    +D+
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDQMIADLDS 170


>gi|150026488|ref|YP_001297314.1| ATP synthase B subunit [Flavobacterium psychrophilum JIP02/86]
 gi|226741455|sp|A6H2D9|ATPF_FLAPJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149773029|emb|CAL44513.1| ATP synthase B subunit [Flavobacterium psychrophilum JIP02/86]
          Length = 166

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 22/164 (13%), Positives = 60/164 (36%), Gaps = 2/164 (1%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                    L  F    I+F     +  +F    +   +  R + I +     ++A+ E+
Sbjct: 1   MEQLLGQFSLGLFILQIILFVGLILLLKKFAWKPILDAVNEREDGIKNALLSAENARTEM 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           +++ +  +  L  AR     ++       E+ +   +   +   +  +  A+  I+  + 
Sbjct: 61  QNLQADNQRILQEARLERDNMLKDAREIKEKMIADSKTEAQAQGIKMIEQAKAAIESEKN 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
            A  E+ S V  ++ ++  KL      +     K++++    + 
Sbjct: 121 AAMAELKSQVSNLSIEIAEKLLKDELSNKDAQTKLVEKMLGDVK 164


>gi|57239565|ref|YP_180701.1| ATP synthase B chain [Ehrlichia ruminantium str. Welgevonden]
 gi|58579553|ref|YP_197765.1| ATP synthase B chain [Ehrlichia ruminantium str. Welgevonden]
 gi|58617607|ref|YP_196806.1| ATP synthase B chain [Ehrlichia ruminantium str. Gardel]
 gi|57161644|emb|CAH58573.1| putative ATP synthase B subunit [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417219|emb|CAI28332.1| ATP synthase B chain [Ehrlichia ruminantium str. Gardel]
 gi|58418179|emb|CAI27383.1| ATP synthase B chain [Ehrlichia ruminantium str. Welgevonden]
          Length = 167

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 26/142 (18%), Positives = 56/142 (39%)

Query: 14  PPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVE 73
           P  D S++ SQFFW  + F + Y +  + +LP++ +I+  R N+I    + +       +
Sbjct: 5   PQLDISSYPSQFFWFFLSFSVLYIIISKNVLPKIENIVRKRYNIIRCSIDSVKGDLSHAQ 64

Query: 74  SMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKK 133
             +      L   +A    II       +          ++++      A + + +M+ +
Sbjct: 65  QELDKQLLKLTAVQAEVDRIIRSAFDEVQDANVSLMATLDQEIQSMFKMADDNLKNMKLQ 124

Query: 134 ASQEVYSIVGEVTKDLVRKLGF 155
             QE+  +   +      KL  
Sbjct: 125 LEQELIDLAFNIALIYYSKLLG 146


>gi|227552049|ref|ZP_03982098.1| H(+)-transporting ATPase F(0) B subunit [Enterococcus faecium
           TX1330]
 gi|257882703|ref|ZP_05662356.1| ATP synthase F0 [Enterococcus faecium 1,231,502]
 gi|257886789|ref|ZP_05666442.1| ATP synthase F0 [Enterococcus faecium 1,141,733]
 gi|257895357|ref|ZP_05675010.1| ATP synthase F0 [Enterococcus faecium Com12]
 gi|257897969|ref|ZP_05677622.1| ATP synthase F0 [Enterococcus faecium Com15]
 gi|261208696|ref|ZP_05923133.1| ATP synthase F0 [Enterococcus faecium TC 6]
 gi|289566047|ref|ZP_06446484.1| ATP synthase F0, B subunit [Enterococcus faecium D344SRF]
 gi|293378228|ref|ZP_06624397.1| ATP synthase F0, B subunit [Enterococcus faecium PC4.1]
 gi|293556420|ref|ZP_06675001.1| ATP synthase F0, B subunit [Enterococcus faecium E1039]
 gi|293572429|ref|ZP_06683409.1| ATP synthase F0, B subunit [Enterococcus faecium E980]
 gi|294617577|ref|ZP_06697207.1| ATP synthase F0, B subunit [Enterococcus faecium E1679]
 gi|294623200|ref|ZP_06702078.1| ATP synthase F0, B subunit [Enterococcus faecium U0317]
 gi|227178802|gb|EEI59774.1| H(+)-transporting ATPase F(0) B subunit [Enterococcus faecium
           TX1330]
 gi|257818361|gb|EEV45689.1| ATP synthase F0 [Enterococcus faecium 1,231,502]
 gi|257822843|gb|EEV49775.1| ATP synthase F0 [Enterococcus faecium 1,141,733]
 gi|257831922|gb|EEV58343.1| ATP synthase F0 [Enterococcus faecium Com12]
 gi|257835881|gb|EEV60955.1| ATP synthase F0 [Enterococcus faecium Com15]
 gi|260077198|gb|EEW64918.1| ATP synthase F0 [Enterococcus faecium TC 6]
 gi|289162154|gb|EFD10017.1| ATP synthase F0, B subunit [Enterococcus faecium D344SRF]
 gi|291596183|gb|EFF27446.1| ATP synthase F0, B subunit [Enterococcus faecium E1679]
 gi|291597395|gb|EFF28568.1| ATP synthase F0, B subunit [Enterococcus faecium U0317]
 gi|291601487|gb|EFF31758.1| ATP synthase F0, B subunit [Enterococcus faecium E1039]
 gi|291607491|gb|EFF36833.1| ATP synthase F0, B subunit [Enterococcus faecium E980]
 gi|292643092|gb|EFF61233.1| ATP synthase F0, B subunit [Enterococcus faecium PC4.1]
          Length = 174

 Score = 80.2 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
            L     ++  F I   +   F    +S I++ R + I++D +  + ++     M    E
Sbjct: 14  MLGNIIVVSGSFLILLALLKHFAWGPISDILKKREDKIANDLDSAEQSRINSAKMEQERE 73

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  +R+ A +II     + E + +   +  +++     S AQ +I   +  A   V  
Sbjct: 74  QQLLASRSDAADIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKD 133

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            V E++  +  K+    +S    + ++++  +G+ +
Sbjct: 134 DVAELSLQIAEKILNKELSPEMHESLINQYIEGLGS 169


>gi|256848009|ref|ZP_05553453.1| ATP synthase F0, B subunit [Lactobacillus coleohominis 101-4-CHN]
 gi|256715069|gb|EEU30046.1| ATP synthase F0, B subunit [Lactobacillus coleohominis 101-4-CHN]
          Length = 167

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 64/158 (40%), Gaps = 1/158 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           S ++    +  I F I   +   F    ++ +ME R N I+ D +     +++   + + 
Sbjct: 9   SLYMGDMLFYLISFIILALLVWHFAWKPVTEMMEKRANKIADDIDSAAKDRKDAAKLAAQ 68

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  ++  A +I+D+     E       +   ++       AQ + +  ++ A    
Sbjct: 69  RQAELQGSKQEATQIVDEARKNGENLRNQIVDEAHQNAQSIQEQAQRDAEQARQDALNGA 128

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
              V  ++ ++  KL    ++  D Q+++D   +G+  
Sbjct: 129 KDDVANLSLEIAAKLINKQLNADDQQQLIDSYIEGLSK 166


>gi|291456003|ref|ZP_06595393.1| ATP synthase F0, B subunit [Bifidobacterium breve DSM 20213]
 gi|291382412|gb|EFE89930.1| ATP synthase F0, B subunit [Bifidobacterium breve DSM 20213]
          Length = 172

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 9   FSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSA 68
                  F   T+     W  II  I     ++F +P+ ++I + R   I  +  K + A
Sbjct: 4   AEGGIDLFIPETYD--IVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIEGNIAKAEQA 61

Query: 69  KREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEID 128
           K++ +   + YE  L+ AR  A +I D   A A   +   R   E D     ++AQ  I+
Sbjct: 62  KKDADEAKAKYEAQLSTARVDAAKIRDDARAEASHIISDARSRAESDAAQITASAQRSIE 121

Query: 129 DMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
             Q++A   +   VG +   L  K+  +    +     ++D   D +DA
Sbjct: 122 SQQQQAIVSLKGEVGALATALAGKILGAKLEDNDVQSSMIDSMIDDLDA 170


>gi|166033112|ref|ZP_02235941.1| hypothetical protein DORFOR_02834 [Dorea formicigenerans ATCC
           27755]
 gi|166027469|gb|EDR46226.1| hypothetical protein DORFOR_02834 [Dorea formicigenerans ATCC
           27755]
          Length = 166

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 64/151 (42%), Gaps = 1/151 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I   +FY +  +F+   +  IME R  +I+   +     + E ES+   YE +L+
Sbjct: 8   LLWTIINLVVFYLLLKKFLFKPVMGIMEKREQMIADGLKNASDRQEEAESLKKEYESALS 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  + +I++     A++  +      ++     +  A+  I+  +K+A   V + +  
Sbjct: 68  GAKEESVKIVENARVEAKRQSDEILADADRRADATIERARKTIETERKQALDGVETQIAG 127

Query: 145 VTKDLVRKLGFSVSDAD-VQKILDRKRDGID 174
           +     RK+    +     Q I D+  + + 
Sbjct: 128 LAMQAARKIVDEETRKQGNQAIYDQFLESVG 158


>gi|327443492|gb|EGE90146.1| ATP synthase F0, B subunit [Propionibacterium acnes HL013PA2]
          Length = 184

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 63/151 (41%), Gaps = 2/151 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++ +  Y+  LA
Sbjct: 19  IIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLA 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   +   Q +   R   +++       A  +I   + +A +EV + +G 
Sbjct: 79  SARDEAAQIRDDAKSQGAQIIAVMRANAQEEADRITERANAQIQAERDQAVREVRAEIGG 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
           +   L  ++       D  VQ  +DR    +
Sbjct: 139 LATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|294638355|ref|ZP_06716608.1| ATP synthase F0, B subunit [Edwardsiella tarda ATCC 23685]
 gi|291088608|gb|EFE21169.1| ATP synthase F0, B subunit [Edwardsiella tarda ATCC 23685]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKADAQVIIEQANKRKSQIIDEAKAEAEQERAKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|288550151|ref|ZP_05969465.2| hypothetical protein ENTCAN_08070 [Enterobacter cancerogenus ATCC
           35316]
 gi|288315959|gb|EFC54897.1| ATP synthase F0, B subunit [Enterobacter cancerogenus ATCC 35316]
          Length = 154

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 5   ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 64

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 65  KAKAEAQVIIEQANKRRAQILDEAKAEAEQERTKIVTQAQAEIEAERKRAREELRKQVAI 124

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 125 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 154


>gi|269925189|ref|YP_003321812.1| ATP synthase F0, B subunit [Thermobaculum terrenum ATCC BAA-798]
 gi|269788849|gb|ACZ40990.1| ATP synthase F0, B subunit [Thermobaculum terrenum ATCC BAA-798]
          Length = 175

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 61/149 (40%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           F W  + F I  +V  RF    ++ I++ R   +    E  +  +RE        ++ L 
Sbjct: 15  FIWQLVAFLILVYVLKRFAFGPVTRILDERAARVRESIETAERIQREAAEQEQRTKQMLE 74

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A+ I+ +   AAE+     ++   +     +  AQ +ID M+ +A  E+   V +
Sbjct: 75  DARRQAQAILQQAQQAAERIQSTAQDNAREQANQIIQRAQEDIDRMKAEAIDELRRQVAD 134

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDG 172
           +      ++    +  A  + +++     
Sbjct: 135 LAIAAASRIIRKELDPATHRALINEVLAE 163


>gi|226694486|sp|Q0A4M4|ATPF_ALHEH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 64/150 (42%), Gaps = 2/150 (1%)

Query: 26  FWL-AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           FW   I F +F W T +++ P + + M  R+  I+      +  ++E++   S  ++ L 
Sbjct: 7   FWGPMISFALFVWFTMKYVWPPIQTAMADRQKQIADGLAAGERGQKELDQAKSEVDKMLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A ++I +      + +E  RE   ++    L+ A++EID    +A   +   V  
Sbjct: 67  EAREQASQVIAQANKRQSELVEQAREEARQEAERVLAQARSEIDTEISQARDALRKEVVN 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      ++    +     + ++D     +
Sbjct: 127 LAVAGSSRILKREIDAKAHKDLIDDLVKQL 156


>gi|313204904|ref|YP_004043561.1| ATP synthase f0 subcomplex b subunit [Paludibacter propionicigenes
           WB4]
 gi|312444220|gb|ADQ80576.1| ATP synthase F0 subcomplex B subunit [Paludibacter propionicigenes
           WB4]
          Length = 166

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 69/154 (44%), Gaps = 2/154 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI  ++  ++  P +  ++E R+  I +       A  E+ ++ +  E  
Sbjct: 9   GLLFWMLLSFGIVAFILVKYGFPVIIKMVEERKAYIDNSLNVAIQAHEELANVRAEGEAI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +  AR    +I+++     +  ++  +E    +    + +A+ +I   ++ A +++   V
Sbjct: 69  VDNARREQVKIMNEAAQTRDMLIKDAKEKAGIEADKLIEDARKQILIEKEDAIRDIRRQV 128

Query: 143 GEVTKDLVRKL--GFSVSDADVQKILDRKRDGID 174
            E++ D+  K+  G          ++DR  D I+
Sbjct: 129 AELSVDIAEKILRGQLAEKDQQMAMIDRLLDEIN 162


>gi|110835591|ref|YP_694450.1| ATP synthase F0 subunit B [Alcanivorax borkumensis SK2]
 gi|123050199|sp|Q0VKX0|ATPF_ALCBS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|110648702|emb|CAL18178.1| ATP synthase F0, B subunit [Alcanivorax borkumensis SK2]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 70/156 (44%), Gaps = 5/156 (3%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +T + Q  W    F +F +   +F+ P +S  ++ R+  I+      D A+R++E     
Sbjct: 5   ATLIGQAIW----FALFVFFCMKFVWPPISRALDERKQKIAEGLSAADRAERDLELAQEK 60

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
              +L  ++  A EIID+    A Q +E  ++    +    ++ A +EID    +A +++
Sbjct: 61  ATANLKESKEKAAEIIDQANRRANQIVEEAKDAARAEGERLIAKAHSEIDQEVNQAREQL 120

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
              V  +      K LG  V+     ++L++    +
Sbjct: 121 RKDVAVLALSGAEKVLGGEVNQDKHTQLLEQLAAEL 156


>gi|289550277|ref|YP_003471181.1| ATP synthase B chain [Staphylococcus lugdunensis HKU09-01]
 gi|315660263|ref|ZP_07913118.1| ATP synthase F0 sector subunit B [Staphylococcus lugdunensis
           M23590]
 gi|289179809|gb|ADC87054.1| ATP synthase B chain [Staphylococcus lugdunensis HKU09-01]
 gi|315494690|gb|EFU83030.1| ATP synthase F0 sector subunit B [Staphylococcus lugdunensis
           M23590]
          Length = 174

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 61/149 (40%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                  F I   +  +F    L  +M+ R   I+ D +  + AK   + +    +++L 
Sbjct: 22  IIVTLATFAILLALLKKFAWGPLKEVMDKRERDINKDIDDAEQAKENAQKLEEENQKTLK 81

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +   + I++     A +  E             +  AQ+EI+  +++A  ++ + V E
Sbjct: 82  ETQEEVQRILEDAKVQARKQQEEIIHEANVRANGMIETAQSEINSQKERALADINNQVSE 141

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++  +  K L   +S+ D + ++D+    
Sbjct: 142 LSVLIASKVLQKEISEQDQKALVDKYIKE 170


>gi|170729220|ref|YP_001763246.1| F0F1 ATP synthase subunit B [Shewanella woodyi ATCC 51908]
 gi|226694919|sp|B1KQ38|ATPF_SHEWM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|169814567|gb|ACA89151.1| ATP synthase F0, B subunit [Shewanella woodyi ATCC 51908]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F IF W   +F+ P L + +E R+  I+      D A +++E   +   + L  A+A
Sbjct: 11  TVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q ++  +   + +    ++  Q EI+  + +  +++   V  +   
Sbjct: 71  TANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDLRKQVATLAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+ +A    I+++    +
Sbjct: 131 GAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|119715994|ref|YP_922959.1| ATP synthase F0, B subunit [Nocardioides sp. JS614]
 gi|226694328|sp|A1SHI7|ATPF_NOCSJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119536655|gb|ABL81272.1| ATP synthase F0 subcomplex B subunit [Nocardioides sp. JS614]
          Length = 189

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 64/152 (42%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                ++FG+  +   +F+ PR   I   R   I       ++ + E ++ ++  E+ L+
Sbjct: 25  IVLSLVVFGLLLFAVWKFVTPRFEQIYTERTQAIEGGLAAAETKQAEADAKLADLEQQLS 84

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A  I ++      Q +   RE  + D    + + + +I+  +++A   + + VG 
Sbjct: 85  EARHEAARIREEAREQGAQIIAEMREQAQADAARIVEHGKTQIEAERQQAVTSLRAEVGT 144

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
           +   L  ++       D    ++++R    ++
Sbjct: 145 LATSLAGRIVGESLEDDDRSARVVERFLADLE 176


>gi|258622938|ref|ZP_05717953.1| ATP synthase F0, B subunit [Vibrio mimicus VM573]
 gi|258625005|ref|ZP_05719928.1| ATP synthase F0, B subunit [Vibrio mimicus VM603]
 gi|262166766|ref|ZP_06034503.1| ATP synthase B chain [Vibrio mimicus VM223]
 gi|262172745|ref|ZP_06040423.1| ATP synthase B chain [Vibrio mimicus MB-451]
 gi|258582703|gb|EEW07529.1| ATP synthase F0, B subunit [Vibrio mimicus VM603]
 gi|258584721|gb|EEW09455.1| ATP synthase F0, B subunit [Vibrio mimicus VM573]
 gi|261893821|gb|EEY39807.1| ATP synthase B chain [Vibrio mimicus MB-451]
 gi|262026482|gb|EEY45150.1| ATP synthase B chain [Vibrio mimicus VM223]
          Length = 154

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 64/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 9   AIAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A  EI+  + +A  E+   V  +   
Sbjct: 69  TATELIEQANKRKAQIIDEAREEAQAERQKILTQADAEIEAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 129 GAEKILERSIDKDAHKDILDNI 150


>gi|257064831|ref|YP_003144503.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
 gi|256792484|gb|ACV23154.1| ATP synthase, F0 subunit b [Slackia heliotrinireducens DSM 20476]
          Length = 203

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 73/150 (48%), Gaps = 1/150 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
           + + F I + +  +F  P    ++E R + I +D +  + A+ E E +++ Y++ LA A+
Sbjct: 51  MLVAFIILWIILAKFGWPIFDGMLEKRESTIRNDLKNAEEARMESERILAEYKQQLAEAK 110

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+     A E          + +    +  A+  I+  +K A  ++   V +++ 
Sbjct: 111 AEASQIVANAKKAGEDVKADITAKAQVEADGMIEKARAAIEAEKKAAIADLQGSVADISV 170

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGIDAF 176
           ++  K +G  +SD + + I+ R  + + +F
Sbjct: 171 EVASKVIGTDLSDDEHRAIIKRYVEEVGSF 200


>gi|242241383|ref|YP_002989564.1| F0F1 ATP synthase subunit B [Dickeya dadantii Ech703]
 gi|242133440|gb|ACS87742.1| ATP synthase F0, B subunit [Dickeya dadantii Ech703]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+++    ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ I+++      Q LE  +   E +    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKADAQHIVEQANKQRAQILEEAKTEAEVERNKIVAQAQAEIEAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|114565199|ref|YP_752713.1| F0F1 ATP synthase subunit B [Shewanella frigidimarina NCIMB 400]
 gi|122298237|sp|Q07VU0|ATPF_SHEFN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|114336492|gb|ABI73874.1| ATP synthase F0, B subunit [Shewanella frigidimarina NCIMB 400]
          Length = 156

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 62/154 (40%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +  F   + F +F W   +F+ P L + +E R+  I+        A +++E       
Sbjct: 3   FNATLFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  A+  A EII++      Q +E  +   + +    ++  Q EI++ + +   ++  
Sbjct: 63  EQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLRK 122

Query: 141 IVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGI 173
            V  +      K+    +       I+++    I
Sbjct: 123 QVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI 156


>gi|69247779|ref|ZP_00604484.1| ATP synthase F0, subunit B [Enterococcus faecium DO]
 gi|257879710|ref|ZP_05659363.1| ATP synthase F0 [Enterococcus faecium 1,230,933]
 gi|257884017|ref|ZP_05663670.1| ATP synthase F0 [Enterococcus faecium 1,231,501]
 gi|257890374|ref|ZP_05670027.1| ATP synthase F0 [Enterococcus faecium 1,231,410]
 gi|257892982|ref|ZP_05672635.1| ATP synthase F0 [Enterococcus faecium 1,231,408]
 gi|258616680|ref|ZP_05714450.1| ATP synthase F0, B subunit [Enterococcus faecium DO]
 gi|260559631|ref|ZP_05831811.1| ATP synthase F0 [Enterococcus faecium C68]
 gi|293560032|ref|ZP_06676536.1| ATP synthase F0, B subunit [Enterococcus faecium E1162]
 gi|293568728|ref|ZP_06680043.1| ATP synthase F0, B subunit [Enterococcus faecium E1071]
 gi|314939616|ref|ZP_07846843.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a04]
 gi|314941242|ref|ZP_07848138.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133C]
 gi|314949825|ref|ZP_07853135.1| ATP synthase F0, B subunit [Enterococcus faecium TX0082]
 gi|314953383|ref|ZP_07856308.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133A]
 gi|314993460|ref|ZP_07858825.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133B]
 gi|314997317|ref|ZP_07862282.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a01]
 gi|68194708|gb|EAN09190.1| ATP synthase F0, subunit B [Enterococcus faecium DO]
 gi|257813938|gb|EEV42696.1| ATP synthase F0 [Enterococcus faecium 1,230,933]
 gi|257819855|gb|EEV47003.1| ATP synthase F0 [Enterococcus faecium 1,231,501]
 gi|257826734|gb|EEV53360.1| ATP synthase F0 [Enterococcus faecium 1,231,410]
 gi|257829361|gb|EEV55968.1| ATP synthase F0 [Enterococcus faecium 1,231,408]
 gi|260074299|gb|EEW62621.1| ATP synthase F0 [Enterococcus faecium C68]
 gi|291588688|gb|EFF20521.1| ATP synthase F0, B subunit [Enterococcus faecium E1071]
 gi|291605899|gb|EFF35329.1| ATP synthase F0, B subunit [Enterococcus faecium E1162]
 gi|313588608|gb|EFR67453.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a01]
 gi|313592125|gb|EFR70970.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133B]
 gi|313594576|gb|EFR73421.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133A]
 gi|313599966|gb|EFR78809.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133C]
 gi|313641156|gb|EFS05736.1| ATP synthase F0, B subunit [Enterococcus faecium TX0133a04]
 gi|313643898|gb|EFS08478.1| ATP synthase F0, B subunit [Enterococcus faecium TX0082]
          Length = 174

 Score = 80.2 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
            L     ++  F I   +   F    +S I++ R + I++D +  + ++     M    E
Sbjct: 14  MLGNVIVVSGSFLILLALLKHFAWGPISDILKKREDKIANDLDSAEQSRINSAKMEQERE 73

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  +R+ A +II     + E + +   +  +++     S AQ +I   +  A   V  
Sbjct: 74  QQLLASRSDAADIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKD 133

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            V E++  +  K+    +S    + ++++  +G+ +
Sbjct: 134 DVAELSLQIAEKILNKELSPEMHESLINQYIEGLGS 169


>gi|73667487|ref|YP_303503.1| H+-transporting two-sector ATPase, B/B' subunit [Ehrlichia canis
           str. Jake]
 gi|72394628|gb|AAZ68905.1| H+-transporting two-sector ATPase, B/B' subunit [Ehrlichia canis
           str. Jake]
          Length = 167

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 14  PPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVE 73
           P  D +++ SQ FW  + FGI Y V  + ILP++ +++  R N+       +++    ++
Sbjct: 5   PQLDITSYPSQLFWFFLSFGILYLVISKNILPKVENVIRKRYNITRGSINCVENDLNLIQ 64

Query: 74  SMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKK 133
             +     SL   +A A +II   +   +           +++    S A   + +++ +
Sbjct: 65  HELKKQLLSLDEVKAEADKIISSALQEVKSTNADLITALNEEIKKMFSTADEYMHNLKHQ 124

Query: 134 ASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKIL 166
             QE+  +  E+     +K LG    D D  + +
Sbjct: 125 VEQELIDLTCEIALLYYKKMLGTEYIDKDKLRDI 158


>gi|238060780|ref|ZP_04605489.1| ATP synthase F0, B subunit [Micromonospora sp. ATCC 39149]
 gi|237882591|gb|EEP71419.1| ATP synthase F0, B subunit [Micromonospora sp. ATCC 39149]
          Length = 177

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 64/148 (43%), Gaps = 2/148 (1%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F +   V  +F+ PR+    + R + I    ++ ++A+ E   ++  Y   LA AR  
Sbjct: 26  IAFVLLCIVLMKFVFPRMEQTFQARVDAIEGGIKRAEAAQAEANQLLEQYRAQLAEARTD 85

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A +I D   A AE   +       ++    ++  + ++   +    +E+ + VG +  DL
Sbjct: 86  AAKIRDDARADAEGIRQDILAKAREESDRIIAAGKEQLAAERATIVRELRTEVGTIAVDL 145

Query: 150 VRKLGFS--VSDADVQKILDRKRDGIDA 175
             K+       +A  +  +DR    +++
Sbjct: 146 ASKIVGESLADEARRKGTVDRFLSDLES 173


>gi|332828936|gb|EGK01619.1| ATP synthase subunit B [Dysgonomonas gadei ATCC BAA-286]
          Length = 166

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 67/152 (44%), Gaps = 2/152 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI +++  +F  P ++ +++ R+N I    +    A  ++  +    +E 
Sbjct: 9   GLLFWMLLSFGIVFFILAKFGFPVITKMVDERKNYIQDSLDAAHKANEQLAKIKEKSDEL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  A+A   +I+       ++ +   RE  +     +L   + +I   +++A +++   V
Sbjct: 69  LNSAKAEQVKILKDAADTRDRIVNEAREQAKVAGAKELEEIRKQIQAEKEQAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDG 172
            E++ D+  K+             ++DR  D 
Sbjct: 129 AELSVDVAEKVLRESLKDPKAQMSMIDRLVDE 160


>gi|146284506|ref|YP_001174659.1| ATP synthase B chain [Pseudomonas stutzeri A1501]
 gi|226694444|sp|A4VS66|ATPF_PSEU5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145572711|gb|ABP81817.1| ATP synthase B chain [Pseudomonas stutzeri A1501]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   + F IF W   + + P +++ M  R+  I+   +    A+++++        +L 
Sbjct: 7   LFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDKVSHTLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +  A +II++    A   +E  ++    +    ++ A+ EI+    +A  ++ S V  
Sbjct: 67  ETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQLRSQVAA 126

Query: 145 VTKDLVRKLGFS-VSDADVQKILDRKRDGI 173
           +      K+  S V      +++++    +
Sbjct: 127 LAVAGAEKILESQVDAKVHNELVEKLASQL 156


>gi|332308603|ref|YP_004436454.1| ATP synthase F0, B subunit [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175932|gb|AEE25186.1| ATP synthase F0, B subunit [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   I F  F W   +F+ P +   +E R+  I+      +  ++++E   +   E L 
Sbjct: 7   LFGELIAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAKATEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  II++      Q ++ + +   ++  + ++    EI+  + +A +++   V  
Sbjct: 67  EAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDLRKQVAV 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    +  A    I+++    +
Sbjct: 127 LAVAGAEKILERQIDAAAQSDIVEKLVAEL 156


>gi|148543698|ref|YP_001271068.1| ATP synthase F0, B subunit [Lactobacillus reuteri DSM 20016]
 gi|184153108|ref|YP_001841449.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194468261|ref|ZP_03074247.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227363323|ref|ZP_03847452.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227544497|ref|ZP_03974546.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300909315|ref|ZP_07126776.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|325682069|ref|ZP_08161587.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
 gi|226741494|sp|A5VIQ7|ATPF_LACRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741495|sp|B2G687|ATPF_LACRJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148530732|gb|ABQ82731.1| ATP synthase F0 subcomplex B subunit [Lactobacillus reuteri DSM
           20016]
 gi|154705566|gb|ABS84209.1| ATP synthase F0 B subunit [Lactobacillus reuteri]
 gi|183224452|dbj|BAG24969.1| ATP synthase B subunit [Lactobacillus reuteri JCM 1112]
 gi|194453114|gb|EDX42012.1| ATP synthase F0, B subunit [Lactobacillus reuteri 100-23]
 gi|227071630|gb|EEI09924.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           MM2-3]
 gi|227185520|gb|EEI65591.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus reuteri
           CF48-3A]
 gi|300893180|gb|EFK86539.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri SD2112]
 gi|324978713|gb|EGC15662.1| ATP synthase F0 sector subunit B [Lactobacillus reuteri MM4-1A]
          Length = 172

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 64/159 (40%), Gaps = 1/159 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           S ++    +  + F I   +   F    ++ +M+ R + I++D +    ++   E M + 
Sbjct: 12  SLYIGDLVFYIVTFIILMLLVKHFAWKPVTDMMKKRADKIANDIDNAARSRESAEKMAAK 71

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  +R  A EI+     + E       E  +KD       AQ + +  ++ A    
Sbjct: 72  RQAELQSSRQEAAEIVSNAKKSGETQRAQIVETAQKDAQALKQQAQKDAEQARRDALNSA 131

Query: 139 YSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
              V  ++ ++  KL    +   D ++++D   +G+   
Sbjct: 132 KDDVANLSIEIASKLIQKELKADDQKELIDSYIEGLVEH 170


>gi|221195234|ref|ZP_03568290.1| ATP synthase F0, B subunit [Atopobium rimae ATCC 49626]
 gi|221185137|gb|EEE17528.1| ATP synthase F0, B subunit [Atopobium rimae ATCC 49626]
          Length = 203

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 66/148 (44%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I ++V  +F  P +  +ME R+  I  D +  +++  +      +   S+  AR 
Sbjct: 51  LIAFLIIWFVLGKFAWPSILKMMESRQEKIQEDLDAAENSHIKAAEDQKAAAASIDEARR 110

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EI+       E+      E  +K+    ++   + +D  +++   ++ S V +++ +
Sbjct: 111 KADEIVSAAKREGEEERAHIIEQAKKEASDIIAKGHSAVDSERRRCLTDLSSSVVDLSVE 170

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +  K +G  + +A  +++ ++    +  
Sbjct: 171 IAGKIIGNELDEAQQRRLAEKYLAEVGK 198


>gi|15673750|ref|NP_267924.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116512627|ref|YP_811534.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125624729|ref|YP_001033212.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281492360|ref|YP_003354340.1| ATP synthase F0 subunit B [Lactococcus lactis subsp. lactis KF147]
 gi|61219599|sp|P0A2Z0|ATPF_LACLA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219602|sp|P0A2Z1|ATPF_LACLM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123320232|sp|Q02XA1|ATPF_LACLS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|6048349|gb|AAF02204.1|AF059739_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|12724791|gb|AAK05866.1|AE006407_2 ATP synthase subunit b [Lactococcus lactis subsp. lactis Il1403]
 gi|116108281|gb|ABJ73421.1| ATP synthase F0 subcomplex B subunit [Lactococcus lactis subsp.
           cremoris SK11]
 gi|124493537|emb|CAL98518.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281376024|gb|ADA65515.1| ATP synthase F0, B subunit [Lactococcus lactis subsp. lactis KF147]
 gi|300071526|gb|ADJ60926.1| F0F1 ATP synthase subunit B [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 168

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 64/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            +T L     ++  F I   +   F    ++S+   R   IS D +  ++  ++   ++ 
Sbjct: 10  PNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVK 69

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             +  LA ++  A  II      A QN         ++       AQ +I+  +K+A   
Sbjct: 70  QRQAELAGSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNT 129

Query: 138 VYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V   V +++  +  K +G S+  +  Q+++D     +  
Sbjct: 130 VKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|314923490|gb|EFS87321.1| ATP synthase F0, B subunit [Propionibacterium acnes HL001PA1]
 gi|314966535|gb|EFT10634.1| ATP synthase F0, B subunit [Propionibacterium acnes HL082PA2]
 gi|315092945|gb|EFT64921.1| ATP synthase F0, B subunit [Propionibacterium acnes HL060PA1]
 gi|327327359|gb|EGE69135.1| ATP synthase F0, B subunit [Propionibacterium acnes HL103PA1]
          Length = 184

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 65/161 (40%), Gaps = 3/161 (1%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P        +     I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++
Sbjct: 10  PLAPEH-PVEIIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAEKAQAEAKA 68

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
            +  Y+  LA AR  A +I D   +   Q +   R   +++       A  +I   + +A
Sbjct: 69  ALEKYQAQLASARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQA 128

Query: 135 SQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
            +EV + +G +   L  ++       D  VQ  +DR    +
Sbjct: 129 VREVRAEIGGLATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|226741483|sp|A4ITJ3|ATPF_GEOTN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 180

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  + F +   +  +F    L  +M+ R   I+++ ++ +  ++E E ++    E L 
Sbjct: 24  IIFQLVAFILLMLLLRKFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLK 83

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A+ I++     AE+  E        +       A+ EI+  +++A   +   V  
Sbjct: 84  QSRQEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVAS 143

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           ++  +  K +   +++ D +K+++     I
Sbjct: 144 LSVLIASKVIERELTEQDQRKLIEAYIKDI 173


>gi|182677734|ref|YP_001831880.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|226698371|sp|B2IGK9|ATPX_BEII9 RecName: Full=ATP synthase subunit b/b'; AltName: Full=ATP synthase
           F(0) sector subunit b/b'; AltName: Full=ATPase subunit
           II; AltName: Full=F-type ATPase subunit b/b';
           Short=F-ATPase subunit b/b'
 gi|182633617|gb|ACB94391.1| H+transporting two-sector ATPase B/B' subunit [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 187

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 70/158 (44%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
                   FPPFD+S F     WLAI F + Y +  + +LPR+  I+  R   + SD  +
Sbjct: 21  PHEGQGEPFPPFDSSNFAPLLIWLAISFLLLYALMSKLVLPRIGGILHTRNEKLRSDMHE 80

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
             +   + +   +  E+++A A+A A  +  +  A      + ++   E +L  KL+ A+
Sbjct: 81  ATALHAQAKEAAALQEKTIADAKAKAIALAQENQAKLRAESDAKQHAVEAELAAKLTAAE 140

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADV 162
             I + +  A   V +I  E    +V++      DA  
Sbjct: 141 ARITETKAAAMSNVTAIAQEAASAIVQQFTGKAPDAKK 178


>gi|157377620|ref|YP_001476220.1| F0F1 ATP synthase subunit B [Shewanella sediminis HAW-EB3]
 gi|226694917|sp|A8G1W9|ATPF_SHESH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157319994|gb|ABV39092.1| ATP synthase F0, B subunit [Shewanella sediminis HAW-EB3]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F IF W   +F+ P L + +E R+  I+      D A +++E   S   + L  A+A
Sbjct: 11  TVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQSKATDQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q ++  +   + +    ++  Q EI+  + +  +++   V  +   
Sbjct: 71  TANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGQAEIEAERNRVKEDLRKQVATLAIY 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+ +A    I+++    +
Sbjct: 131 GAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|154489791|ref|ZP_02030052.1| hypothetical protein PARMER_00019 [Parabacteroides merdae ATCC
           43184]
 gi|154089516|gb|EDN88560.1| hypothetical protein PARMER_00019 [Parabacteroides merdae ATCC
           43184]
          Length = 166

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 69/154 (44%), Gaps = 2/154 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + +  ++  P +   +E R+  I +  E    A  ++ ++ +     
Sbjct: 9   GLLFWMIVSFGIVFVILSKYGFPVIIKAVEQRKAYIDNSLETARQANEQLANIQAEGARI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA A+     I+ +  A  EQ ++        +   ++  A   I + ++KA +EV S +
Sbjct: 69  LAEAKEKQNAILKEAFAEKEQIIDEAHRKAAAETRLQVEEAARRIREEKEKAIREVRSEI 128

Query: 143 GEVTKDLVRKLGFSVS--DADVQKILDRKRDGID 174
            +++  +  K+       D + Q+I+DR  D + 
Sbjct: 129 ADLSIAIAEKVMKEKISRDKEQQQIIDRLLDEVS 162


>gi|149675735|dbj|BAF64749.1| FOF1-type ATP synthase b subunit [Shewanella livingstonensis]
          Length = 159

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 62/154 (40%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +  F   + F +F W   +F+ P L + +E R+  I+        A +++E       
Sbjct: 6   FNATLFGQTVAFILFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQIKAT 65

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  A+  A EII++      Q +E  +   + +    ++  Q EI++ + +   ++  
Sbjct: 66  EQLKEAKVTANEIIEQANKRKAQIVEEAKVEAQTERAKIIAQGQAEIENERNRVKDDLRK 125

Query: 141 IVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGI 173
            V  +      K+    +       I+++    I
Sbjct: 126 QVALLAIAGAEKILERTIDPEAHSDIVNKLVAEI 159


>gi|86160753|ref|YP_467538.1| ATP synthase F0 subunit B [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497396|sp|Q2IHP6|ATPF_ANADE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|85777264|gb|ABC84101.1| ATP synthase F0 subcomplex B subunit [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 179

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W AI F +   V  +F    +  ++  R   I    +     + E E ++++ +E
Sbjct: 21  PGLTLWTAITFLVMLAVLAKFAWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKE 80

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           SL+ A+  A E+  +     E   +       K+    ++ A+ +I +   KA  E+ + 
Sbjct: 81  SLSKAQREAAELARRNQQEVEALRQELTAKARKEADELVAEARRQIAEELVKAKAELKAQ 140

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           V ++  D   +L   ++ +   + +++     + A
Sbjct: 141 VVDLAIDAASRLVKANLDEKSQRALVEEYIAQLPA 175


>gi|238921739|ref|YP_002935254.1| F0F1 ATP synthase subunit B [Edwardsiella ictaluri 93-146]
 gi|269140870|ref|YP_003297571.1| F0F1-type ATP synthase, subunit b [Edwardsiella tarda EIB202]
 gi|238871308|gb|ACR71019.1| ATP synthase F0, B subunit, putative [Edwardsiella ictaluri 93-146]
 gi|267986531|gb|ACY86360.1| F0F1-type ATP synthase, subunit b [Edwardsiella tarda EIB202]
 gi|304560628|gb|ADM43292.1| ATP synthase B chain [Edwardsiella tarda FL6-60]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 72/150 (48%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPLMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKADAQVIIEQANKRKSQIIDEAKAEAEQERAKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|171742079|ref|ZP_02917886.1| hypothetical protein BIFDEN_01184 [Bifidobacterium dentium ATCC
           27678]
 gi|283456795|ref|YP_003361359.1| ATP synthase subunit B [Bifidobacterium dentium Bd1]
 gi|306822062|ref|ZP_07455446.1| ATP synthase F0 sector subunit B [Bifidobacterium dentium ATCC
           27679]
 gi|309802600|ref|ZP_07696704.1| ATP synthase F0, B subunit [Bifidobacterium dentium JCVIHMP022]
 gi|171277693|gb|EDT45354.1| hypothetical protein BIFDEN_01184 [Bifidobacterium dentium ATCC
           27678]
 gi|283103429|gb|ADB10535.1| ATP synthase B chain [Bifidobacterium dentium Bd1]
 gi|304554662|gb|EFM42565.1| ATP synthase F0 sector subunit B [Bifidobacterium dentium ATCC
           27679]
 gi|308220664|gb|EFO76972.1| ATP synthase F0, B subunit [Bifidobacterium dentium JCVIHMP022]
          Length = 173

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 66/153 (43%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  +I  I     ++F LP+  ++ + R   I     K + A+++ +   + YE  L+
Sbjct: 18  IFWSLVILIIVAVFFYKFFLPKFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     + AQ  I+  Q++A   +   VG 
Sbjct: 78  TARVEASKIRDDARAEASHIIADARSRAESDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  S   +D     ++DR    +D+
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDRMIADMDS 170


>gi|268593518|ref|ZP_06127739.1| ATP synthase F0, B subunit [Providencia rettgeri DSM 1131]
 gi|291310941|gb|EFE51394.1| ATP synthase F0, B subunit [Providencia rettgeri DSM 1131]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+ +E   +   + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTDATDRLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKQRVQMIDEAKAEAEAERAKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|220919572|ref|YP_002494876.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219957426|gb|ACL67810.1| ATP synthase F0, B subunit [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 179

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W AI F +   V  +F    +  ++  R   I    +     + E E ++++ +E
Sbjct: 21  PGLTLWTAITFLVMLAVLAKFAWGPIVKMLAERERSIREAIDSAKKERAEAERLLAAQKE 80

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           SLA A+  A E+  +     E   +       K+    ++ A+ +I +   KA  E+ + 
Sbjct: 81  SLAKAQREAAELARRNQQEVEVLRQELTAKARKEADDLVAEARRQIAEELVKAKAELKAQ 140

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           V ++  D   +L   ++ +   + +++     + A
Sbjct: 141 VVDLAIDAASRLVKANLDEKAQRALVEEYIAQLPA 175


>gi|170767001|ref|ZP_02901454.1| ATP synthase F0, B subunit [Escherichia albertii TW07627]
 gi|170124439|gb|EDS93370.1| ATP synthase F0, B subunit [Escherichia albertii TW07627]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|16762457|ref|NP_458074.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767153|ref|NP_462768.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143945|ref|NP_807287.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415737|ref|YP_152812.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62182351|ref|YP_218768.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161505606|ref|YP_001572718.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|161616989|ref|YP_001590954.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167994873|ref|ZP_02575963.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168263235|ref|ZP_02685208.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168464796|ref|ZP_02698688.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194444961|ref|YP_002043115.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450958|ref|YP_002047898.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472738|ref|ZP_03078722.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194737006|ref|YP_002116810.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197248823|ref|YP_002148804.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197261971|ref|ZP_03162045.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197364665|ref|YP_002144302.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245044|ref|YP_002217815.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200386880|ref|ZP_03213492.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204928728|ref|ZP_03219927.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207859092|ref|YP_002245743.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213028745|ref|ZP_03343192.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213052666|ref|ZP_03345544.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213427466|ref|ZP_03360216.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213649862|ref|ZP_03379915.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|224585664|ref|YP_002639463.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913122|ref|ZP_04656959.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289810104|ref|ZP_06540733.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|75505460|sp|Q57HX5|ATPF_SALCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81678058|sp|Q5PKW8|ATPF_SALPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81706850|sp|Q7CPE4|ATPF_SALTY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81766285|sp|Q8XGD7|ATPF_SALTI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694461|sp|B5EZ00|ATPF_SALA4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694463|sp|A9MJR5|ATPF_SALAR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694464|sp|B5FN37|ATPF_SALDC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694465|sp|B5QVD6|ATPF_SALEP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694467|sp|B4TAX6|ATPF_SALHS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694468|sp|B4SYD5|ATPF_SALNS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694469|sp|A9MXB0|ATPF_SALPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694470|sp|B5BIP0|ATPF_SALPK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694472|sp|B4TN35|ATPF_SALSV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|25290581|pir||AB0954 ATP synthase chain B [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16422443|gb|AAL22727.1| membrane-bound ATP synthase, F0 sector, subunit b [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16504762|emb|CAD03126.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139581|gb|AAO71147.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56129994|gb|AAV79500.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|62129984|gb|AAX67687.1| membrane-bound ATP synthase, F0 sector, subunit b [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|160866953|gb|ABX23576.1| hypothetical protein SARI_03782 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161366353|gb|ABX70121.1| hypothetical protein SPAB_04810 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194403624|gb|ACF63846.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409262|gb|ACF69481.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459102|gb|EDX47941.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194712508|gb|ACF91729.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195632223|gb|EDX50707.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197096142|emb|CAR61738.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197212526|gb|ACH49923.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240226|gb|EDY22846.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197939560|gb|ACH76893.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199603978|gb|EDZ02523.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204322161|gb|EDZ07359.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205327334|gb|EDZ14098.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205348062|gb|EDZ34693.1| ATP synthase F0, B subunit [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710895|emb|CAR35259.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|224470192|gb|ACN48022.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261249009|emb|CBG26867.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996156|gb|ACY91041.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160401|emb|CBW19927.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915000|dbj|BAJ38974.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088294|emb|CBY98055.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321222165|gb|EFX47238.1| ATP synthase B chain [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|322617218|gb|EFY14123.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322619094|gb|EFY15980.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625161|gb|EFY21989.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322630212|gb|EFY26983.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634363|gb|EFY31097.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635247|gb|EFY31962.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642876|gb|EFY39461.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645080|gb|EFY41610.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650429|gb|EFY46841.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653621|gb|EFY49948.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322661551|gb|EFY57774.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322661633|gb|EFY57852.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669795|gb|EFY65937.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671988|gb|EFY68107.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675001|gb|EFY71087.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322683691|gb|EFY79704.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686078|gb|EFY82063.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716844|gb|EFZ08415.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132231|gb|ADX19661.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323192005|gb|EFZ77242.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200499|gb|EFZ85577.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202728|gb|EFZ87765.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208305|gb|EFZ93246.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211740|gb|EFZ96573.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218602|gb|EGA03309.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220003|gb|EGA04473.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224774|gb|EGA09039.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323232518|gb|EGA16620.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235293|gb|EGA19378.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323241081|gb|EGA25118.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241370|gb|EGA25402.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323248600|gb|EGA32530.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252101|gb|EGA35961.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258595|gb|EGA42258.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262373|gb|EGA45931.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323268210|gb|EGA51686.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270624|gb|EGA54069.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625602|gb|EGE31947.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332990718|gb|AEF09701.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|326776584|ref|ZP_08235849.1| ATP synthase F0, B subunit [Streptomyces cf. griseus XylebKG-1]
 gi|326656917|gb|EGE41763.1| ATP synthase F0, B subunit [Streptomyces cf. griseus XylebKG-1]
          Length = 178

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I FGI ++V  + +LP ++  +E RR  I    EK +SA+ E +S++  Y+  LA AR 
Sbjct: 24  LICFGIVFFVFSKKLLPVINKTLEERREAIEGGIEKAESAQIEAQSVLEQYKAQLAEARH 83

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        ++  +   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 84  EAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKLATD 143

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A     +DR  D ++A
Sbjct: 144 LAGKLVGESLQDHARQSGTVDRFLDELEA 172


>gi|254427405|ref|ZP_05041112.1| ATP synthase F0, B subunit [Alcanivorax sp. DG881]
 gi|196193574|gb|EDX88533.1| ATP synthase F0, B subunit [Alcanivorax sp. DG881]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 71/156 (45%), Gaps = 5/156 (3%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +T + Q  W    F +F +   +F+ P +S  ++ R+  I+      D A+R++E     
Sbjct: 5   ATLIGQAIW----FALFVFFCMKFVWPPISRALDERKQKIAEGLSAADRAERDLELAQEK 60

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
              +L  ++  A EIID+    A Q +E  ++    +    ++ AQ+EID    +A +++
Sbjct: 61  ATANLKESKEKAAEIIDQANRRANQIVEEAKDAARTEGERLIAKAQSEIDQEVNQAREQL 120

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
              V  +      K LG  V+     ++L++    +
Sbjct: 121 RKEVAVLALSGAEKVLGNEVNQDAHTQLLEQLAAEL 156


>gi|290969219|ref|ZP_06560744.1| ATP synthase F0, B subunit [Megasphaera genomosp. type_1 str. 28L]
 gi|290780725|gb|EFD93328.1| ATP synthase F0, B subunit [Megasphaera genomosp. type_1 str. 28L]
          Length = 164

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 75/153 (49%), Gaps = 1/153 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F +   +  +F    L  +ME RR  I++D ++   AK E   + + YE  L 
Sbjct: 8   LILQFVNFIVLVLILAKFAYKPLLKVMEERRQRIAADLDEAAKAKTEAAQLKADYEAQLR 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A+EI+DK V AA++  + Q +   + +  +   AQ EI + ++ A +++   V  
Sbjct: 68  DARARAQEIVDKAVKAADREAQVQLDAVREQIAREKEIAQAEITNEREAALKQMRQEVVT 127

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
           ++  +  KL   +++DA  +K++    D +   
Sbjct: 128 LSMAVAEKLLHKNMNDAQNEKLVADYLDQLPHH 160


>gi|261213279|ref|ZP_05927561.1| ATP synthase B chain [Vibrio sp. RC341]
 gi|260837553|gb|EEX64256.1| ATP synthase B chain [Vibrio sp. RC341]
          Length = 154

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 65/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ FG+F W   +++ P +   +E R+  I+   +  + AK++++   ++  + L  A+ 
Sbjct: 9   ALAFGMFVWFCMKYVWPPIIKAIEDRQKKIADGLQAAERAKKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  RE  + +    L+ A+ EI+  + +A  E+   V  +   
Sbjct: 69  TATELIEQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 129 GAEKIIERSIDKDAHKDILDNI 150


>gi|253681112|ref|ZP_04861915.1| ATP synthase F0, B subunit [Clostridium botulinum D str. 1873]
 gi|253562961|gb|EES92407.1| ATP synthase F0, B subunit [Clostridium botulinum D str. 1873]
          Length = 159

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/157 (19%), Positives = 68/157 (43%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
              +S F W  I F +   +   F+   ++ +++ R + I +D  +  + K + + +  +
Sbjct: 2   EFTISTFVWTIINFVVLLGILSYFLFKPVNLVIDRRNSEIENDINQAKTDKEKAKELRIA 61

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            E+    A+   K I++     AE   +       K+    +  A+ EI   ++KA  EV
Sbjct: 62  NEKEYKAAKKEGKTIVENYKVKAENVSQEIISDAHKEAELIIQRAKKEIQREREKAEDEV 121

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
            +   E+  +L +K L  S+ +   ++++D     + 
Sbjct: 122 KNKTIELALELSKKALERSIDEKVHRELIDNFISKVG 158


>gi|327482895|gb|AEA86205.1| ATP synthase B chain [Pseudomonas stutzeri DSM 4166]
          Length = 152

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   + F IF W   + + P +++ M  R+  I+   +    A+++++        +L 
Sbjct: 3   LFGQTLAFAIFVWFCMKLVWPPITAAMAARQKKIAEGLDAAGRAQQDLKLAQDKVSHTLR 62

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +  A +II++    A   +E  ++    +    ++ A+ EI+    +A  ++ S V  
Sbjct: 63  ETKEQAAQIIEQANKHANAIIEEAKQQARVEGERLVAGARAEIEQEVNRARDQLRSQVAA 122

Query: 145 VTKDLVRKLGFS-VSDADVQKILDRKRDGI 173
           +      K+  S V      +++++    +
Sbjct: 123 LAVAGAEKILESQVDAKVHNELVEKLASQL 152


>gi|237809871|ref|YP_002894311.1| ATP synthase F0, B subunit [Tolumonas auensis DSM 9187]
 gi|237502132|gb|ACQ94725.1| ATP synthase F0, B subunit [Tolumonas auensis DSM 9187]
          Length = 156

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F IF W   +F+ P L + +E R+  I+      D AK++++   +   E + 
Sbjct: 7   ILGQTIAFIIFVWFCMKFVWPPLMAAIEKRQKEIADGMASADRAKKDLDLAQNKAMEQIK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII++      Q ++   +    +    L+ A+ EI+  + +A +E+   V  
Sbjct: 67  EAKQQAAEIIEQANKRRAQVIDEANQDAMAEREKILNQARAEIEAERNRAKEELRKHVAA 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    +  A    I+D+    +
Sbjct: 127 LAVAGAEKILERQLDSAANSAIVDKLVAEL 156


>gi|29346126|ref|NP_809629.1| ATP synthase subunit B [Bacteroides thetaiotaomicron VPI-5482]
 gi|253568450|ref|ZP_04845861.1| ATP synthase B subunit [Bacteroides sp. 1_1_6]
 gi|298385491|ref|ZP_06995049.1| ATP synthase F0, B subunit [Bacteroides sp. 1_1_14]
 gi|81740940|sp|Q8A9U9|ATPF_BACTN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|29338020|gb|AAO75823.1| ATP synthase B subunit [Bacteroides thetaiotaomicron VPI-5482]
 gi|251842523|gb|EES70603.1| ATP synthase B subunit [Bacteroides sp. 1_1_6]
 gi|298261632|gb|EFI04498.1| ATP synthase F0, B subunit [Bacteroides sp. 1_1_14]
          Length = 167

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/153 (16%), Positives = 62/153 (40%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FG+ + +  ++  P +  ++E R+  I    E    A  ++  +    E  
Sbjct: 9   GLLFWMFVAFGVVFVILAKYGFPIIIKMVEGRKTYIDQSLEVAREANAQLAHLKEEGEAL 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   ++ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRILKEAMEERDKIVHEARKQAEIAAQKELDAVKQQIQIEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
             ++ D+  K+             ++DR  D +
Sbjct: 129 AVLSVDIAEKVLRKNLQDKESQMGMIDRMLDEV 161


>gi|323496910|ref|ZP_08101938.1| F0F1 ATP synthase subunit B [Vibrio sinaloensis DSM 21326]
 gi|323317984|gb|EGA70967.1| F0F1 ATP synthase subunit B [Vibrio sinaloensis DSM 21326]
          Length = 154

 Score = 79.8 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 64/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+   +  + A ++++   ++  + L  A+ 
Sbjct: 9   AISFALFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q L+  RE  + +    L+ A+ E++  + +A  E+   V  +   
Sbjct: 69  TATEIIEQANKRKAQILDEAREEAQAERQKILTQAEAELEAERNRARDELRKQVATLAVA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D QK +    
Sbjct: 129 GAEKILERSIDKDAQKDILDNI 150


>gi|323493005|ref|ZP_08098141.1| F0F1 ATP synthase subunit B [Vibrio brasiliensis LMG 20546]
 gi|323312741|gb|EGA65869.1| F0F1 ATP synthase subunit B [Vibrio brasiliensis LMG 20546]
          Length = 154

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 64/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P L   +E R+  I+   +  + A ++++   ++  + L  A+ 
Sbjct: 9   AISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q L+  RE  + +    L+ A+ E++  + +A  E+   V  +   
Sbjct: 69  TATEIIEQANKRKAQILDEAREEAQTERQKILTQAEAELEAERNRARDELRKQVATLAVA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D QK +    
Sbjct: 129 GAEKILERSIDKDAQKDILDNI 150


>gi|119026449|ref|YP_910294.1| F0F1 ATP synthase subunit B [Bifidobacterium adolescentis ATCC
           15703]
 gi|226741309|sp|A1A3C9|ATPF_BIFAA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|118766033|dbj|BAF40212.1| protein with similarity to ATP synthase B chain [Bifidobacterium
           adolescentis ATCC 15703]
          Length = 173

 Score = 79.8 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  +I  I     ++F LP+  ++ + R   I     K + A+++ +   + Y+  L+
Sbjct: 18  IFWSLVILIIVAVFFYKFFLPKFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     + AQ  I+  Q++A   +   VG 
Sbjct: 78  NARVEASKIRDDARAEASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 145 VTKDLVRKLGFSVSDAD--VQKILDRKRDGIDA 175
           +   L  K+  S  ++D     ++D+    +D+
Sbjct: 138 LATALAGKILGSKLESDDVQSTMIDQMIAELDS 170


>gi|313894469|ref|ZP_07828034.1| ATP synthase F0, B subunit [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313441293|gb|EFR59720.1| ATP synthase F0, B subunit [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 165

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L ++M  R+  I+ D E  + A+ E E   + Y  
Sbjct: 6   LGTILAQMLNFFILVWLLARFAYKPLLAMMTERKERIAKDLEAAEKARVEAEGFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +A AR  A++I++K V  AE     Q     + +  + + A+ +I   + +A   + + 
Sbjct: 66  QIAKARQEAQQIVEKAVQEAEHTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNE 125

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K +   ++     K+++     +D+
Sbjct: 126 VVSLSVAMAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|239982323|ref|ZP_04704847.1| F0F1 ATP synthase subunit B [Streptomyces albus J1074]
 gi|291454168|ref|ZP_06593558.1| F0F1 ATP synthase subunit B [Streptomyces albus J1074]
 gi|291357117|gb|EFE84019.1| F0F1 ATP synthase subunit B [Streptomyces albus J1074]
          Length = 181

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 71/148 (47%), Gaps = 2/148 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I ++V  + +LP ++ +++ R + I    E+ ++A+ E +S++  Y+  LA AR 
Sbjct: 24  LLCFAIIFFVFAKKLLPSINKVLDERHDKIVGGIEEAEAAQVEAQSVLEQYKAQLAEARH 83

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+Q +   VG++  +
Sbjct: 84  EAARLRSEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIEADRKAAAQSLRQDVGQLATE 143

Query: 149 LVRKLGFSVSD--ADVQKILDRKRDGID 174
           L  K+     +  A   + +DR  DG+D
Sbjct: 144 LAGKIVGESLEEHARQSRTIDRFLDGLD 171


>gi|315103534|gb|EFT75510.1| ATP synthase F0, B subunit [Propionibacterium acnes HL050PA2]
          Length = 184

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/161 (20%), Positives = 65/161 (40%), Gaps = 3/161 (1%)

Query: 15  PFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVES 74
           P        +     I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++
Sbjct: 10  PLAPEH-PVEIIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAEKAQAEAKA 68

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
            +  Y+  LA AR  A +I D   +   Q +   R   +++       A  +I   + +A
Sbjct: 69  ALEKYQAQLASARDEAAQIRDDAKSQGAQIIAQMRANAQEEADRITERANAQIQAERDQA 128

Query: 135 SQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
            +EV + +G +   L  ++       D  VQ  +DR    +
Sbjct: 129 VREVRAEIGGLATTLASRIVGESLQDDQRVQATVDRFLSSL 169


>gi|326407255|gb|ADZ64326.1| F-type H+-transporting ATPase subunit b [Lactococcus lactis subsp.
           lactis CV56]
          Length = 168

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 64/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            +T L     ++  F I   +   F    ++S+   R   IS D +  ++  ++   ++ 
Sbjct: 10  PNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVK 69

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             +  LA ++  A  II      A QN         ++       AQ +I+  +K+A   
Sbjct: 70  QRQAELARSKEEAANIIQVANDTASQNRAKVLATANEEATSLKKRAQEDIEQERKEALNT 129

Query: 138 VYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V   V +++  +  K +G S+  +  Q+++D     +  
Sbjct: 130 VKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|295130803|ref|YP_003581466.1| ATP synthase F0, B subunit [Propionibacterium acnes SK137]
 gi|291376597|gb|ADE00452.1| ATP synthase F0, B subunit [Propionibacterium acnes SK137]
 gi|313772053|gb|EFS38019.1| ATP synthase F0, B subunit [Propionibacterium acnes HL074PA1]
 gi|313810253|gb|EFS47974.1| ATP synthase F0, B subunit [Propionibacterium acnes HL083PA1]
 gi|313830583|gb|EFS68297.1| ATP synthase F0, B subunit [Propionibacterium acnes HL007PA1]
 gi|313833619|gb|EFS71333.1| ATP synthase F0, B subunit [Propionibacterium acnes HL056PA1]
 gi|314973584|gb|EFT17680.1| ATP synthase F0, B subunit [Propionibacterium acnes HL053PA1]
 gi|314975806|gb|EFT19901.1| ATP synthase F0, B subunit [Propionibacterium acnes HL045PA1]
 gi|314983715|gb|EFT27807.1| ATP synthase F0, B subunit [Propionibacterium acnes HL005PA1]
 gi|315095858|gb|EFT67834.1| ATP synthase F0, B subunit [Propionibacterium acnes HL038PA1]
 gi|327326409|gb|EGE68199.1| ATP synthase F0, B subunit [Propionibacterium acnes HL096PA2]
 gi|327445695|gb|EGE92349.1| ATP synthase F0, B subunit [Propionibacterium acnes HL043PA2]
 gi|327448321|gb|EGE94975.1| ATP synthase F0, B subunit [Propionibacterium acnes HL043PA1]
 gi|328760900|gb|EGF74465.1| ATP synthase F0, B subunit [Propionibacterium acnes HL099PA1]
          Length = 184

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 62/151 (41%), Gaps = 2/151 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I+  +  W+  + ++PR   + E R   I    E+ + A+ E ++ +  Y+  LA
Sbjct: 19  IIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAERAQAEAKAALEKYQAQLA 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   +   Q +   R   +++       A  +I   + +A +EV + +G 
Sbjct: 79  SARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQIQAERDQAVREVRAEIGG 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGI 173
           +   L  ++       D  VQ  +D     +
Sbjct: 139 LATTLASRIVGESLQDDQRVQATVDCFLSSL 169


>gi|311064985|ref|YP_003971711.1| ATP synthasesubunit B [Bifidobacterium bifidum PRL2010]
 gi|310867305|gb|ADP36674.1| AtpF ATP synthase B chain [Bifidobacterium bifidum PRL2010]
          Length = 175

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     H+F +P+ ++I + R   I  +  K + +K++ ++  S YE  L+
Sbjct: 19  IVWSLIILVIVALFFHKFFMPKFNAIFDERAAKIEGNIAKAEQSKKDADAAKSKYEAQLS 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     +NAQ  I+  Q++A   +   VG 
Sbjct: 79  TARVEASKIRDDARAEASHIIADARSRAESDAAQITANAQRSIESQQQQALVSLKGEVGT 138

Query: 145 VTKDLVRKLGFSVSDAD--VQKILDRKRDGID 174
           +   L  K+  +  ++D     ++D+  D +D
Sbjct: 139 LATALAGKILGAKLESDDVQSSMIDKMIDDLD 170


>gi|315221772|ref|ZP_07863686.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
 gi|315189158|gb|EFU22859.1| ATP synthase F0, B subunit [Streptococcus anginosus F0211]
          Length = 164

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++S  E R   IS D +  +SA+++ E +    E 
Sbjct: 9   IGDFILVAGSFLLLIVLIKKFAWDNITSTFEQRAKKISDDIDGAESARQKAEDLAQKRET 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  A  II+     AE+N          +       A  EI   + +A   +   
Sbjct: 69  ELAGSRQEATTIIENAKETAEKNKAGILADAADEAGRLKEKANQEIAQTKAEAMNSIKGD 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           V ++T +L  K+ G  +     ++++DR  D + 
Sbjct: 129 VADLTVNLASKILGQKLDQEAHKELIDRYIDKLG 162


>gi|261823734|ref|YP_003261840.1| F0F1 ATP synthase subunit B [Pectobacterium wasabiae WPP163]
 gi|261607747|gb|ACX90233.1| ATP synthase F0, B subunit [Pectobacterium wasabiae WPP163]
          Length = 156

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +F+ P + + +E R+  I+      + AK+++    ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKFVWPPMMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E +    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKADAQVIIEQANKRRAQILDEAKVEAEAERNKIVAQAQAEIEAERKRAREELRKQVAV 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|317502823|ref|ZP_07960926.1| ATP synthase F0 sector subunit B [Prevotella salivae DSM 15606]
 gi|315666063|gb|EFV05627.1| ATP synthase F0 sector subunit B [Prevotella salivae DSM 15606]
          Length = 172

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 65/156 (41%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L    W+   F + ++   RF  P +  +++ R+  I     K   A   + ++    E 
Sbjct: 12  LGLLIWMLAAFLVVFFFLARFGFPVIIKMVDERKRYIDDSLSKAHEAAERLLNIKQEGEA 71

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +  AR    +I+       +  +E  +E    +    +S A+ +I+  ++ A +++ S 
Sbjct: 72  LIQEAREQQAKIMKDAATTRDAIIEQAQEKARDEGARIISEAKKQIEVEKQSAIRDIRSQ 131

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           V E++  +  K+      +D    +++DR  D +  
Sbjct: 132 VAELSIQVAEKILREKLSTDKSQMEMIDRLLDNVSK 167


>gi|212637837|ref|YP_002314362.1| F0F1 ATP synthase subunit B [Shewanella piezotolerans WP3]
 gi|212559321|gb|ACJ31775.1| ATP synthase F0, subunit B [Shewanella piezotolerans WP3]
          Length = 156

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F IF W   +F+ P L + +E R+  I+      D A +++E   +   + L  A+A
Sbjct: 11  TVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII+       Q ++  +   + +    ++  Q EI+  + +  +++   V  +   
Sbjct: 71  TANEIIESANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDLRKQVAVLAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+ +A    I+++    +
Sbjct: 131 GAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|157150236|ref|YP_001450825.1| F0F1 ATP synthase subunit B [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283124|ref|ZP_06060891.1| predicted protein [Streptococcus sp. 2_1_36FAA]
 gi|226695878|sp|A8AYG5|ATPF_STRGC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157075030|gb|ABV09713.1| ATP synthase F0, B subunit [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262261376|gb|EEY80075.1| predicted protein [Streptococcus sp. 2_1_36FAA]
          Length = 164

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 69/154 (44%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++SI E R   IS D +  +SA++  E +    EE
Sbjct: 9   IGNFILVAGSFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARKNAEVLEQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         +++      A  EI   + +A + +   
Sbjct: 69  ALAGSREEAATIVETAKETAEKNKASILADTTEEVSRLKQKANQEIAQSKAEALRSIKGD 128

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
           V +++ DL  K +G ++      +++D   D + 
Sbjct: 129 VADLSIDLASKIIGQTLDKEAQSQLIDSYIDKLG 162


>gi|21223729|ref|NP_629508.1| F0F1 ATP synthase subunit B [Streptomyces coelicolor A3(2)]
 gi|256785178|ref|ZP_05523609.1| F0F1 ATP synthase subunit B [Streptomyces lividans TK24]
 gi|81785262|sp|Q9K4D7|ATPF_STRCO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|8568791|emb|CAB94540.1| ATP synthase B chain [Streptomyces coelicolor A3(2)]
          Length = 184

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 2/148 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 27  LIAFVIVFGFLAKKLLPNINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I   +K A+  +   VG++  +
Sbjct: 87  EAARLRQEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIQADRKAAASALRQDVGKLATE 146

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGID 174
           L  KL        A   +++DR  D +D
Sbjct: 147 LAGKLVGESLEDHARQSRVIDRFLDELD 174


>gi|154488036|ref|ZP_02029153.1| hypothetical protein BIFADO_01605 [Bifidobacterium adolescentis
           L2-32]
 gi|154083509|gb|EDN82554.1| hypothetical protein BIFADO_01605 [Bifidobacterium adolescentis
           L2-32]
          Length = 173

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  +I  I     ++F LP+  ++ + R   I     K + A+++ +   + Y+  L+
Sbjct: 18  IFWSLVILIIVAVFFYKFFLPKFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYDAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     + AQ  I+  Q++A   +   VG 
Sbjct: 78  SARVEASKIRDDARAEASHIIADARTRAEADAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 145 VTKDLVRKLGFSVSDAD--VQKILDRKRDGIDA 175
           +   L  K+  S  ++D     ++D+    +D+
Sbjct: 138 LATALAGKILGSKLESDDVQSTMIDQMIAELDS 170


>gi|224283627|ref|ZP_03646949.1| F0F1 ATP synthase subunit B [Bifidobacterium bifidum NCIMB 41171]
 gi|310288112|ref|YP_003939371.1| ATP synthase B chain [Bifidobacterium bifidum S17]
 gi|313140778|ref|ZP_07802971.1| F0F1 ATP synthase subunit B [Bifidobacterium bifidum NCIMB 41171]
 gi|309252049|gb|ADO53797.1| ATP synthase B chain [Bifidobacterium bifidum S17]
 gi|313133288|gb|EFR50905.1| F0F1 ATP synthase subunit B [Bifidobacterium bifidum NCIMB 41171]
          Length = 176

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     H+F +P+ ++I + R   I  +  K + +K++ ++  S YE  L+
Sbjct: 20  IVWSLIILVIVALFFHKFFMPKFNAIFDERAAKIEGNIAKAEQSKKDADAAKSKYEAQLS 79

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     +NAQ  I+  Q++A   +   VG 
Sbjct: 80  TARVEASKIRDDARAEASHIIADARSRAESDAAQITANAQRSIESQQQQALVSLKGEVGT 139

Query: 145 VTKDLVRKLGFSVSDAD--VQKILDRKRDGID 174
           +   L  K+  +  ++D     ++D+  D +D
Sbjct: 140 LATALAGKILGAKLESDDVQSSMIDKMIDDLD 171


>gi|308177043|ref|YP_003916449.1| H(+)-transporting two-sector ATPase subunit B [Arthrobacter
           arilaitensis Re117]
 gi|307744506|emb|CBT75478.1| H(+)-transporting two-sector ATPase, chain B [Arthrobacter
           arilaitensis Re117]
          Length = 184

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/170 (18%), Positives = 68/170 (40%), Gaps = 4/170 (2%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             S    P   + +  +     + F +  ++  + I P+     E R   I    EK ++
Sbjct: 9   AASESVNPLLPNPW--EILVTGVGFAVLLFIVIKVIAPKFEQSYEDRVTAIEGGLEKAEA 66

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
           A++E E  ++ Y+  L  AR  A  I ++  +   Q L   +     +       +  +I
Sbjct: 67  AQKEAEETLAQYKAQLLEARTEANRIREEARSEGAQILADLKTKATDEAARITEQSHRQI 126

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +  +  A   + + VG +  +L  K+       DA  Q+++D+    ++A
Sbjct: 127 EAERVSALASLRTDVGALATELASKVVDEALQDDARAQRVVDKFLTDLEA 176


>gi|220913087|ref|YP_002488396.1| ATP synthase F0 subunit beta [Arthrobacter chlorophenolicus A6]
 gi|219859965|gb|ACL40307.1| ATP synthase F0, B subunit [Arthrobacter chlorophenolicus A6]
          Length = 184

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 60/149 (40%), Gaps = 2/149 (1%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
           + + F I  ++  +F++P        R   I     K + A+ E  + +  Y++ L  AR
Sbjct: 28  VLVGFAILMFIVVKFVVPMFEKTFAERAEAIEGGIAKAEKAQAEASAALEEYKQQLTDAR 87

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
             A  I ++  A   Q L   +E    +     + A  +I+  ++ A   + S VG +  
Sbjct: 88  TEANRIREEARAEGAQILADLKEKAAAESARITAQAHAQIESERQAAVVSLRSEVGTLAT 147

Query: 148 DLVRKLGFSV--SDADVQKILDRKRDGID 174
            L  ++       D    +++DR    ++
Sbjct: 148 TLAGRIVGESLNDDDRSARVVDRFLADLE 176


>gi|254382324|ref|ZP_04997684.1| ATP synthase B chain [Streptomyces sp. Mg1]
 gi|194341229|gb|EDX22195.1| ATP synthase B chain [Streptomyces sp. Mg1]
          Length = 179

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 25  LIAFVIVFGFLAKKLLPNINKVLEERREQIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 84

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  + +       E  R   ++     ++    +I+  +K ASQ +   VG++  D
Sbjct: 85  EAARLRQEALEQGTALKEELRAEGQRQREEIIAAGHAQIEADRKAASQALRQDVGKLATD 144

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   + +DR    ++ 
Sbjct: 145 LAGKLVGESLEDAARQSRTIDRFLSELEE 173


>gi|109900597|ref|YP_663852.1| F0F1 ATP synthase subunit B [Pseudoalteromonas atlantica T6c]
 gi|123360113|sp|Q15MU0|ATPF2_PSEA6 RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|109702878|gb|ABG42798.1| ATP synthase F0 subcomplex B subunit [Pseudoalteromonas atlantica
           T6c]
          Length = 156

 Score = 79.4 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 23/150 (15%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   + F  F W   +F+ P +   +E R+  I+      +  ++++E   +   E L 
Sbjct: 7   LFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAKATEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  II++      Q ++ + +   ++  + ++    EI+  + +A +++   V  
Sbjct: 67  EAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDLRKQVAA 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      ++    +  A    I+++    +
Sbjct: 127 LAVAGAERILERQIDAAAQSDIVEKLVAEL 156


>gi|291298836|ref|YP_003510114.1| ATP synthase F0 subunit B [Stackebrandtia nassauensis DSM 44728]
 gi|290568056|gb|ADD41021.1| ATP synthase F0, B subunit [Stackebrandtia nassauensis DSM 44728]
          Length = 181

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 61/149 (40%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I  +V  +F+ P++      R + I    ++ +  + +   ++  Y++ LA AR 
Sbjct: 27  TVAFAILCFVLMKFVFPKMEQTFRARVDAIEGGIKRAEETQAKANELLEQYKQQLAEART 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  I D+  A A    E        +    ++  +  +   +++   E+   VGE+  +
Sbjct: 87  EAASIRDEARAEAIAAKEEIVTEARTEAERIINAGKESLAASRQQLLTELRGEVGEIAVE 146

Query: 149 LVRKLGFS--VSDADVQKILDRKRDGIDA 175
           L  ++       +A     ++R    +DA
Sbjct: 147 LAGRIVGESLADEARRSGTVERFLSELDA 175


>gi|163840189|ref|YP_001624594.1| ATP synthase B chain [Renibacterium salmoninarum ATCC 33209]
 gi|226694450|sp|A9WNC4|ATPF_RENSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|162953665|gb|ABY23180.1| ATP synthase B chain [Renibacterium salmoninarum ATCC 33209]
          Length = 185

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/175 (20%), Positives = 68/175 (38%), Gaps = 4/175 (2%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           +   +       P   + + +    + I F I  ++  +F++P        R   I    
Sbjct: 4   AEIFAASGEGVNPIVPNIWDTAL--VLIGFAILLFIVIKFVVPMFEKTFAERTEAIEGGI 61

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
            K + A+ E  + +  Y++ LA ARA A +I +   A   Q L   +E    +       
Sbjct: 62  AKAEEAQAEATAALEEYKQQLAEARAEANKIREDARAEGAQILADLKEKAASESARITEQ 121

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           AQ  I   ++ A   + S VG +   L  ++       DA   +++DR    ++A
Sbjct: 122 AQVAIAAERQAAVVSLRSEVGSLATTLAGRIVGESLQDDARSNRVVDRFLADLEA 176


>gi|67458420|ref|YP_246044.1| F0F1 ATP synthase subunit B' [Rickettsia felis URRWXCal2]
 gi|67003953|gb|AAY60879.1| ATP synthase B chain [Rickettsia felis URRWXCal2]
          Length = 169

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 71/149 (47%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + FG+ Y   ++FI P+   I   R+  I  +  + D+  +EV
Sbjct: 1   MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTQEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   + E +         +  + + + E     +++  E+DL + +++   +I+   K
Sbjct: 61  EKLNKYHNEEIDKTNTEIDRLKKEKIYSLESEFLIKKKNLEQDLKNSINHNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDAD 161
           +        + ++  +++ K+  + +D D
Sbjct: 121 QFRTNKSEAIIKLAVNIIEKIAGAKADMD 149


>gi|205354548|ref|YP_002228349.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|226694466|sp|B5RFV9|ATPF_SALG2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|205274329|emb|CAR39353.1| ATP synthase subunit B [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|326629683|gb|EGE36026.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A  + II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEVQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|113972256|ref|YP_736049.1| F0F1 ATP synthase subunit B [Shewanella sp. MR-4]
 gi|114049505|ref|YP_740055.1| F0F1 ATP synthase subunit B [Shewanella sp. MR-7]
 gi|123030130|sp|Q0HPF7|ATPF_SHESR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123129970|sp|Q0HD75|ATPF_SHESM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|113886940|gb|ABI40992.1| ATP synthase F0, B subunit [Shewanella sp. MR-4]
 gi|113890947|gb|ABI44998.1| ATP synthase F0, B subunit [Shewanella sp. MR-7]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +      + F IF W   +F+ P L + +E R+  I+      D A +++E   +   
Sbjct: 3   FNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+  A EII++      Q +E  +   + +    ++  + EI+  + +  +++  
Sbjct: 63  DQLKEAKVTANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRK 122

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
            V  +      K+   S+  A    I+++    I
Sbjct: 123 QVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|227529633|ref|ZP_03959682.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus vaginalis
           ATCC 49540]
 gi|227350423|gb|EEJ40714.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus vaginalis
           ATCC 49540]
          Length = 172

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 63/156 (40%), Gaps = 1/156 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           S ++    +  + F I   +   F    ++ +M+ R + I+SD +    ++   E M + 
Sbjct: 12  SLYVGDLVFYIVTFIILMLLIKHFAWKPVTDMMKKRADKIASDIDNAAKSRENAEKMAAK 71

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  +   A +I++    + E       E  + D       AQ +    ++ A    
Sbjct: 72  RQAELQNSHQEAADIVNNAKKSGEAQRTQIVEAAQNDAQALKQRAQEDAKQARRDALNGA 131

Query: 139 YSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
              V  ++ ++  KL    ++  D ++++D   +G+
Sbjct: 132 KDDVANLSIEIASKLIHKELNADDQKELIDSYIEGL 167


>gi|117922565|ref|YP_871757.1| F0F1 ATP synthase subunit B [Shewanella sp. ANA-3]
 gi|226694916|sp|A0L2T2|ATPF_SHESA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117614897|gb|ABK50351.1| ATP synthase F0, B subunit [Shewanella sp. ANA-3]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +      + F IF W   +F+ P L + +E R+  I+      D A +++E   +   
Sbjct: 3   FNATLIGQTVAFIIFVWFCMKFVWPPLMNAIEARQKRIADGLADADRAVKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+A A EII++      Q +E  +   + +    ++  + EI+  + +  +++  
Sbjct: 63  DQLKEAKATANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRK 122

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
            V  +      K+   S+  A    I+++    I
Sbjct: 123 QVATLAIMGAEKILERSIDPAAHSDIVNKLVAEI 156


>gi|310644381|ref|YP_003949140.1| ATP synthase subunit b [Paenibacillus polymyxa SC2]
 gi|309249332|gb|ADO58899.1| ATP synthase subunit b [Paenibacillus polymyxa SC2]
          Length = 162

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 63/153 (41%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  I F I YW+  R+    L S+ME RR L+     +    + +  + +   +++L 
Sbjct: 8   IVFTIIAFLILYWLLTRYAFGPLFSVMEKRRQLVLQQMNEAAQTREQAVAYVEEQKQALQ 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +II++      +  E      + + +     A  EI   + KA  E+ S VG+
Sbjct: 68  QARKEAYDIIEQSKQTGNKQAEQIIIQAKDEAVRLKDEAVREITSERNKAVAELRSEVGK 127

Query: 145 VTKDLVRKLGFSVSDAD--VQKILDRKRDGIDA 175
            +  +  KL       D    +++D+    +  
Sbjct: 128 ASVQIASKLIQKEIKEDQVQGELVDQYLKEVGG 160


>gi|90409085|ref|ZP_01217209.1| ATP synthase subunit B [Psychromonas sp. CNPT3]
 gi|90309812|gb|EAS37973.1| ATP synthase subunit B [Psychromonas sp. CNPT3]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +F+ P L   +E R+ LI+    + + A ++++   +   + L  A+ 
Sbjct: 11  AIAFIMFVWFCMKFVWPPLLDAIEARQKLIADGLTQAERAGKDLQLAQAKATDKLKEAKV 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EIID+      Q ++  +   E +    ++    E++  + +A +E+   V  +   
Sbjct: 71  QAAEIIDQANKRRAQIVDEAKTEGETERQKIITQGTAEVESERNRAREELRQQVTILAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+       I+D+    +
Sbjct: 131 GAEKIIKHSIDKNANSDIIDKLVTEL 156


>gi|15963433|dbj|BAB69467.1| H+-ATPase b subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 63/159 (39%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            +T L     ++  F I   +   F    ++S+   R   IS D +  ++  ++   ++ 
Sbjct: 10  PNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVK 69

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             +  LA ++  A  II      A QN         +        AQ +I+  +K+A   
Sbjct: 70  QRQAELAGSKEEAANIIQVANDTASQNRAKVLATANRRDTSLKKRAQEDIEQERKEALNT 129

Query: 138 VYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V   V +++  +  K +G S+  +  Q+++D     +  
Sbjct: 130 VKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|157825173|ref|YP_001492893.1| F0F1 ATP synthase subunit B' [Rickettsia akari str. Hartford]
 gi|157799131|gb|ABV74385.1| F0F1 ATP synthase subunit B' [Rickettsia akari str. Hartford]
          Length = 157

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 68/155 (43%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL   FG+ Y   ++FI P+   I   R+  I  +  + D   +EV
Sbjct: 1   MPQFDVATYYSQIFWLIATFGLLYIFVYKFITPKAEEIFNNRQTNIQCNITQADMLTQEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y   +         +  + + + E      R+  E+DL + ++     I+   +
Sbjct: 61  EKLNKYYNVEIDKTNTEIDRLKKEKIDSLESEFLITRKNLEQDLKNSINQNIEGINLAAQ 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILD 167
           +        + ++  +++ K+  + +D ++ + + 
Sbjct: 121 QFRTNKSEAIIKLAVNIIEKITGTKADMNLLQSIK 155


>gi|309812144|ref|ZP_07705902.1| ATP synthase F0, B subunit [Dermacoccus sp. Ellin185]
 gi|308433831|gb|EFP57705.1| ATP synthase F0, B subunit [Dermacoccus sp. Ellin185]
          Length = 201

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I YW+    ++P +  +   R   I     K + A++E  +    YE  LA ARA
Sbjct: 27  LIAFAILYWLYKTKVVPNMERMYAERTASIEGGIAKAEEAQKEAAAAKQQYESQLADARA 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +I +   A     +   RE    +      NA  +I   +++A  ++ S VG ++ +
Sbjct: 87  EAAKIREDARAQGAAIIAESREQAGAEAARITENATKQIAAERQQAFVQLRSEVGGLSTE 146

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  ++       +A  + I+DR    ++A
Sbjct: 147 LASRIVGESLHDEARQKGIVDRFLAELEA 175


>gi|297202399|ref|ZP_06919796.1| ATP synthase F0, B subunit [Streptomyces sviceus ATCC 29083]
 gi|197710080|gb|EDY54114.1| ATP synthase F0, B subunit [Streptomyces sviceus ATCC 29083]
          Length = 181

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 33/149 (22%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ +++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 27  LIAFVIVFGFLAKKLLPNINKVLDERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 87  EAARLRQEAQEQGATLIAEMRAEGQRQREEIVAAGHAQIEADRKAAASALRQDVGKLATD 146

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   +++DR  D ++ 
Sbjct: 147 LAGKLVGESLEDHARQSRVIDRFLDDLEE 175


>gi|319939419|ref|ZP_08013779.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
 gi|319811405|gb|EFW07700.1| ATP synthase subunit B [Streptococcus anginosus 1_2_62CV]
          Length = 164

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++S  E R   IS D +  +SA+++ E +    E 
Sbjct: 9   IGDFILVAGSFLLLIVLIKKFAWDNITSTFEQRAKKISDDIDSAESARQKAEDLAQKRET 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  A  II+     AE+N          +       A  EI   + +A   +   
Sbjct: 69  ELAGSRQEATTIIENAKETAEKNKAGILADAADEAGRLKEKANQEIAQTKAEAMNSIKGD 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           V ++T +L  K+ G  +     ++++DR  D + 
Sbjct: 129 VADLTVNLASKILGQKLDQEAHKELIDRYIDKLG 162


>gi|222035449|emb|CAP78194.1| ATP synthase B chain [Escherichia coli LF82]
 gi|312948302|gb|ADR29129.1| F0F1 ATP synthase subunit B [Escherichia coli O83:H1 str. NRG 857C]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIDAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|148284442|ref|YP_001248532.1| ATP synthase subunit B [Orientia tsutsugamushi str. Boryong]
 gi|146739881|emb|CAM79839.1| ATP synthase subunit B [Orientia tsutsugamushi str. Boryong]
          Length = 165

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/141 (21%), Positives = 61/141 (43%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P  D   F +Q FWL I F     + +  I+P    +   R + ISS  +K +    ++
Sbjct: 1   MPQLDYIFFPTQLFWLVITFTFLLLMINFVIVPLAEKLFSKRNDHISSYIKKAEQTNIQI 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           + +         ++   A+EII++   + E+    +     + +  K+++   EI+ M  
Sbjct: 61  QKINEEVSRIARMSELEAEEIINQAKKSTEEIYNQRLMKHSQKIDQKVTDCIAEIEKMTI 120

Query: 133 KASQEVYSIVGEVTKDLVRKL 153
                    V + ++DL++KL
Sbjct: 121 NFQNSYKEQVIKYSQDLIKKL 141


>gi|15804336|ref|NP_290375.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 EDL933]
 gi|15833932|ref|NP_312705.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. Sakai]
 gi|16131604|ref|NP_418192.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. MG1655]
 gi|24115039|ref|NP_709549.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a str. 301]
 gi|26250482|ref|NP_756522.1| F0F1 ATP synthase subunit B [Escherichia coli CFT073]
 gi|30064959|ref|NP_839130.1| F0F1 ATP synthase subunit B [Shigella flexneri 2a str. 2457T]
 gi|74314238|ref|YP_312657.1| F0F1 ATP synthase subunit B [Shigella sonnei Ss046]
 gi|82546103|ref|YP_410050.1| F0F1 ATP synthase subunit B [Shigella boydii Sb227]
 gi|82779072|ref|YP_405421.1| F0F1 ATP synthase subunit B [Shigella dysenteriae Sd197]
 gi|89110271|ref|AP_004051.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. W3110]
 gi|91213263|ref|YP_543249.1| F0F1 ATP synthase subunit B [Escherichia coli UTI89]
 gi|110644077|ref|YP_671807.1| F0F1 ATP synthase subunit B [Escherichia coli 536]
 gi|110807560|ref|YP_691080.1| F0F1 ATP synthase subunit B [Shigella flexneri 5 str. 8401]
 gi|157156607|ref|YP_001465227.1| F0F1 ATP synthase subunit B [Escherichia coli E24377A]
 gi|157163218|ref|YP_001460536.1| F0F1 ATP synthase subunit B [Escherichia coli HS]
 gi|168748534|ref|ZP_02773556.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113]
 gi|168753638|ref|ZP_02778645.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401]
 gi|168759936|ref|ZP_02784943.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501]
 gi|168766236|ref|ZP_02791243.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486]
 gi|168772215|ref|ZP_02797222.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196]
 gi|168779971|ref|ZP_02804978.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076]
 gi|168786579|ref|ZP_02811586.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869]
 gi|168798784|ref|ZP_02823791.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508]
 gi|170022227|ref|YP_001727181.1| F0F1 ATP synthase subunit B [Escherichia coli ATCC 8739]
 gi|170083237|ref|YP_001732557.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170680530|ref|YP_001746066.1| F0F1 ATP synthase subunit B [Escherichia coli SMS-3-5]
 gi|187730481|ref|YP_001882427.1| F0F1 ATP synthase subunit B [Shigella boydii CDC 3083-94]
 gi|188495894|ref|ZP_03003164.1| ATP synthase F0, B subunit [Escherichia coli 53638]
 gi|191165830|ref|ZP_03027668.1| ATP synthase F0, B subunit [Escherichia coli B7A]
 gi|191170575|ref|ZP_03032128.1| ATP synthase F0, B subunit [Escherichia coli F11]
 gi|193063838|ref|ZP_03044925.1| ATP synthase F0, B subunit [Escherichia coli E22]
 gi|193069162|ref|ZP_03050119.1| ATP synthase F0, B subunit [Escherichia coli E110019]
 gi|194428101|ref|ZP_03060645.1| ATP synthase F0, B subunit [Escherichia coli B171]
 gi|194431089|ref|ZP_03063382.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012]
 gi|194435957|ref|ZP_03068060.1| ATP synthase F0, B subunit [Escherichia coli 101-1]
 gi|195936363|ref|ZP_03081745.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. EC4024]
 gi|208808170|ref|ZP_03250507.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4206]
 gi|208812218|ref|ZP_03253547.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4045]
 gi|208821029|ref|ZP_03261349.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4042]
 gi|209396106|ref|YP_002273264.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4115]
 gi|209921217|ref|YP_002295301.1| F0F1 ATP synthase subunit B [Escherichia coli SE11]
 gi|215489074|ref|YP_002331505.1| F0F1 ATP synthase subunit B [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217324928|ref|ZP_03441012.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. TW14588]
 gi|218551270|ref|YP_002385062.1| F0F1 ATP synthase subunit B [Escherichia fergusonii ATCC 35469]
 gi|218556307|ref|YP_002389221.1| F0F1 ATP synthase subunit B [Escherichia coli IAI1]
 gi|218560811|ref|YP_002393724.1| F0F1 ATP synthase subunit B [Escherichia coli S88]
 gi|218692024|ref|YP_002400236.1| F0F1 ATP synthase subunit B [Escherichia coli ED1a]
 gi|218697462|ref|YP_002405129.1| F0F1 ATP synthase subunit B [Escherichia coli 55989]
 gi|218702586|ref|YP_002410215.1| F0F1 ATP synthase subunit B [Escherichia coli IAI39]
 gi|218707382|ref|YP_002414901.1| F0F1 ATP synthase subunit B [Escherichia coli UMN026]
 gi|227883958|ref|ZP_04001763.1| H(+)-transporting two-sector ATPase [Escherichia coli 83972]
 gi|237703537|ref|ZP_04534018.1| membrane-bound ATP synthase [Escherichia sp. 3_2_53FAA]
 gi|238902827|ref|YP_002928623.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli BW2952]
 gi|253775629|ref|YP_003038460.1| F0F1 ATP synthase subunit B [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038955|ref|ZP_04873007.1| predicted protein [Escherichia sp. 1_1_43]
 gi|254163688|ref|YP_003046796.1| F0F1 ATP synthase subunit B [Escherichia coli B str. REL606]
 gi|254795742|ref|YP_003080579.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. TW14359]
 gi|256021242|ref|ZP_05435107.1| F0F1 ATP synthase subunit B [Shigella sp. D9]
 gi|256025533|ref|ZP_05439398.1| F0F1 ATP synthase subunit B [Escherichia sp. 4_1_40B]
 gi|260846479|ref|YP_003224257.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O103:H2 str. 12009]
 gi|260857849|ref|YP_003231740.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O26:H11 str. 11368]
 gi|260870470|ref|YP_003236872.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O111:H- str. 11128]
 gi|261225893|ref|ZP_05940174.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261258938|ref|ZP_05951471.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291285160|ref|YP_003501978.1| ATP synthase subunit B [Escherichia coli O55:H7 str. CB9615]
 gi|293407373|ref|ZP_06651295.1| F0F1 ATP synthase subunit B [Escherichia coli FVEC1412]
 gi|293413186|ref|ZP_06655852.1| ATP synthase F0 [Escherichia coli B354]
 gi|293417209|ref|ZP_06659836.1| ATP synthase F0 [Escherichia coli B185]
 gi|293464062|ref|ZP_06664476.1| ATP synthase F0 [Escherichia coli B088]
 gi|297518324|ref|ZP_06936710.1| F0F1 ATP synthase subunit B [Escherichia coli OP50]
 gi|298383115|ref|ZP_06992710.1| ATP synthase subunit B [Escherichia coli FVEC1302]
 gi|300815009|ref|ZP_07095234.1| ATP synthase F0, B subunit [Escherichia coli MS 107-1]
 gi|300824554|ref|ZP_07104664.1| ATP synthase F0, B subunit [Escherichia coli MS 119-7]
 gi|300896065|ref|ZP_07114624.1| ATP synthase F0, B subunit [Escherichia coli MS 198-1]
 gi|300902982|ref|ZP_07120925.1| ATP synthase F0, B subunit [Escherichia coli MS 84-1]
 gi|300916395|ref|ZP_07133135.1| ATP synthase F0, B subunit [Escherichia coli MS 115-1]
 gi|300925566|ref|ZP_07141439.1| ATP synthase F0, B subunit [Escherichia coli MS 182-1]
 gi|300932371|ref|ZP_07147636.1| ATP synthase F0, B subunit [Escherichia coli MS 187-1]
 gi|300940922|ref|ZP_07155448.1| ATP synthase F0, B subunit [Escherichia coli MS 21-1]
 gi|300950653|ref|ZP_07164547.1| ATP synthase F0, B subunit [Escherichia coli MS 116-1]
 gi|300958744|ref|ZP_07170861.1| ATP synthase F0, B subunit [Escherichia coli MS 175-1]
 gi|300983832|ref|ZP_07176774.1| ATP synthase F0, B subunit [Escherichia coli MS 200-1]
 gi|300984350|ref|ZP_07176956.1| ATP synthase F0, B subunit [Escherichia coli MS 45-1]
 gi|301019832|ref|ZP_07183973.1| ATP synthase F0, B subunit [Escherichia coli MS 196-1]
 gi|301020860|ref|ZP_07184921.1| ATP synthase F0, B subunit [Escherichia coli MS 69-1]
 gi|301047559|ref|ZP_07194631.1| ATP synthase F0, B subunit [Escherichia coli MS 185-1]
 gi|301305615|ref|ZP_07211705.1| ATP synthase F0, B subunit [Escherichia coli MS 124-1]
 gi|301324963|ref|ZP_07218518.1| ATP synthase F0, B subunit [Escherichia coli MS 78-1]
 gi|301644412|ref|ZP_07244411.1| ATP synthase F0, B subunit [Escherichia coli MS 146-1]
 gi|306815912|ref|ZP_07450050.1| F0F1 ATP synthase subunit B [Escherichia coli NC101]
 gi|307140436|ref|ZP_07499792.1| F0F1 ATP synthase subunit B [Escherichia coli H736]
 gi|307313192|ref|ZP_07592817.1| ATP synthase F0, B subunit [Escherichia coli W]
 gi|309784447|ref|ZP_07679086.1| ATP synthase F0, B subunit [Shigella dysenteriae 1617]
 gi|309795707|ref|ZP_07690122.1| ATP synthase F0, B subunit [Escherichia coli MS 145-7]
 gi|312967854|ref|ZP_07782066.1| ATP synthase F0, B subunit [Escherichia coli 2362-75]
 gi|312971972|ref|ZP_07786146.1| ATP synthase F0, B subunit [Escherichia coli 1827-70]
 gi|331644463|ref|ZP_08345592.1| ATP synthase F0, B subunit [Escherichia coli H736]
 gi|331649562|ref|ZP_08350648.1| ATP synthase F0, B subunit [Escherichia coli M605]
 gi|331655398|ref|ZP_08356397.1| ATP synthase F0, B subunit [Escherichia coli M718]
 gi|331660080|ref|ZP_08361018.1| ATP synthase F0, B subunit [Escherichia coli TA206]
 gi|331665390|ref|ZP_08366291.1| ATP synthase F0, B subunit [Escherichia coli TA143]
 gi|331670586|ref|ZP_08371425.1| ATP synthase F0, B subunit [Escherichia coli TA271]
 gi|331679840|ref|ZP_08380510.1| ATP synthase F0, B subunit [Escherichia coli H591]
 gi|331685463|ref|ZP_08386049.1| ATP synthase F0, B subunit [Escherichia coli H299]
 gi|332282469|ref|ZP_08394882.1| membrane-bound ATP synthase [Shigella sp. D9]
 gi|81175151|sp|P0ABA2|ATPF_ECO57 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81175152|sp|P0ABA1|ATPF_ECOL6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81175153|sp|P0ABA0|ATPF_ECOLI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81175154|sp|P0ABA3|ATPF_SHIFL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122421811|sp|Q1R4J6|ATPF_ECOUT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123342305|sp|Q0SYU0|ATPF_SHIF8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123343410|sp|Q0TAX3|ATPF_ECOL5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123558238|sp|Q31UN6|ATPF_SHIBS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123561164|sp|Q329S5|ATPF_SHIDS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123615763|sp|Q3YVP0|ATPF_SHISS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694920|sp|B2TUN9|ATPF_SHIB3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741439|sp|A7ZTU8|ATPF_ECO24 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741440|sp|B5YXE0|ATPF_ECO5E RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741441|sp|B1X9W4|ATPF_ECODH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741442|sp|A8A6J9|ATPF_ECOHS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741443|sp|B1IX02|ATPF_ECOLC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741444|sp|B6I3X3|ATPF_ECOSE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741445|sp|B1LL63|ATPF_ECOSM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741450|sp|B7LK81|ATPF_ESCF3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|12518593|gb|AAG58939.1|AE005605_7 membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
           O157:H7 str. EDL933]
 gi|26110912|gb|AAN83096.1|AE016769_211 ATP synthase B chain [Escherichia coli CFT073]
 gi|146321|gb|AAA83871.1| integral membrane proton channel F0 subunit B [Escherichia coli]
 gi|148135|gb|AAA24733.1| ATP synthase b subunit [Escherichia coli]
 gi|290585|gb|AAA62088.1| ATP synthase F0 subunit b [Escherichia coli]
 gi|581045|emb|CAA23516.1| unnamed protein product [Escherichia coli]
 gi|581046|emb|CAA23523.1| atpF [Escherichia coli]
 gi|581249|emb|CAA25778.1| unnamed protein product [Escherichia coli]
 gi|1790174|gb|AAC76759.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13364153|dbj|BAB38101.1| membrane-bound ATP synthase subunit b AtpF [Escherichia coli
           O157:H7 str. Sakai]
 gi|24054298|gb|AAN45256.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           flexneri 2a str. 301]
 gi|30043220|gb|AAP18941.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           flexneri 2a str. 2457T]
 gi|73857715|gb|AAZ90422.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella sonnei
           Ss046]
 gi|81243220|gb|ABB63930.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           dysenteriae Sd197]
 gi|81247514|gb|ABB68222.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella boydii
           Sb227]
 gi|85676302|dbj|BAE77552.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K12 substr. W3110]
 gi|91074837|gb|ABE09718.1| membrane-bound ATP synthase F0 sector subunit b [Escherichia coli
           UTI89]
 gi|110345669|gb|ABG71906.1| ATP synthase B chain [Escherichia coli 536]
 gi|110617108|gb|ABF05775.1| membrane-bound ATP synthase, F0 sector, subunit b [Shigella
           flexneri 5 str. 8401]
 gi|157068898|gb|ABV08153.1| ATP synthase F0, B subunit [Escherichia coli HS]
 gi|157078637|gb|ABV18345.1| ATP synthase F0, B subunit [Escherichia coli E24377A]
 gi|169757155|gb|ACA79854.1| ATP synthase F0, B subunit [Escherichia coli ATCC 8739]
 gi|169891072|gb|ACB04779.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170518248|gb|ACB16426.1| ATP synthase F0, B subunit [Escherichia coli SMS-3-5]
 gi|187427473|gb|ACD06747.1| ATP synthase F0, B subunit [Shigella boydii CDC 3083-94]
 gi|187771617|gb|EDU35461.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4196]
 gi|188016977|gb|EDU55099.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4113]
 gi|188491093|gb|EDU66196.1| ATP synthase F0, B subunit [Escherichia coli 53638]
 gi|189002279|gb|EDU71265.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4076]
 gi|189358998|gb|EDU77417.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4401]
 gi|189364601|gb|EDU83020.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4486]
 gi|189369852|gb|EDU88268.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4501]
 gi|189373288|gb|EDU91704.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC869]
 gi|189378758|gb|EDU97174.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC508]
 gi|190904154|gb|EDV63865.1| ATP synthase F0, B subunit [Escherichia coli B7A]
 gi|190909383|gb|EDV68969.1| ATP synthase F0, B subunit [Escherichia coli F11]
 gi|192930553|gb|EDV83160.1| ATP synthase F0, B subunit [Escherichia coli E22]
 gi|192957486|gb|EDV87932.1| ATP synthase F0, B subunit [Escherichia coli E110019]
 gi|194413859|gb|EDX30137.1| ATP synthase F0, B subunit [Escherichia coli B171]
 gi|194420544|gb|EDX36620.1| ATP synthase F0, B subunit [Shigella dysenteriae 1012]
 gi|194425500|gb|EDX41484.1| ATP synthase F0, B subunit [Escherichia coli 101-1]
 gi|208727971|gb|EDZ77572.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4206]
 gi|208733495|gb|EDZ82182.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4045]
 gi|208741152|gb|EDZ88834.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4042]
 gi|209157506|gb|ACI34939.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. EC4115]
 gi|209753848|gb|ACI75231.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753850|gb|ACI75232.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753852|gb|ACI75233.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753854|gb|ACI75234.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209753856|gb|ACI75235.1| membrane-bound ATP synthase subunit c AtpE [Escherichia coli]
 gi|209914476|dbj|BAG79550.1| ATP synthase subunit B [Escherichia coli SE11]
 gi|215267146|emb|CAS11594.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli O127:H6 str. E2348/69]
 gi|217321149|gb|EEC29573.1| ATP synthase F0, B subunit [Escherichia coli O157:H7 str. TW14588]
 gi|218354194|emb|CAV00825.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli 55989]
 gi|218358812|emb|CAQ91469.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           fergusonii ATCC 35469]
 gi|218363076|emb|CAR00714.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli IAI1]
 gi|218367580|emb|CAR05364.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli S88]
 gi|218372572|emb|CAR20446.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli IAI39]
 gi|218429588|emb|CAR10410.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli ED1a]
 gi|218434479|emb|CAR15406.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli UMN026]
 gi|226838920|gb|EEH70947.1| predicted protein [Escherichia sp. 1_1_43]
 gi|226902801|gb|EEH89060.1| membrane-bound ATP synthase [Escherichia sp. 3_2_53FAA]
 gi|227839236|gb|EEJ49702.1| H(+)-transporting two-sector ATPase [Escherichia coli 83972]
 gi|238861065|gb|ACR63063.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli BW2952]
 gi|242379274|emb|CAQ34081.1| ATP synthase, F0 complex, b subunit, subunit of b subunit complex,
           ATP synthase, F0 complex and ATP synthase [Escherichia
           coli BL21(DE3)]
 gi|253326673|gb|ACT31275.1| ATP synthase F0, B subunit [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975589|gb|ACT41260.1| F0F1 ATP synthase subunit B [Escherichia coli B str. REL606]
 gi|253979745|gb|ACT45415.1| F0F1 ATP synthase subunit B [Escherichia coli BL21(DE3)]
 gi|254595142|gb|ACT74503.1| F0 sector of membrane-bound ATP synthase, subunit b [Escherichia
           coli O157:H7 str. TW14359]
 gi|257756498|dbj|BAI28000.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O26:H11 str. 11368]
 gi|257761626|dbj|BAI33123.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O103:H2 str. 12009]
 gi|257766826|dbj|BAI38321.1| F0 sector of membrane-bound ATP synthase, subunit b AtpF
           [Escherichia coli O111:H- str. 11128]
 gi|260451407|gb|ACX41829.1| ATP synthase F0, B subunit [Escherichia coli DH1]
 gi|281180794|dbj|BAI57124.1| ATP synthase subunit B [Escherichia coli SE15]
 gi|281603134|gb|ADA76118.1| ATP synthase B chain [Shigella flexneri 2002017]
 gi|284923850|emb|CBG36949.1| ATP synthase subunit B [Escherichia coli 042]
 gi|290765033|gb|ADD58994.1| ATP synthase B chain [Escherichia coli O55:H7 str. CB9615]
 gi|291321694|gb|EFE61130.1| ATP synthase F0 [Escherichia coli B088]
 gi|291425664|gb|EFE98700.1| F0F1 ATP synthase subunit B [Escherichia coli FVEC1412]
 gi|291431240|gb|EFF04233.1| ATP synthase F0 [Escherichia coli B185]
 gi|291468319|gb|EFF10814.1| ATP synthase F0 [Escherichia coli B354]
 gi|294490671|gb|ADE89427.1| ATP synthase F0, B subunit [Escherichia coli IHE3034]
 gi|298276951|gb|EFI18469.1| ATP synthase subunit B [Escherichia coli FVEC1302]
 gi|299882060|gb|EFI90271.1| ATP synthase F0, B subunit [Escherichia coli MS 196-1]
 gi|300300545|gb|EFJ56930.1| ATP synthase F0, B subunit [Escherichia coli MS 185-1]
 gi|300306861|gb|EFJ61381.1| ATP synthase F0, B subunit [Escherichia coli MS 200-1]
 gi|300314625|gb|EFJ64409.1| ATP synthase F0, B subunit [Escherichia coli MS 175-1]
 gi|300360051|gb|EFJ75921.1| ATP synthase F0, B subunit [Escherichia coli MS 198-1]
 gi|300398430|gb|EFJ81968.1| ATP synthase F0, B subunit [Escherichia coli MS 69-1]
 gi|300404977|gb|EFJ88515.1| ATP synthase F0, B subunit [Escherichia coli MS 84-1]
 gi|300408386|gb|EFJ91924.1| ATP synthase F0, B subunit [Escherichia coli MS 45-1]
 gi|300416299|gb|EFJ99609.1| ATP synthase F0, B subunit [Escherichia coli MS 115-1]
 gi|300418340|gb|EFK01651.1| ATP synthase F0, B subunit [Escherichia coli MS 182-1]
 gi|300450023|gb|EFK13643.1| ATP synthase F0, B subunit [Escherichia coli MS 116-1]
 gi|300454352|gb|EFK17845.1| ATP synthase F0, B subunit [Escherichia coli MS 21-1]
 gi|300459876|gb|EFK23369.1| ATP synthase F0, B subunit [Escherichia coli MS 187-1]
 gi|300522955|gb|EFK44024.1| ATP synthase F0, B subunit [Escherichia coli MS 119-7]
 gi|300531901|gb|EFK52963.1| ATP synthase F0, B subunit [Escherichia coli MS 107-1]
 gi|300839123|gb|EFK66883.1| ATP synthase F0, B subunit [Escherichia coli MS 124-1]
 gi|300848134|gb|EFK75894.1| ATP synthase F0, B subunit [Escherichia coli MS 78-1]
 gi|301077251|gb|EFK92057.1| ATP synthase F0, B subunit [Escherichia coli MS 146-1]
 gi|305850308|gb|EFM50765.1| F0F1 ATP synthase subunit B [Escherichia coli NC101]
 gi|306906875|gb|EFN37384.1| ATP synthase F0, B subunit [Escherichia coli W]
 gi|307555875|gb|ADN48650.1| membrane-bound ATP synthase, F0 sector, subunit b [Escherichia coli
           ABU 83972]
 gi|307628810|gb|ADN73114.1| F0F1 ATP synthase subunit B [Escherichia coli UM146]
 gi|308120586|gb|EFO57848.1| ATP synthase F0, B subunit [Escherichia coli MS 145-7]
 gi|308927954|gb|EFP73422.1| ATP synthase F0, B subunit [Shigella dysenteriae 1617]
 gi|309704184|emb|CBJ03531.1| ATP synthase subunit B [Escherichia coli ETEC H10407]
 gi|310334349|gb|EFQ00554.1| ATP synthase F0, B subunit [Escherichia coli 1827-70]
 gi|312287415|gb|EFR15323.1| ATP synthase F0, B subunit [Escherichia coli 2362-75]
 gi|313647648|gb|EFS12096.1| ATP synthase F0, B subunit [Shigella flexneri 2a str. 2457T]
 gi|315063046|gb|ADT77373.1| F0 sector of membrane-bound ATP synthase, subunit B [Escherichia
           coli W]
 gi|315138321|dbj|BAJ45480.1| ATP synthase subunit B [Escherichia coli DH1]
 gi|315254571|gb|EFU34539.1| ATP synthase F0, B subunit [Escherichia coli MS 85-1]
 gi|315285547|gb|EFU44989.1| ATP synthase F0, B subunit [Escherichia coli MS 110-3]
 gi|315292822|gb|EFU52174.1| ATP synthase F0, B subunit [Escherichia coli MS 153-1]
 gi|315296880|gb|EFU56169.1| ATP synthase F0, B subunit [Escherichia coli MS 16-3]
 gi|320174627|gb|EFW49763.1| ATP synthase B chain [Shigella dysenteriae CDC 74-1112]
 gi|320180082|gb|EFW55024.1| ATP synthase B chain [Shigella boydii ATCC 9905]
 gi|320186281|gb|EFW61017.1| ATP synthase B chain [Shigella flexneri CDC 796-83]
 gi|320191160|gb|EFW65810.1| ATP synthase B chain [Escherichia coli O157:H7 str. EC1212]
 gi|320193719|gb|EFW68352.1| ATP synthase B chain [Escherichia coli WV_060327]
 gi|320201231|gb|EFW75812.1| ATP synthase B chain [Escherichia coli EC4100B]
 gi|320639464|gb|EFX09079.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. G5101]
 gi|320644904|gb|EFX13940.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H- str. 493-89]
 gi|320650170|gb|EFX18666.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H- str. H 2687]
 gi|320655519|gb|EFX23454.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320661142|gb|EFX28578.1| F0F1 ATP synthase subunit B [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320666271|gb|EFX33277.1| F0F1 ATP synthase subunit B [Escherichia coli O157:H7 str. LSU-61]
 gi|323155417|gb|EFZ41600.1| ATP synthase F0, B subunit [Escherichia coli EPECa14]
 gi|323161012|gb|EFZ46931.1| ATP synthase F0, B subunit [Escherichia coli E128010]
 gi|323167010|gb|EFZ52749.1| ATP synthase F0, B subunit [Shigella sonnei 53G]
 gi|323173361|gb|EFZ58990.1| ATP synthase F0, B subunit [Escherichia coli LT-68]
 gi|323177756|gb|EFZ63340.1| ATP synthase F0, B subunit [Escherichia coli 1180]
 gi|323189531|gb|EFZ74811.1| ATP synthase F0, B subunit [Escherichia coli RN587/1]
 gi|323380892|gb|ADX53160.1| ATP synthase F0, B subunit [Escherichia coli KO11]
 gi|323934913|gb|EGB31291.1| ATP synthase F0 [Escherichia coli E1520]
 gi|323939201|gb|EGB35414.1| ATP synthase F0 [Escherichia coli E482]
 gi|323944212|gb|EGB40292.1| ATP synthase F0 [Escherichia coli H120]
 gi|323949979|gb|EGB45863.1| ATP synthase F0 [Escherichia coli H252]
 gi|323954969|gb|EGB50747.1| ATP synthase F0 [Escherichia coli H263]
 gi|323959802|gb|EGB55452.1| ATP synthase F0 [Escherichia coli H489]
 gi|323965804|gb|EGB61255.1| ATP synthase F0 [Escherichia coli M863]
 gi|323971215|gb|EGB66461.1| ATP synthase F0 [Escherichia coli TA007]
 gi|323975196|gb|EGB70300.1| ATP synthase F0 [Escherichia coli TW10509]
 gi|324008004|gb|EGB77223.1| ATP synthase F0, B subunit [Escherichia coli MS 57-2]
 gi|324012758|gb|EGB81977.1| ATP synthase F0, B subunit [Escherichia coli MS 60-1]
 gi|324018466|gb|EGB87685.1| ATP synthase F0, B subunit [Escherichia coli MS 117-3]
 gi|324111635|gb|EGC05616.1| ATP synthase F0 [Escherichia fergusonii B253]
 gi|324115908|gb|EGC09834.1| ATP synthase F0 [Escherichia coli E1167]
 gi|325499542|gb|EGC97401.1| F0F1 ATP synthase subunit B [Escherichia fergusonii ECD227]
 gi|326340516|gb|EGD64315.1| ATP synthase B chain [Escherichia coli O157:H7 str. 1044]
 gi|326341582|gb|EGD65371.1| ATP synthase B chain [Escherichia coli O157:H7 str. 1125]
 gi|327250888|gb|EGE62590.1| ATP synthase F0, B subunit [Escherichia coli STEC_7v]
 gi|330908049|gb|EGH36568.1| ATP synthase B chain [Escherichia coli AA86]
 gi|331036757|gb|EGI08983.1| ATP synthase F0, B subunit [Escherichia coli H736]
 gi|331042060|gb|EGI14204.1| ATP synthase F0, B subunit [Escherichia coli M605]
 gi|331047413|gb|EGI19491.1| ATP synthase F0, B subunit [Escherichia coli M718]
 gi|331053295|gb|EGI25328.1| ATP synthase F0, B subunit [Escherichia coli TA206]
 gi|331057900|gb|EGI29886.1| ATP synthase F0, B subunit [Escherichia coli TA143]
 gi|331062648|gb|EGI34568.1| ATP synthase F0, B subunit [Escherichia coli TA271]
 gi|331073012|gb|EGI44337.1| ATP synthase F0, B subunit [Escherichia coli H591]
 gi|331077834|gb|EGI49046.1| ATP synthase F0, B subunit [Escherichia coli H299]
 gi|332084598|gb|EGI89792.1| ATP synthase F0, B subunit [Shigella boydii 5216-82]
 gi|332084747|gb|EGI89933.1| ATP synthase F0, B subunit [Shigella dysenteriae 155-74]
 gi|332089391|gb|EGI94495.1| ATP synthase F0, B subunit [Shigella boydii 3594-74]
 gi|332104821|gb|EGJ08167.1| membrane-bound ATP synthase [Shigella sp. D9]
 gi|332345726|gb|AEE59060.1| ATP synthase F0, B subunit AtpF [Escherichia coli UMNK88]
 gi|332750745|gb|EGJ81153.1| ATP synthase F0, B subunit [Shigella flexneri 4343-70]
 gi|332750901|gb|EGJ81307.1| ATP synthase F0, B subunit [Shigella flexneri K-671]
 gi|332751760|gb|EGJ82158.1| ATP synthase F0, B subunit [Shigella flexneri 2747-71]
 gi|332764007|gb|EGJ94244.1| ATP synthase F0, B subunit [Shigella flexneri 2930-71]
 gi|332997053|gb|EGK16669.1| ATP synthase F0, B subunit [Shigella flexneri K-218]
 gi|332998040|gb|EGK17645.1| ATP synthase F0, B subunit [Shigella flexneri K-272]
 gi|333013469|gb|EGK32840.1| ATP synthase F0, B subunit [Shigella flexneri K-304]
 gi|333013710|gb|EGK33075.1| ATP synthase F0, B subunit [Shigella flexneri K-227]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|291615576|ref|YP_003518318.1| AtpF [Pantoea ananatis LMG 20103]
 gi|291150606|gb|ADD75190.1| AtpF [Pantoea ananatis LMG 20103]
 gi|327395845|dbj|BAK13267.1| ATP synthase B chain AtpF [Pantoea ananatis AJ13355]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPIMAAIEKRQKEIAEGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   + +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKEEAQVIIEQANKRRTQILDEAKTEADNERTRIVAQAQAEIDAERKRAREELRKQVAL 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAMAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|302383814|ref|YP_003819637.1| H+transporting two-sector ATPase B/B' subunit [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194442|gb|ADL02014.1| H+transporting two-sector ATPase B/B' subunit [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 197

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/156 (17%), Positives = 61/156 (39%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A++ +       P F++  ++ Q  +L I+F I Y +  +   PR+  + + R   I++
Sbjct: 27  VATAEAEHGGGGLPQFESQHWVGQIGYLLILFVILYILISKVFAPRMRRVFDERETTIAT 86

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
                   + E      + +  +  ARA A+       A   +    +    E  +  ++
Sbjct: 87  AVSTARQVQAEAAGQAEAAKAEVEKARADARAASVAAKARVTEEANRRAAEEEAVVNARI 146

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS 156
           + A+  I   +  A   V +I  +    +V +L   
Sbjct: 147 AEAETAIGKTRDAAMTNVAAIAADTASAIVERLTGK 182


>gi|167626203|ref|YP_001676497.1| F0F1 ATP synthase subunit B [Shewanella halifaxensis HAW-EB4]
 gi|226694479|sp|B0TQF8|ATPF_SHEHH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167356225|gb|ABZ78838.1| ATP synthase F0, B subunit [Shewanella halifaxensis HAW-EB4]
          Length = 156

 Score = 79.1 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +F+ P L + +E R+  I+        A +++E       E L  A+A
Sbjct: 11  AISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVKATEQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q ++  +   + +    ++    EI++ + +  +++   V  +   
Sbjct: 71  TANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDLRKQVAALAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+ +A    I+++    +
Sbjct: 131 GAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|148145|gb|AAA24741.1| proton-translocating ATPase b subunit (uncF; gtg start codon)
           [Escherichia coli]
          Length = 156

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASANDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|239990751|ref|ZP_04711415.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 11379]
 gi|291447764|ref|ZP_06587154.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 15998]
 gi|291350711|gb|EFE77615.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 15998]
          Length = 178

 Score = 79.1 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I ++V ++ +LP ++  ++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 24  LICFSIVFFVFYKKLLPAINKALDERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 83

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        ++  +   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 84  EAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKLATD 143

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A     +DR  D ++A
Sbjct: 144 LAGKLVGESLQDHARQSGTVDRFLDELEA 172


>gi|85060388|ref|YP_456090.1| F0F1 ATP synthase subunit B [Sodalis glossinidius str. 'morsitans']
 gi|123518616|sp|Q2NQ90|ATPF_SODGM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|84780908|dbj|BAE75685.1| ATP synthase subunit B [Sodalis glossinidius str. 'morsitans']
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + AK++++   +   + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMASIEKRQKEIADGLASAERAKKDLDIAQAEATDHLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q ++  +   E +    L+ AQ EID  +K+A +E+   V  
Sbjct: 67  QAKVEAQAIIEQANKRKAQVVDEAKAEAEAERNKILAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV DA    I+D+    +
Sbjct: 127 LALAGAEKIIERSVDDAANSDIVDKIVAEL 156


>gi|284032934|ref|YP_003382865.1| ATP synthase F0 subunit B [Kribbella flavida DSM 17836]
 gi|283812227|gb|ADB34066.1| ATP synthase F0, B subunit [Kribbella flavida DSM 17836]
          Length = 189

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/171 (16%), Positives = 66/171 (38%), Gaps = 4/171 (2%)

Query: 7   SDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMD 66
           S+      P    T  ++  +  +   +      + ++P+       R   I     +  
Sbjct: 9   SEAGEGPSPLMPHT--AEIIFGFVFLVLLAIAFAKIVVPKFEKAYAERTQAIEGGMNEAK 66

Query: 67  SAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNE 126
            A+ E ++ +  Y   LA AR  A +I +       Q +   RE    +    +S+A+ +
Sbjct: 67  QAQAEAKAALDKYNAQLAEARQEAAKIREDAREQGAQIIAEMREQAGVEAERIVSHARTQ 126

Query: 127 IDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           I+  + +A   + S VG +   L  ++       +A  ++ ++R    +++
Sbjct: 127 IEAERSQAVASLRSEVGSMATSLAGRIVGESLEDEARQRRTVERFLAELES 177


>gi|300726960|ref|ZP_07060383.1| ATP synthase F0, B subunit [Prevotella bryantii B14]
 gi|299775745|gb|EFI72332.1| ATP synthase F0, B subunit [Prevotella bryantii B14]
          Length = 168

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 70/155 (45%), Gaps = 2/155 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ I+F I + V  ++  P +  ++  R+  I     K   A  ++ ++    E  
Sbjct: 9   GLLFWMTIVFIIVFLVLLKWGFPSIIKMVNDRKAFIDDSLRKAHEANEKLANIQKEGESI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR     I+ +     +  +E  ++   ++    ++ A+ +I+  ++ A +++ S V
Sbjct: 69  LQEAREKQAAILKEAAETRDAIVENAQDKAREEGARIVNEAKIQIETEKQNAIRDIRSQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
            E++  +  K+      +DA   +++DR  D + +
Sbjct: 129 AELSILVAEKVLKQNLSTDAKQMELIDRLLDEVSS 163


>gi|253987523|ref|YP_003038879.1| F0F1 ATP synthase subunit B [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253778973|emb|CAQ82133.1| ATP synthase B chain [Photorhabdus asymbiotica]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +F+ P + + +E R+  I+      + AK++++   ++  + + 
Sbjct: 7   ILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQMK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  RAKAEAQVIIEQANKQKAQILDDAKAEAELERNRIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|116493069|ref|YP_804804.1| F0F1-type ATP synthase, subunit b [Pediococcus pentosaceus ATCC
           25745]
 gi|122265467|sp|Q03EL0|ATPF_PEDPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116103219|gb|ABJ68362.1| ATP synthase F0 subcomplex B subunit [Pediococcus pentosaceus ATCC
           25745]
          Length = 173

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 70/157 (44%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           + ++    + AI+F +   +  +F    ++++++ R + IS+D +  + ++ E E +   
Sbjct: 14  TLYVGDMLFYAILFIVLMALIAKFAWGPVNAMLKERADRISNDIDSAEQSRIEAEKLAKQ 73

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +E+L  + A A  II+    +  +  E      + +       A+ +I+  +  A +  
Sbjct: 74  RKEALDNSHAEATSIINNAKDSGAKERELIIGNAQNEAKSLKDKAKQDIEQERADALKSA 133

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
              +  ++ ++  K +   + +   + ++D   +G+ 
Sbjct: 134 QDDIASLSIEIASKVIKKELDENSQKDLIDSYIEGLG 170


>gi|163751418|ref|ZP_02158643.1| ATP synthase subunit B [Shewanella benthica KT99]
 gi|161328721|gb|EDP99869.1| ATP synthase subunit B [Shewanella benthica KT99]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F +F W   +F+ P L + +E R+  I+      D A +++E   +   + L  A+A
Sbjct: 11  TVAFILFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q ++  +   + +    ++  Q EI+  + +  +++   V  +   
Sbjct: 71  TANEIIEQANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDLRKQVAALAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+ +A    I+++    +
Sbjct: 131 GAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|311033326|ref|ZP_07711416.1| F0F1 ATP synthase subunit B [Bacillus sp. m3-13]
          Length = 172

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 63/148 (42%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I  +   +F   +L  +M+ R + I+++    + +  E ++++   +  L  AR 
Sbjct: 23  LITFLILLYFLRKFAWDKLVGMMKQREDHIANEITAAEQSNVEAKALVEEQKSLLKEART 82

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A+ +++     AE          +++       A+ EI   +++A   +   V  ++  
Sbjct: 83  EAQALVESAKKVAEDQKADIVRAAQEESARLKEAARKEIIQEKEQAVVALREQVASLSVL 142

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +  K +   +++ D QK++D     +  
Sbjct: 143 IASKVIEKELNEKDQQKLIDDYVKQVGE 170


>gi|317050174|ref|YP_004117822.1| ATP synthase F0 subunit B [Pantoea sp. At-9b]
 gi|316951791|gb|ADU71266.1| ATP synthase F0, B subunit [Pantoea sp. At-9b]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E +    ++ AQ EI+  + +A +E+   V  
Sbjct: 67  KAKEEAQVIIEQANKRRAQILDEAKTEAETERNRIVAQAQAEIEAERSRAREELRKQVAL 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LALAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|271502661|ref|YP_003335687.1| ATP synthase F0 subunit B [Dickeya dadantii Ech586]
 gi|270346216|gb|ACZ78981.1| ATP synthase F0, B subunit [Dickeya dadantii Ech586]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+++    ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++        L+  +   E +    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKQRALILDEAKVEAEAERNKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|325963830|ref|YP_004241736.1| ATP synthase F0 subcomplex subunit beta [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|323469917|gb|ADX73602.1| ATP synthase F0 subcomplex B subunit [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 183

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 66/172 (38%), Gaps = 4/172 (2%)

Query: 6   SSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKM 65
           S+       P   + +      + + F I  ++  +F++P        R   I     K 
Sbjct: 7   SAATEGEINPLMPNLWEMGV--VLVGFAILMFIVVKFVVPMFEKTFAERAEAIEGGIAKA 64

Query: 66  DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQN 125
           + A+ E  + +  Y++ L  AR  A  I ++  A   Q L   +E    +     + A  
Sbjct: 65  EKAQAEASAALEEYKQQLTDARTEANRIREEARAEGAQILADLKEKAAAESARITAQAHA 124

Query: 126 EIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +I+  ++ A   + S VG +   L  ++       D    +++DR    +++
Sbjct: 125 QIESERQAAVVSLRSEVGTLATTLAGRIVGEALNDDERAARVVDRFLADLES 176


>gi|319947326|ref|ZP_08021559.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
 gi|319746568|gb|EFV98828.1| ATP synthase F0 sector subunit B [Streptococcus australis ATCC
           700641]
          Length = 164

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/160 (21%), Positives = 77/160 (48%), Gaps = 1/160 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
               T +  F  +A  F +  ++  +F    ++SI++ R   I++D ++ ++A+++ E +
Sbjct: 3   LTIGTIIGDFILIAGSFLLLIFLVKKFAWGNITSILDARAEKITNDIDEAEAARKKAEEL 62

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
            +  E  LA +R  A  I++     AE+N         ++ L     AQ EI   +++A 
Sbjct: 63  ATKREAELAGSRQEATTILETAKETAEKNKAHILSEANQEALRLKEKAQLEISQNKEEAM 122

Query: 136 QEVYSIVGEVTKDLVRKLGFSVSDAD-VQKILDRKRDGID 174
             +   V ++T +L  KL     D++  ++++DR  + + 
Sbjct: 123 NSIKGDVADLTVNLAGKLLSQQLDSEGHRQLIDRYLNELG 162


>gi|239948440|ref|ZP_04700193.1| F0F1 ATP synthase subunit B' [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922716|gb|EER22740.1| F0F1 ATP synthase subunit B' [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 158

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/143 (21%), Positives = 65/143 (45%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + FG+ Y   ++FI P+   I   R+  I  +  + D+   EV
Sbjct: 1   MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTIEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +         +  + + + E     +++  E+DL + ++    +I+   K
Sbjct: 61  EKLNKYYNEEIDKTNTEIDRLKKEKIDSLESEFLIKKKNLEQDLKNSINQNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGF 155
           +        + ++  +++ K+  
Sbjct: 121 QFRTNKSEAIIKLAVNIIEKIAG 143


>gi|283787575|ref|YP_003367440.1| ATP synthase subunit B [Citrobacter rodentium ICC168]
 gi|283836160|ref|ZP_06355901.1| hypothetical protein CIT292_10585 [Citrobacter youngae ATCC 29220]
 gi|282951029|emb|CBG90707.1| ATP synthase subunit B [Citrobacter rodentium ICC168]
 gi|291068353|gb|EFE06462.1| ATP synthase F0, B subunit [Citrobacter youngae ATCC 29220]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|37681439|ref|NP_936048.1| F0F1 ATP synthase subunit B [Vibrio vulnificus YJ016]
 gi|326423791|ref|NP_759978.2| ATP synthase F0 subunit B [Vibrio vulnificus CMCP6]
 gi|38503000|sp|Q8DDH2|ATPF_VIBVU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81756321|sp|Q7MGH6|ATPF_VIBVY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|37200191|dbj|BAC96019.1| F0F1-type ATP synthase, subunit b [Vibrio vulnificus YJ016]
 gi|319999157|gb|AAO09505.2| ATP synthase F0, B subunit [Vibrio vulnificus CMCP6]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 62/142 (43%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+   +  + A ++++   ++    L  A+ 
Sbjct: 11  AISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANASSQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q L+  RE  + +    L+ A+ +++  + +A  E+   V  +   
Sbjct: 71  TATEIIEQANKRKAQILDEAREDAQTERQKILAQAEAQLEAERNRARDELRKQVATLAVA 130

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 131 GAEKILERSIDKDAHKDILDNI 152


>gi|157144372|ref|YP_001451691.1| F0F1 ATP synthase subunit B [Citrobacter koseri ATCC BAA-895]
 gi|237729047|ref|ZP_04559528.1| predicted protein [Citrobacter sp. 30_2]
 gi|226741340|sp|A8ACP2|ATPF_CITK8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157081577|gb|ABV11255.1| hypothetical protein CKO_00076 [Citrobacter koseri ATCC BAA-895]
 gi|226909669|gb|EEH95587.1| predicted protein [Citrobacter sp. 30_2]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIDAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|227497327|ref|ZP_03927559.1| F family two-sector ATPase, F(1) beta subunit [Actinomyces
           urogenitalis DSM 15434]
 gi|226833198|gb|EEH65581.1| F family two-sector ATPase, F(1) beta subunit [Actinomyces
           urogenitalis DSM 15434]
          Length = 199

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/153 (21%), Positives = 60/153 (39%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  I F +   +   F LPR +++++ R   I       D AK + +         + 
Sbjct: 32  LVWGTIAFLLIAGLLIFFALPRFTAVLDERTKKIEEGLALADKAKEDQKDAELKAARLVE 91

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D+    A   +   R   + +    L  AQ +I   ++ A   + S VG 
Sbjct: 92  DARREAAQIRDQAQDEARLIIAQARTEAQAEAGRALEAAQRQILADRQAAQISLRSDVGL 151

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +   L  K+        A   +++DR  D +++
Sbjct: 152 LATSLAEKIVGEQLSDAAVSSRVIDRFLDSLES 184


>gi|29829427|ref|NP_824061.1| F0F1 ATP synthase subunit B [Streptomyces avermitilis MA-4680]
          Length = 186

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I ++V  + +LP ++ ++E RR  I    E+ ++ K E +S++  Y+  LA AR 
Sbjct: 32  LLAFAIVFFVLGKKLLPNINKVLEERRAAIEGGIEEAEAMKVEAQSVLEQYKAQLAEARH 91

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +++  +K A+Q +   VG +  D
Sbjct: 92  EAARLRQEAQEQGATLITEMRAEGQRQREEIIAAGHAQLEADRKAAAQALRQDVGTLATD 151

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   +++DR  DG++ 
Sbjct: 152 LAGKLVGESLEDHARQSRVIDRFLDGLEE 180


>gi|50123432|ref|YP_052599.1| F0F1 ATP synthase subunit B [Pectobacterium atrosepticum SCRI1043]
 gi|227113927|ref|ZP_03827583.1| F0F1 ATP synthase subunit B [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|253690613|ref|YP_003019803.1| ATP synthase F0, B subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|81643446|sp|Q6CYJ1|ATPF_ERWCT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|49613958|emb|CAG77411.1| ATP synthase B chain [Pectobacterium atrosepticum SCRI1043]
 gi|251757191|gb|ACT15267.1| ATP synthase F0, B subunit [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+++    ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPMMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E +    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKADAQVIIEQANKRRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREELRKQVAV 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|289769071|ref|ZP_06528449.1| ATP synthase F0, B subunit [Streptomyces lividans TK24]
 gi|289699270|gb|EFD66699.1| ATP synthase F0, B subunit [Streptomyces lividans TK24]
          Length = 181

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 2/148 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 24  LIAFVIVFGFLAKKLLPNINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 83

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I   +K A+  +   VG++  +
Sbjct: 84  EAARLRQEAQEQGATLIAEMRAEGQRQREEIIAAGHAQIQADRKAAASALRQDVGKLATE 143

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGID 174
           L  KL        A   +++DR  D +D
Sbjct: 144 LAGKLVGESLEDHARQSRVIDRFLDELD 171


>gi|581169|emb|CAA23592.1| unnamed protein product [Escherichia coli]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L +  E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAFEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A  + II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEDQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|116671155|ref|YP_832088.1| ATP synthase F0 subunit B [Arthrobacter sp. FB24]
 gi|226741295|sp|A0JY68|ATPF_ARTS2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116611264|gb|ABK03988.1| ATP synthase F0 subcomplex B subunit [Arthrobacter sp. FB24]
          Length = 182

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/170 (18%), Positives = 68/170 (40%), Gaps = 4/170 (2%)

Query: 7   SDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMD 66
           S  +    P   + +      +   F + +++  +F++P        R   I     K +
Sbjct: 7   SAATEGTNPLVPNPWEMGV--VLAGFAVLFYIVVKFVVPMFEKTFAERAEAIEGGIAKAE 64

Query: 67  SAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNE 126
            A+ E  + +  Y++ L  ARA A  I ++  A   Q L   +E    +     ++A  +
Sbjct: 65  KAQAEASAALEEYKQQLTDARAEANRIREEARAEGAQILADLKEKAAAESARITAHAHAQ 124

Query: 127 IDDMQKKASQEVYSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           I+  ++ A   + + VG +   L  ++       DA   +++DR    ++
Sbjct: 125 IESERQAAVVSLRAEVGTLATTLASRIVGESLSDDARAARVVDRFLADLE 174


>gi|312865390|ref|ZP_07725618.1| ATP synthase F0, B subunit [Streptococcus downei F0415]
 gi|311099501|gb|EFQ57717.1| ATP synthase F0, B subunit [Streptococcus downei F0415]
          Length = 165

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 63/163 (38%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                 ST L           + YW+   F   +++ I E R N I+ D +  ++A++E 
Sbjct: 1   MSILINSTTLGDIIITTGSVLVLYWLIRTFAWKQITGIFEERANKINQDIDDAENARQEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           + +    +E L  A+  A +IID                   ++      A  +I   + 
Sbjct: 61  QELAQKRQEQLNSAKDDAAKIIDDAKETGNAQSAKILAETRDEVSRLKEKANQDIAQNKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +A   V   V ++T  L  K+   ++  A   +++D+  D + 
Sbjct: 121 EALSSVKGDVADLTVLLAEKVMTKNLDKAAQSELIDQYLDQLG 163


>gi|320154854|ref|YP_004187233.1| ATP synthase subunit B [Vibrio vulnificus MO6-24/O]
 gi|319930166|gb|ADV85030.1| ATP synthase B chain [Vibrio vulnificus MO6-24/O]
          Length = 154

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 62/142 (43%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+   +  + A ++++   ++    L  A+ 
Sbjct: 9   AISFAMFVWFCMKYVWPPIMQAIEERQKKIADGLQAAERAAKDLDLAQANASSQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q L+  RE  + +    L+ A+ +++  + +A  E+   V  +   
Sbjct: 69  TATEIIEQANKRKAQILDEAREDAQTERQKILAQAEAQLEAERNRARDELRKQVATLAVA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 129 GAEKILERSIDKDAHKDILDNI 150


>gi|251791744|ref|YP_003006465.1| F0F1 ATP synthase subunit B [Dickeya zeae Ech1591]
 gi|247540365|gb|ACT08986.1| ATP synthase F0, B subunit [Dickeya zeae Ech1591]
          Length = 156

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+++    ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E +    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKQRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|226694487|sp|Q1DF98|ATPF_MYXXD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
          Length = 184

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  + F I   V        + S++E R   I+S  E     + E E +++  + 
Sbjct: 17  PGLIFWTLVTFVIAAVVLKWKAWGPILSLVEEREKQIASSIESAKRERAEAEKLLADQKT 76

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           ++A AR  A E++ +     E+  E       K+      +A+ EID+ + KA  EV S+
Sbjct: 77  AIAEARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKLSARREIDEQKAKAIAEVRSM 136

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
             ++  ++  KL    + D+  + + ++   G+ 
Sbjct: 137 AVDLAMEVAGKLISERMDDSKQRALAEQFVQGLP 170


>gi|56551565|ref|YP_162404.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241761303|ref|ZP_04759391.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|260752835|ref|YP_003225728.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|56543139|gb|AAV89293.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|241374210|gb|EER63707.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|258552198|gb|ACV75144.1| H+transporting two-sector ATPase B/B' subunit [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 166

 Score = 78.7 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/162 (23%), Positives = 77/162 (47%), Gaps = 3/162 (1%)

Query: 13  FPPFD--TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKR 70
            P      ST+ SQ FW+ ++FGI Y+   + +L ++ S M+ R + IS D    ++A +
Sbjct: 1   MPQIAQLASTYASQVFWMLVVFGIIYFGIAKTMLVKVESTMDSRDSKISDDLAAAEAAHK 60

Query: 71  EVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDM 130
             +    + +  LA  R+ A+  +      A ++   Q      D  H++ +A+  I D 
Sbjct: 61  AAKEADEACQSRLAKVRSEAQARLQAAKEQASKDASQQNAAANADYDHRIDSARMRIADE 120

Query: 131 QKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRD 171
           + K   ++ +I  ++  D+V+++ G SV    + K + +   
Sbjct: 121 KSKVMADLENIASDIAHDIVKQITGRSVPKEQITKAVAQVIS 162


>gi|332362652|gb|EGJ40450.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK49]
          Length = 164

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           SLA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  SLAGSREEAATIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVALASKILSQELDKEAQSELIDRYIKQLG 162


>gi|294143110|ref|YP_003559088.1| ATP synthase F0 subunit B [Shewanella violacea DSS12]
 gi|293329579|dbj|BAJ04310.1| ATP synthase F0, B subunit [Shewanella violacea DSS12]
          Length = 156

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F +F W   +F+ P L + +E R+  I+      D A +++E   +   + L 
Sbjct: 7   LIGQTVAFILFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A EII++      Q ++  +   + +    ++  Q EI+  + +  +++   V  
Sbjct: 67  EAKATANEIIEQANKRKAQIVDEAKAEADTERAKIIAQGQAEIEAERNRVKEDLRKQVAA 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   S+ +A    I+++    +
Sbjct: 127 LAIAGAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|294616245|ref|ZP_06696038.1| ATP synthase F0, B subunit [Enterococcus faecium E1636]
 gi|291590759|gb|EFF22475.1| ATP synthase F0, B subunit [Enterococcus faecium E1636]
          Length = 174

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 67/156 (42%), Gaps = 1/156 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
            L     ++  F I   +   F    +S I++ R + I++D +  + ++     M    E
Sbjct: 14  MLGNVIVVSGSFLILLALLKHFAWEPISDILKKREDKIANDLDSAEQSRINSAKMEQERE 73

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  +R+ A +II     + E + +   +  +++     S AQ +I   +  A   V  
Sbjct: 74  QQLLASRSDAADIIKNAKESGELSRQNILKDAQEEAARLKSKAQADITVERDSALNSVKD 133

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            V E++  +  K+    +S    + ++++  +G+ +
Sbjct: 134 DVAELSLQIAEKILNKELSPEMHESLINQYIEGLGS 169


>gi|78042703|ref|YP_361342.1| ATP synthase F0 subunit B [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123575369|sp|Q3A942|ATPF_CARHZ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77994818|gb|ABB13717.1| ATP synthase F0, B subunit [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 159

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           S F W  I F +  ++    +   +   +E R+  I    EK   A+ E E + + Y+  
Sbjct: 6   SDFIWTLINFFVLLFILKILLYKPVLKTIEDRKKSIEESLEKAAKAQEEAERIKAEYDGM 65

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A AR  A+EII K    A+   E      +++    L++A+  I   ++KA +E+   +
Sbjct: 66  IAKAREEAREIIAKAQKTAQAEKEEIIATAQREAQSLLADAKATIAQEKEKALRELRQEI 125

Query: 143 GEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           G +      K+   +V+  D QK++D   + + 
Sbjct: 126 GNLAVLAAGKILNRAVTLEDHQKLVDEFLNEVK 158


>gi|261420767|ref|YP_003254449.1| F0F1 ATP synthase subunit B [Geobacillus sp. Y412MC61]
 gi|297531562|ref|YP_003672837.1| ATP synthase F0 subunit beta [Geobacillus sp. C56-T3]
 gi|319768437|ref|YP_004133938.1| ATP synthase F0 subunit B [Geobacillus sp. Y412MC52]
 gi|261377224|gb|ACX79967.1| ATP synthase F0, B subunit [Geobacillus sp. Y412MC61]
 gi|297254814|gb|ADI28260.1| ATP synthase F0, B subunit [Geobacillus sp. C56-T3]
 gi|317113303|gb|ADU95795.1| ATP synthase F0, B subunit [Geobacillus sp. Y412MC52]
          Length = 178

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  ++F I   +  +F    L +IM+ R   I+++  + +  ++E E ++    E + 
Sbjct: 22  IIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIGQAEKRRQEAEKLLEEQRELMK 81

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A+ +I+     AE+  E        +       A+ EI+  +++A   +   V  
Sbjct: 82  QSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEAAKKEIEREKEQAMAALREQVAS 141

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           ++  +  K +   +++ D +K+++     +
Sbjct: 142 LSVLIASKVIEKELTEQDQRKLIEAYIKDV 171


>gi|212715315|ref|ZP_03323443.1| hypothetical protein BIFCAT_00208 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661772|gb|EEB22347.1| hypothetical protein BIFCAT_00208 [Bifidobacterium catenulatum DSM
           16992]
          Length = 173

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  +I  I     ++F LP+  ++ + R   I     K + A+++ +   + YE  L+
Sbjct: 18  IFWSLVILIIVAVFFYKFFLPKFQAVFDERAAKIEGGIAKAEQAQKDADEAKAKYEAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D     A   +   R   E D     + AQ  I+  Q++A   +   VG 
Sbjct: 78  KARVDASKIRDDARTEASHIIADARTRAESDAAQITATAQRSIESQQQQALVSLKGEVGV 137

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  S   +D     ++D+    +D+
Sbjct: 138 LATALAGKILGSKLENDDVQSSMIDQMIADMDS 170


>gi|37524076|ref|NP_927420.1| F0F1 ATP synthase subunit B [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81707841|sp|Q7NA90|ATPF_PHOLL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|36783499|emb|CAE12339.1| ATP synthase B chain [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 156

 Score = 78.3 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +F+ P + + +E R+  I+      + AK++++   ++  + + 
Sbjct: 7   ILGQAIAFVLFVMFCMKFVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQMK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKVEAQVIIEQANKQKAQILDDAKAEAEQERNRIVTQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|212712649|ref|ZP_03320777.1| hypothetical protein PROVALCAL_03744 [Providencia alcalifaciens DSM
           30120]
 gi|261346703|ref|ZP_05974347.1| ATP synthase F0, B subunit [Providencia rustigianii DSM 4541]
 gi|212684865|gb|EEB44393.1| hypothetical protein PROVALCAL_03744 [Providencia alcalifaciens DSM
           30120]
 gi|282565103|gb|EFB70638.1| ATP synthase F0, B subunit [Providencia rustigianii DSM 4541]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK+ +E   +   + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLELAQTDATDRLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKQRTQMIDEAKAEAEAERAKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|311898385|dbj|BAJ30793.1| putative ATP synthase subunit B [Kitasatospora setae KM-6054]
          Length = 185

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/170 (17%), Positives = 70/170 (41%), Gaps = 4/170 (2%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
               +  P   +    +     + F I + +  + +LP +  ++  RR+ I    ++ ++
Sbjct: 8   ASEEKMNPLLPAW--PEVIIGLLCFFIVFGLLGKKLLPSIEKVLGERRDAIEGGMKRAET 65

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
           A+ E ++++  Y   LA AR  A  I +         +   RE  ++     ++    +I
Sbjct: 66  AQAEAQALLEQYRAELAEARHEAARITEHAREQGAALINEMREEGQRQREAIVAAGHAQI 125

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +  +K+A+  +   VG +   L  ++        A    ++DR  D +++
Sbjct: 126 EADKKQATAVLRQDVGSLASQLASRIVGESLEDHARQSGVIDRFLDELES 175


>gi|225012514|ref|ZP_03702950.1| ATP synthase F0, B subunit [Flavobacteria bacterium MS024-2A]
 gi|225003491|gb|EEG41465.1| ATP synthase F0, B subunit [Flavobacteria bacterium MS024-2A]
          Length = 166

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 68/164 (41%), Gaps = 2/164 (1%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                    L  FFW ++IF   +++  +F    +   +  R   I       ++A+ E+
Sbjct: 1   MEKLIGEFSLGLFFWQSLIFIGLFFLLKKFAWKPILDAVNERETSIKDALASAEAARNEM 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ES+ S  +  L  ARA  + ++ +      + +   +E  + +    L+ AQ  I + ++
Sbjct: 61  ESLQSDNQRILKEARAEKETLLKEARITRSELINGAKEEAQMEAQKILAQAQEAIQNEKR 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
            A  E+   VG +  ++  K+      S+    +++++     +
Sbjct: 121 AAVIELREQVGSIAMEIAEKVLQKELESNDKQLQLVEQLLKDTN 164


>gi|324995407|gb|EGC27319.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK678]
          Length = 164

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F ++A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|323352618|ref|ZP_08087588.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
 gi|322121654|gb|EFX93400.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis VMC66]
          Length = 164

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F ++A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    E+
Sbjct: 9   IGNFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|239944297|ref|ZP_04696234.1| F0F1 ATP synthase subunit B [Streptomyces roseosporus NRRL 15998]
          Length = 175

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I ++V ++ +LP ++  ++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 21  LICFSIVFFVFYKKLLPAINKALDERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 80

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        ++  +   ++     ++    +I+  +K A+  +   VG++  D
Sbjct: 81  EAARLRQEAQEQGAVIIQEMKAEGQRQREEIIAAGHTQIEADRKAAASALRQDVGKLATD 140

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A     +DR  D ++A
Sbjct: 141 LAGKLVGESLQDHARQSGTVDRFLDELEA 169


>gi|238793098|ref|ZP_04636726.1| ATP synthase B chain [Yersinia intermedia ATCC 29909]
 gi|238727471|gb|EEQ18997.1| ATP synthase B chain [Yersinia intermedia ATCC 29909]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     ++I P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQASKRKAQILDEAKTEAEQERNKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|22128007|ref|NP_671430.1| F0F1 ATP synthase subunit B [Yersinia pestis KIM 10]
 gi|45443755|ref|NP_995294.1| F0F1 ATP synthase subunit B [Yersinia pestis biovar Microtus str.
           91001]
 gi|51598255|ref|YP_072446.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis IP 32953]
 gi|108810160|ref|YP_654076.1| F0F1 ATP synthase subunit B [Yersinia pestis Antiqua]
 gi|108814142|ref|YP_649909.1| F0F1 ATP synthase subunit B [Yersinia pestis Nepal516]
 gi|145601148|ref|YP_001165224.1| F0F1 ATP synthase subunit B [Yersinia pestis Pestoides F]
 gi|150260941|ref|ZP_01917669.1| ATP synthase subunit B protein [Yersinia pestis CA88-4125]
 gi|153949255|ref|YP_001403122.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis IP 31758]
 gi|162419287|ref|YP_001608476.1| F0F1 ATP synthase subunit B [Yersinia pestis Angola]
 gi|165926217|ref|ZP_02222049.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939951|ref|ZP_02228488.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009539|ref|ZP_02230437.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213226|ref|ZP_02239261.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401599|ref|ZP_02307093.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422830|ref|ZP_02314583.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425492|ref|ZP_02317245.1| ATP synthase F0, B subunit [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170026426|ref|YP_001722931.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis YPIII]
 gi|186897464|ref|YP_001874576.1| F0F1 ATP synthase subunit B [Yersinia pseudotuberculosis PB1/+]
 gi|218931101|ref|YP_002348976.1| F0F1 ATP synthase subunit B [Yersinia pestis CO92]
 gi|229839835|ref|ZP_04459994.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229841919|ref|ZP_04462075.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229896796|ref|ZP_04511959.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Pestoides A]
 gi|229904685|ref|ZP_04519796.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Nepal516]
 gi|270488395|ref|ZP_06205469.1| ATP synthase F0, B subunit [Yersinia pestis KIM D27]
 gi|294505648|ref|YP_003569710.1| ATP synthase subunit B [Yersinia pestis Z176003]
 gi|81638069|sp|Q663Q4|ATPF_YERPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122382403|sp|Q1C091|ATPF_YERPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122383972|sp|Q1CCH1|ATPF_YERPN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|123776434|sp|Q7CFM4|ATPF_YERPE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698362|sp|A7FPE4|ATPF_YERP3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698363|sp|B2K843|ATPF_YERPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698364|sp|A9R5U3|ATPF_YERPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698365|sp|A4TSI9|ATPF_YERPP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698366|sp|B1JRM8|ATPF_YERPY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|21961155|gb|AAM87681.1|AE014015_6 membrane-bound ATP synthase, F0 sector, subunit b [Yersinia pestis
           KIM 10]
 gi|45438625|gb|AAS64171.1| ATP synthase subunit B protein [Yersinia pestis biovar Microtus
           str. 91001]
 gi|51591537|emb|CAH23209.1| ATP synthase subunit B protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777790|gb|ABG20309.1| ATP synthase subunit B protein [Yersinia pestis Nepal516]
 gi|108782073|gb|ABG16131.1| ATP synthase subunit B protein [Yersinia pestis Antiqua]
 gi|115349712|emb|CAL22693.1| ATP synthase subunit B protein [Yersinia pestis CO92]
 gi|145212844|gb|ABP42251.1| ATP synthase subunit B protein [Yersinia pestis Pestoides F]
 gi|149290349|gb|EDM40426.1| ATP synthase subunit B protein [Yersinia pestis CA88-4125]
 gi|152960750|gb|ABS48211.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis IP 31758]
 gi|162352102|gb|ABX86050.1| ATP synthase F0, B subunit [Yersinia pestis Angola]
 gi|165912077|gb|EDR30717.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922077|gb|EDR39254.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991461|gb|EDR43762.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205524|gb|EDR50004.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958222|gb|EDR55243.1| ATP synthase F0, B subunit [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048981|gb|EDR60389.1| ATP synthase F0, B subunit [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055506|gb|EDR65299.1| ATP synthase F0, B subunit [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752960|gb|ACA70478.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis YPIII]
 gi|186700490|gb|ACC91119.1| ATP synthase F0, B subunit [Yersinia pseudotuberculosis PB1/+]
 gi|229678803|gb|EEO74908.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Nepal516]
 gi|229691258|gb|EEO83311.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696201|gb|EEO86248.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229700234|gb|EEO88270.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis Pestoides A]
 gi|262363813|gb|ACY60534.1| ATP synthase subunit B [Yersinia pestis D106004]
 gi|262367749|gb|ACY64306.1| ATP synthase subunit B [Yersinia pestis D182038]
 gi|270336899|gb|EFA47676.1| ATP synthase F0, B subunit [Yersinia pestis KIM D27]
 gi|294356107|gb|ADE66448.1| ATP synthase subunit B [Yersinia pestis Z176003]
 gi|320017460|gb|ADW01032.1| F0 sector of membrane-bound ATP synthase, subunit b [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|84393412|ref|ZP_00992169.1| ATP synthase subunit B [Vibrio splendidus 12B01]
 gi|84375928|gb|EAP92818.1| ATP synthase subunit B [Vibrio splendidus 12B01]
          Length = 154

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 60/134 (44%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+      + A +++    ++  E +  A+ 
Sbjct: 9   AIAFSLFVWFCMKYVWPPIMQAIEERQKKIADGLVAAERAAKDLNLAQANASEQMKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+ID+      Q ++  RE  + +    L+ A+ EI+  + +A  ++   V  +   
Sbjct: 69  TATEVIDQANKRKAQIIDEAREEAQAERQKILTQAEAEIEAERTRARDDLRKQVATLAIA 128

Query: 149 LVRKLGFSVSDADV 162
              K+     D DV
Sbjct: 129 GAEKILERTIDKDV 142


>gi|156936116|ref|YP_001440032.1| F0F1 ATP synthase subunit B [Cronobacter sakazakii ATCC BAA-894]
 gi|260595798|ref|YP_003208369.1| F0F1 ATP synthase subunit B [Cronobacter turicensis z3032]
 gi|226741448|sp|A7MMX3|ATPF_ENTS8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|156534370|gb|ABU79196.1| hypothetical protein ESA_04010 [Cronobacter sakazakii ATCC BAA-894]
 gi|260214975|emb|CBA26606.1| ATP synthase subunit b [Cronobacter turicensis z3032]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK+++E   S+  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLELAQSNATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRAQILDEAKAEAEQERNKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+++    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVNKLVAEL 156


>gi|300719166|ref|YP_003743969.1| ATP synthase, F0 complex, b subunit [Erwinia billingiae Eb661]
 gi|299065002|emb|CAX62122.1| ATP synthase, F0 complex, b subunit [Erwinia billingiae Eb661]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  ++      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVLFCMKYVWPPLMAAIEKRQKEVAEGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKEEAQVIIEQANKRRSQILDEVKAEAEQERNKIVTQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|56421897|ref|YP_149215.1| F0F1 ATP synthase subunit B [Geobacillus kaustophilus HTA426]
 gi|81346273|sp|Q5KUI9|ATPF_GEOKA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56381739|dbj|BAD77647.1| F0F1-type ATP synthaseB chain [Geobacillus kaustophilus HTA426]
          Length = 177

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 67/150 (44%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  ++F I   +  +F    L +IM+ R   I+++ ++ +  ++E E ++    E + 
Sbjct: 21  IIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEIDQAEKRRQEAEKLLEEQRELMK 80

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A+ +I+     AE+  E        +       A+ EI+  +++A   +   V  
Sbjct: 81  QSRQEAQALIENARKLAEEQKEQIVASARAEAERVKEVAKKEIEREKEQAMAALREQVAS 140

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           ++  +  K +   +++ D +K+++     +
Sbjct: 141 LSVLIASKVIEKELTEQDQRKLIEAYIKDV 170


>gi|320539765|ref|ZP_08039426.1| F0 sector of membrane-bound ATP synthase, subunit b [Serratia
           symbiotica str. Tucson]
 gi|320030168|gb|EFW12186.1| F0 sector of membrane-bound ATP synthase, subunit b [Serratia
           symbiotica str. Tucson]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLDLAQANAADHLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ +I++      Q ++  +   E++    ++ AQ EI+   K+A +E+   V  
Sbjct: 67  TAKAEAQALIEQANKRKAQIMDEAKAEAEQERNKIVAQAQTEIEAECKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIACAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|258593692|emb|CBE70033.1| putative Sodium-transporting two-sector ATPase [NC10 bacterium
           'Dutch sediment']
          Length = 201

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 67/172 (38%), Gaps = 1/172 (0%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           ++ +                     + F I   V ++F+   L+  +  R + I    E+
Sbjct: 28  AAEEAHGGGEQPGIINLNMTLLVQVVNFLILIAVLYKFLFTPLTQFLATRADGIKRSLEE 87

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
             +A+         YE  +   R  A  + +  +   E+  +   +V  ++    ++ A+
Sbjct: 88  AKAAREAAAQTQKEYEAQILATRREAAAMRESAIREVEEERQRLLKVSREEATRLVTEAK 147

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
            +I+   K+A  E+ + V  ++  +  + +  S++  D +++ ++    I +
Sbjct: 148 AQIEQEVKRAKAELRAEVVGLSLGVAERVIARSLTTDDHRRLAEQVVAEIGS 199


>gi|326797432|ref|YP_004315252.1| ATP synthase subunit b [Marinomonas mediterranea MMB-1]
 gi|326548196|gb|ADZ93416.1| ATP synthase subunit b [Marinomonas mediterranea MMB-1]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF W   +++ P + + +E R   I+   E  + A R++E       ++L 
Sbjct: 7   LIGQAISFAIFVWFCMKYVWPPIIAALEERSKKIADGLEAANRASRDLELAQEKATQTLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ++  A EII++    A Q ++  +E    +       AQ EI+    +A + + + V  
Sbjct: 67  ESKEQAAEIIEQANKRANQIVDEAKEQAIAEGQRLREAAQAEIEQDVMRAKEALRAQVSA 126

Query: 145 VTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
           +      K+ G SV +    +I+++    +
Sbjct: 127 LALTGAEKILGASVDEKAHSEIVEQLAKEL 156


>gi|307133307|ref|YP_003885323.1| F0 sector of membrane-bound ATP synthase, subunit b [Dickeya
           dadantii 3937]
 gi|306530836|gb|ADN00767.1| F0 sector of membrane-bound ATP synthase, subunit b [Dickeya
           dadantii 3937]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P + + +E R+  I+      + AK+++    ++  + L 
Sbjct: 7   ILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQKEIADGLASAERAKKDLNLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E +    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQASKQRAQILDEAKAEAEAERNKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|327473285|gb|EGF18705.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK408]
          Length = 164

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 68/154 (44%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F ++A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E++    EE
Sbjct: 9   IGNFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEALAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSREEAATIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|125975087|ref|YP_001038997.1| ATP synthase F0, B subunit [Clostridium thermocellum ATCC 27405]
 gi|256003259|ref|ZP_05428251.1| ATP synthase F0, B subunit [Clostridium thermocellum DSM 2360]
 gi|281418495|ref|ZP_06249514.1| ATP synthase F0, B subunit [Clostridium thermocellum JW20]
 gi|226741417|sp|A3DIM5|ATPF_CLOTH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125715312|gb|ABN53804.1| ATP synthase F0 subcomplex B subunit [Clostridium thermocellum ATCC
           27405]
 gi|255992950|gb|EEU03040.1| ATP synthase F0, B subunit [Clostridium thermocellum DSM 2360]
 gi|281407579|gb|EFB37838.1| ATP synthase F0, B subunit [Clostridium thermocellum JW20]
 gi|316939252|gb|ADU73286.1| ATP synthase F0, B subunit [Clostridium thermocellum DSM 1313]
          Length = 181

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/152 (22%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F + A+   I Y++  R +   +   ME R+N I+   EK +  K E   + + YE 
Sbjct: 26  IPTFIYTALNLVILYFILKRLLFKPVWEFMENRKNSIAESMEKAEKGKAEALELKNKYES 85

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A A A++I+ +    A+Q  E      + +       A+ EI+  + +A +E+ + 
Sbjct: 86  ELNEAYAKAQKILKEAEEKAKQEYERIIRDAKNEAEALKLKAKEEIEREKNEALKEIRNE 145

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDG 172
           V  +  +   K+   ++   + +K+++R  D 
Sbjct: 146 VVSLALEAASKVLEANMDTEENRKLVNRFIDE 177


>gi|329888298|ref|ZP_08266896.1| ATP synthase B/B' CF0 family protein [Brevundimonas diminuta ATCC
           11568]
 gi|328846854|gb|EGF96416.1| ATP synthase B/B' CF0 family protein [Brevundimonas diminuta ATCC
           11568]
          Length = 190

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 63/166 (37%), Gaps = 1/166 (0%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
            +S    SS  P  +   +  Q  +L I+F + Y +  +   PRL  +M+ R   I S  
Sbjct: 22  HASVEHGSSGLPQLEFQHWAGQIGYLLILFVVLYVLVAKVFAPRLRKVMDERAETIDSAV 81

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
               S + E  +   +    +  ARA A+           +    +    E  +  +++ 
Sbjct: 82  AAARSVQTEAAAQAEAARAEVEKARADARATAVAAKQRVTEEFNARLAADEAVVNARIAE 141

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILD 167
           A+  I   +  A   V  I  +    ++ +L G   SDA++   + 
Sbjct: 142 AEGAIAKTRDAAMANVTIIASDAAGAMLERLTGSKASDAELAAAIK 187


>gi|167463131|ref|ZP_02328220.1| hypothetical protein Plarl_11311 [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 164

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 71/158 (44%), Gaps = 2/158 (1%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
             + S  F     F I YW+ +++    L  IME R  L+    +  ++ + + E +++ 
Sbjct: 3   WHWESFVF-AIFAFAILYWLLNKYAFGPLFGIMEKRAELVQEQLKSAETNRTQAEQLVAE 61

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +E++  AR  A  I+++   A+ +  E      ++D       A  +I+  + KA   +
Sbjct: 62  QKEAIQEARKDAYNIVEQAKQASTRQAEEIVHKAKEDASRIKEEAVRDIESEKNKAIAAL 121

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
              VG+++  +  K L   V   + QK++++    ++ 
Sbjct: 122 REQVGDMSVLIASKVLEKEVDAGEQQKLVNQYLKEVEG 159


>gi|238783018|ref|ZP_04627045.1| ATP synthase B chain [Yersinia bercovieri ATCC 43970]
 gi|238716019|gb|EEQ08004.1| ATP synthase B chain [Yersinia bercovieri ATCC 43970]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     ++I P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKVEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|53713465|ref|YP_099457.1| ATP synthase B subunit [Bacteroides fragilis YCH46]
 gi|60681711|ref|YP_211855.1| putative ATP synthase B chain [Bacteroides fragilis NCTC 9343]
 gi|253565453|ref|ZP_04842908.1| ATP synthase B subunit [Bacteroides sp. 3_2_5]
 gi|265763732|ref|ZP_06092300.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_16]
 gi|81315224|sp|Q5LD84|ATPF_BACFN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81690679|sp|Q64UA6|ATPF_BACFR RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|52216330|dbj|BAD48923.1| ATP synthase B subunit [Bacteroides fragilis YCH46]
 gi|60493145|emb|CAH07926.1| putative ATP synthase B chain [Bacteroides fragilis NCTC 9343]
 gi|251945732|gb|EES86139.1| ATP synthase B subunit [Bacteroides sp. 3_2_5]
 gi|263256340|gb|EEZ27686.1| ATP synthase F0, B subunit [Bacteroides sp. 2_1_16]
 gi|301163254|emb|CBW22804.1| putative ATP synthase B chain [Bacteroides fragilis 638R]
          Length = 165

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 29/153 (18%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + V  ++  P +  ++E R+  I    E    A  ++  +    E  
Sbjct: 9   GLIFWMLLSFGIVFAVLAKYGFPVIIKMVEGRKTYIDESLEVAREANAQLSRLKEEGEAI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   E+ +   R+  E     +L   + +I   + +A +++   V
Sbjct: 69  VAAANKEQGRIMKEAMQEREKIIYEARKQAEIAAQKELDEVKRQIQIEKDEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGI 173
             ++ D+  K+     D   ++  ++DR  D +
Sbjct: 129 ALLSVDIAEKVIRKNLDDKQEQMGMIDRMLDEV 161


>gi|87121033|ref|ZP_01076924.1| ATP synthase subunit B [Marinomonas sp. MED121]
 gi|86163525|gb|EAQ64799.1| ATP synthase subunit B [Marinomonas sp. MED121]
          Length = 156

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F  F W   +F+ P + + +E R   I+   E  + A R++E        +L 
Sbjct: 7   LIGQAISFAFFVWFCMKFVWPPVIAALEERSKKIADGLEAANRASRDLELAQEKATHTLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ++  A EII++    A Q ++  +E    D       A +EI+    +A + + + V +
Sbjct: 67  ESKEQAAEIIEQANKRANQIIDEAKEQALADGQRLRDAANSEIEQDVIRAKEALRAQVSQ 126

Query: 145 VTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
           +      K+ G SV +    +++++    +
Sbjct: 127 LALIGAEKILGASVDEKAHSELVEKLAQEL 156


>gi|281420261|ref|ZP_06251260.1| ATP synthase F0, B subunit [Prevotella copri DSM 18205]
 gi|281405756|gb|EFB36436.1| ATP synthase F0, B subunit [Prevotella copri DSM 18205]
          Length = 166

 Score = 78.3 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 68/155 (43%), Gaps = 2/155 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F I + +  +   P +  ++  R+  I    +K   A  ++ ++    E  
Sbjct: 9   GLLFWMTLVFIIVFIILWKAGFPAIIKMVNERKAFIDDSLKKAHEANEKLANIQKEGESI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR     ++ +     +  +E  ++   ++    LS+A+ +I+  ++ A +E+   V
Sbjct: 69  LQEAREKQAALLKEAAETRDAIVEKAQDKAREEGARLLSDAKKQIETEKQNAIREIRGQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
            E++  +  K+  +    D     +++R  D + +
Sbjct: 129 AELSVQIAEKVLKAKLSDDKAQMDMINRLLDEVSS 163


>gi|183602784|ref|ZP_02964147.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219683120|ref|YP_002469503.1| ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241191449|ref|YP_002968843.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196855|ref|YP_002970410.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|45593088|gb|AAS68132.1| ATP synthase B subunit [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|183218022|gb|EDT88670.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620770|gb|ACL28927.1| ATP synthase F0, B subunit [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240249841|gb|ACS46781.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240251409|gb|ACS48348.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|289177575|gb|ADC84821.1| ATP synthase B chain [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295794442|gb|ADG33977.1| F0F1 ATP synthase subunit B [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 175

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 39/152 (25%), Positives = 68/152 (44%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     ++F LP+  S+ + R   I     K + A+++ E     Y+  L+
Sbjct: 18  IVWSLIILIIVALFFYKFFLPKFQSVFDERTAKIEGGLAKAEQAQKDAEEAKKKYQAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E +     +NA+  ++  Q+KA   +   VG 
Sbjct: 78  TARVEASKIRDDARAEASHIIADARSRAETEAAQITANAERSLESQQQKAMVNLKGEVGS 137

Query: 145 VTKDLVRK-LGFSVSDADVQ-KILDRKRDGID 174
           +   L  K LG  + D+ VQ +++D+    ++
Sbjct: 138 LATSLASKILGSELQDSAVQTQMIDQMLADME 169


>gi|157827895|ref|YP_001494137.1| F0F1 ATP synthase subunit B' [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932583|ref|YP_001649372.1| F0F1 ATP synthase subunit B' [Rickettsia rickettsii str. Iowa]
 gi|157800376|gb|ABV75629.1| F0F1 ATP synthase subunit B' [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907670|gb|ABY71966.1| ATP synthase B' chain [Rickettsia rickettsii str. Iowa]
          Length = 157

 Score = 77.9 bits (190), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 70/147 (47%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + FG+ Y   ++FI P+   I   R+  I  +  + D+   EV
Sbjct: 1   MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTIEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +    A    +  + + + E     +++  E+DL + ++    +I+   K
Sbjct: 61  EKLNKYYNEEIDKTNAEIDRLTKEKIDSLESEFLIKKKNLEQDLKNAINQNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSD 159
           +      + + ++  +++ K+  + +D
Sbjct: 121 QFRTNKSAAIIKLAVNIIEKIVDTKAD 147


>gi|123444377|ref|YP_001008342.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238759554|ref|ZP_04620716.1| ATP synthase B chain [Yersinia aldovae ATCC 35236]
 gi|238765111|ref|ZP_04626045.1| ATP synthase B chain [Yersinia kristensenii ATCC 33638]
 gi|238787866|ref|ZP_04631663.1| ATP synthase B chain [Yersinia frederiksenii ATCC 33641]
 gi|332163554|ref|YP_004300131.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|226698361|sp|A1JTD1|ATPF_YERE8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122091338|emb|CAL14224.1| ATP synthase subunit B protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238696663|gb|EEP89446.1| ATP synthase B chain [Yersinia kristensenii ATCC 33638]
 gi|238702213|gb|EEP94768.1| ATP synthase B chain [Yersinia aldovae ATCC 35236]
 gi|238724209|gb|EEQ15852.1| ATP synthase B chain [Yersinia frederiksenii ATCC 33641]
 gi|318608061|emb|CBY29559.1| ATP synthase B chain [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|325667784|gb|ADZ44428.1| F0F1 ATP synthase subunit B [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861784|emb|CBX71957.1| ATP synthase subunit b [Yersinia enterocolitica W22703]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     ++I P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYIWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|255020237|ref|ZP_05292306.1| ATP synthase B chain [Acidithiobacillus caldus ATCC 51756]
 gi|254970379|gb|EET27872.1| ATP synthase B chain [Acidithiobacillus caldus ATCC 51756]
          Length = 159

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/159 (20%), Positives = 61/159 (38%), Gaps = 1/159 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +            I F I   + ++++   L  IM+ RR  IS      +  K E+   
Sbjct: 1   MNPVAINGTLIIQLITFAILVVLLYKYLYGPLRKIMDERRAKISDGLAAAERGKEELALA 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
               E+ L  A+  A EII      A +  E  +    ++    ++ A+ EI+    +A 
Sbjct: 61  QKRAEQILRDAKDKAAEIIASAERRAVEMREEAQVKAREEADRIIAGARAEIEVETNRAR 120

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
           + +   V E+  D  R++    +     + ILDR    +
Sbjct: 121 EVLRGQVVELVVDGTRRILHREIDSNAHRDILDRVVGEL 159


>gi|261367329|ref|ZP_05980212.1| ATP synthase F0, B subunit [Subdoligranulum variabile DSM 15176]
 gi|282570087|gb|EFB75622.1| ATP synthase F0, B subunit [Subdoligranulum variabile DSM 15176]
          Length = 168

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 67/162 (41%), Gaps = 5/162 (3%)

Query: 18  TSTFLSQFFWLAI----IFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVE 73
             +F+    W A+       I + V   F+   +  +++ R+  I +   +   AK++  
Sbjct: 4   FESFVGVNPWTALFTFCNMLITFAVLRHFLFKPVKRMIDDRQQEIDNMYAEAADAKQKAA 63

Query: 74  SMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKK 133
            +   Y+  L   +A   +++ +    A++  E        +     + A+ E+   +KK
Sbjct: 64  DLEKEYQAHLQSIKAEQDDMLREATTRAQKREEEIVNAARAEAQALRNAAEAEMAQERKK 123

Query: 134 ASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
           A  ++ + +G +  ++  K+    ++ AD Q ++D     + 
Sbjct: 124 AVNDLKNEIGGIAVEIASKVVEREINTADHQALIDEFIRNVG 165


>gi|227495025|ref|ZP_03925341.1| F family two-sector ATPase, F(1) beta subunit [Actinomyces
           coleocanis DSM 15436]
 gi|226831477|gb|EEH63860.1| F family two-sector ATPase, F(1) beta subunit [Actinomyces
           coleocanis DSM 15436]
          Length = 183

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 37/152 (24%), Positives = 65/152 (42%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            FW  I   I   V ++++LP+ +++++ R   I+   E  D AK          EE+L 
Sbjct: 24  IFWQVIALAIIALVMYKYVLPKFNAVLDEREQRIAEGLEASDRAKEAEALAKRHAEEALQ 83

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A   A +I       A++ +   R   E D    L NAQ +I   ++ A   + S +G 
Sbjct: 84  AAHVEAGKIRSNATEDAKKIIAKARREAEADAARILENAQRQILAERQAAEISLKSEIGI 143

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           +  +L  K+            +++DR  D +D
Sbjct: 144 LATELAEKIVGEHLKDTELTARVVDRFLDDLD 175


>gi|284007077|emb|CBA72352.1| F0F1 ATP synthase subunit B [Arsenophonus nasoniae]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK+ ++   +   E L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKNLDLAKADATERLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q +E  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKAEAQIIIEQANKQRVQMIEEAKAEAEIERNKIVTQAQIEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV  A    I+D+  + +
Sbjct: 127 LAISGAEKIIERSVDVAANSDIVDKLVNEL 156


>gi|15891948|ref|NP_359662.1| F0F1 ATP synthase subunit B' [Rickettsia conorii str. Malish 7]
 gi|238650338|ref|YP_002916190.1| F0F1 ATP synthase subunit B' [Rickettsia peacockii str. Rustic]
 gi|15619059|gb|AAL02563.1| ATP synthase B chain [Rickettsia conorii str. Malish 7]
 gi|238624436|gb|ACR47142.1| F0F1 ATP synthase subunit B' [Rickettsia peacockii str. Rustic]
          Length = 157

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 70/147 (47%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + FG+ Y   ++FI P+   I   R+  I  +  + D+   EV
Sbjct: 1   MPQFDIATYYSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTIEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +    A    +  + + + E     +++  E+DL + ++    +I+   K
Sbjct: 61  EKLNKYYNEEIDKTNAEIDRLKKEKIDSLESEFLIKKKNLEQDLKNAINQNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSD 159
           +      + + ++  +++ K+  + +D
Sbjct: 121 QFRTNKSAAIIKLAVNIIEKIAGTKAD 147


>gi|228474878|ref|ZP_04059607.1| ATP synthase F0, B subunit [Staphylococcus hominis SK119]
 gi|314935944|ref|ZP_07843294.1| ATP synthase F0, B subunit [Staphylococcus hominis subsp. hominis
           C80]
 gi|228271110|gb|EEK12490.1| ATP synthase F0, B subunit [Staphylococcus hominis SK119]
 gi|313655950|gb|EFS19692.1| ATP synthase F0, B subunit [Staphylococcus hominis subsp. hominis
           C80]
          Length = 176

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 60/139 (43%), Gaps = 1/139 (0%)

Query: 35  FYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEII 94
              +  +F    L  +M+ R   I+ D ++ + AK   + +    +++L   +     I+
Sbjct: 34  LLALLKKFAWGPLKEVMDKRERDINRDIDEAEEAKLNAQKLEEENKKTLKETQDEVHHIL 93

Query: 95  DKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-L 153
           +     A +  E   +   +     +  AQ+EI   +++A  ++ + V E++  +  K L
Sbjct: 94  EDARIQARKQHEEIIKDAHERANGMIETAQSEIKSEKERALADINNQVSELSVLIASKVL 153

Query: 154 GFSVSDADVQKILDRKRDG 172
              +S+ D + ++D+    
Sbjct: 154 QKEISEQDQKGLVDKYLKE 172


>gi|254387514|ref|ZP_05002753.1| F0F1 ATP synthase subunit B [Streptomyces clavuligerus ATCC 27064]
 gi|294815099|ref|ZP_06773742.1| ATP synthase B chain [Streptomyces clavuligerus ATCC 27064]
 gi|326443461|ref|ZP_08218195.1| F0F1 ATP synthase subunit B [Streptomyces clavuligerus ATCC 27064]
 gi|197701240|gb|EDY47052.1| F0F1 ATP synthase subunit B [Streptomyces clavuligerus ATCC 27064]
 gi|294327698|gb|EFG09341.1| ATP synthase B chain [Streptomyces clavuligerus ATCC 27064]
          Length = 181

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 38/177 (21%), Positives = 74/177 (41%), Gaps = 8/177 (4%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +  +++ +     P  D      +     I F I ++   + +LP ++ ++E RR  I  
Sbjct: 5   LTIAAAEEQPPLIPHLD------ELIVGLIAFAIVFFFLAKKLLPNINKVLEERREAIEG 58

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             EK + AK E ES++  Y+  LA AR  A  +  +        +   +   ++     +
Sbjct: 59  GMEKAEEAKTEAESVLEQYKAQLAEARHEAARLRQEATEQGTAIIAEMKAEGQRQREEII 118

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +    +I+  +K AS  +   VG++  DL  KL        A   + +DR  D ++ 
Sbjct: 119 AAGHAQIEADRKAASAALRQDVGKLATDLAGKLVGESLEDHARQSRTIDRFLDELEQ 175


>gi|157964086|ref|YP_001498910.1| F0F1 ATP synthase subunit B' [Rickettsia massiliae MTU5]
 gi|157843862|gb|ABV84363.1| ATP synthase B chain [Rickettsia massiliae MTU5]
          Length = 157

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 69/147 (46%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + FG+ Y   ++FI P+   I   R+  I  +  + D+   EV
Sbjct: 1   MPQFDIATYHSQIFWLIVTFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTIEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +         +  + + + E     +++  E+DL + ++    +I+   K
Sbjct: 61  EKLNKYYNEEIDKTNTEIDRLKKEKIDSLESEFLIKKKNLEQDLKNAINQNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSD 159
           +      + + ++  +++ K+  + +D
Sbjct: 121 QFRTNKSAAIIKLAVNIIEKITGTKAD 147


>gi|153833314|ref|ZP_01985981.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
 gi|156977322|ref|YP_001448228.1| ATP synthase B chain [Vibrio harveyi ATCC BAA-1116]
 gi|226694400|sp|A7N2U5|ATPF2_VIBHB RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|148870450|gb|EDL69371.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
 gi|156528916|gb|ABU74001.1| hypothetical protein VIBHAR_06108 [Vibrio harveyi ATCC BAA-1116]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 75/149 (50%), Gaps = 1/149 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           F  AI F IF W+  +++ P L  +++ RR  I+   E+ + A +E+E   ++ E  L  
Sbjct: 8   FGQAISFVIFVWLCMKYVWPPLVKLLDERRAEIAQGLEQTEKAAQELELAKANGEALLTE 67

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           AR+ A+ II++     EQ +    ++  ++    ++  + E++  + K  QE+   + ++
Sbjct: 68  ARSKAQAIINQGKQRQEQMVAEAVDLANQEKARIVAEGKAEVESERSKVRQELKDEMADL 127

Query: 146 TKDLVRKLG-FSVSDADVQKILDRKRDGI 173
             +   KL   ++  +  + +++R  + +
Sbjct: 128 VIESASKLINRNLDSSANRDLVNRFINEM 156


>gi|157964055|ref|YP_001504089.1| F0F1 ATP synthase subunit B [Shewanella pealeana ATCC 700345]
 gi|226694914|sp|A8HAG7|ATPF_SHEPA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|157849055|gb|ABV89554.1| ATP synthase F0, B subunit [Shewanella pealeana ATCC 700345]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +F+ P L + +E R+  I+        A +++E       E L  A+A
Sbjct: 11  AISFLLFVWFCMKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQVKATEQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q ++  +   + +    ++    EI++ + +  +++   V  +   
Sbjct: 71  TANEIIEQANKRKAQIVDEAKVEADTERAKIIAQGHAEIENERNRVKEDLRKQVAILAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+ +A    I+++    +
Sbjct: 131 GAEKILERSIDEAAHSDIVNKLVAEL 156


>gi|292490164|ref|YP_003533059.1| ATP synthase subunit B protein [Erwinia amylovora CFBP1430]
 gi|292901166|ref|YP_003540535.1| ATP synthase subunit B protein [Erwinia amylovora ATCC 49946]
 gi|291201014|emb|CBJ48153.1| ATP synthase subunit B protein [Erwinia amylovora ATCC 49946]
 gi|291555606|emb|CBA24228.1| ATP synthase subunit B protein [Erwinia amylovora CFBP1430]
 gi|312174357|emb|CBX82610.1| ATP synthase subunit B protein [Erwinia amylovora ATCC BAA-2158]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  ++      + A+++++   +S  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERARKDLDLAQASATDRLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKDDAQVIIEQANKRRAQILDEAKAEAEQERNKIVTQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|49080382|gb|AAT50011.1| PA5558 [synthetic construct]
          Length = 157

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EI+++    A Q ++  R+    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTG 131

Query: 150 VRK-LGFSVSDADVQKILDRKRDGID 174
             K LG S+     ++++ +    I 
Sbjct: 132 AEKILGASIDANAHEQLVSKLAAEIG 157


>gi|312891279|ref|ZP_07750798.1| ATP synthase F0 subcomplex B subunit [Mucilaginibacter paludis DSM
           18603]
 gi|311296239|gb|EFQ73389.1| ATP synthase F0 subcomplex B subunit [Mucilaginibacter paludis DSM
           18603]
          Length = 165

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 68/155 (43%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW ++ F I +++  +F    + S ++ R   I     K ++AK E+  +    E+
Sbjct: 9   IGLVFWTSVAFLILFFLLAKFAWKPIMSAIDERERSIEDALLKAEAAKEEMARLTDENEK 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  ARA    I+ +     +Q +   +E  +K+    L  A+ EID+ +  A  +V ++
Sbjct: 69  LLKQARAERDLILREAKHLKDQIVSEAKESAQKEGAKMLEKARIEIDNQKAIAMADVKNL 128

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V E++ ++  K+            +++      + 
Sbjct: 129 VAELSIEIAEKVLRKQFEKADKQDELVADLLKQVK 163


>gi|302392951|ref|YP_003828771.1| ATP synthase F0 subunit B [Acetohalobium arabaticum DSM 5501]
 gi|302205028|gb|ADL13706.1| ATP synthase F0, B subunit [Acetohalobium arabaticum DSM 5501]
          Length = 167

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 75/152 (49%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
           FF+  I F   + +   F+   +++ M  R   IS   E+ +  + + E + S Y++ L 
Sbjct: 8   FFFQVINFIALFLILRHFLFEPITNFMNQRSEDISDQIEEAEKKEAKAEELKSKYKQELK 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+EII++     ++         +++   ++  A++EI+  ++KA +++     +
Sbjct: 68  EAKQKAQEIIEEGRRRGQRKKNDIINEAKEEASRQIQKAEDEIERAKQKAREKLKDEALD 127

Query: 145 VTKDLVRKLGFSVSDAD-VQKILDRKRDGIDA 175
           ++ D+ +K+   + D +  ++ ++   + +D 
Sbjct: 128 LSVDMTKKVVDQMIDKELQEQTINNYLENLDE 159


>gi|120437592|ref|YP_863278.1| ATP synthase subunit B [Gramella forsetii KT0803]
 gi|226741463|sp|A0M6G6|ATPF_GRAFK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117579742|emb|CAL68211.1| ATP synthase subunit B [Gramella forsetii KT0803]
          Length = 164

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/153 (16%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  FFW  I+F I  ++  +F    +   +  R   I+      + A++E++++ S  E+
Sbjct: 8   IGLFFWQTIVFLILLFLMAKFAWKPILGSVRNREQSINDALASAEKARKEMQNLQSDNEQ 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  ARA    I+ +     E+ +    +  +      +++A+  I+  ++ A  E+ + 
Sbjct: 68  LLKEARAERDAILKEARELKEKVITDASDEAKVKADKIVADAKRSIELEKQSAMAELKNH 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDG 172
           V E++ ++  K+         +  +++++    
Sbjct: 128 VAELSVEIAEKIVRKELSGKNEQHQMIEKMIGD 160


>gi|303231202|ref|ZP_07317940.1| ATP synthase F0, B subunit [Veillonella atypica ACS-049-V-Sch6]
 gi|302514109|gb|EFL56113.1| ATP synthase F0, B subunit [Veillonella atypica ACS-049-V-Sch6]
          Length = 165

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 66/155 (42%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L S+M+ R+  I+ D      A+ E E   + Y  
Sbjct: 6   LGTILAQMLNFFILVWILARFAYKPLVSMMQERKERIAKDLADAQVARNEAEQFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +A AR  A++I++K V  AE     Q     + +  +   A+ +I + + +A   + + 
Sbjct: 66  QIANARQEAQQIVEKAVQQAEATTREQLAAAREQIEREKERARQDIVNERDRAMNNLRNE 125

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K +   +      K+++     +D+
Sbjct: 126 VISLSVAMATKVVAKDMDSETNTKLIEDAIAKLDS 160


>gi|111225284|ref|YP_716078.1| F0F1 ATP synthase subunit B [Frankia alni ACN14a]
 gi|122953769|sp|Q0RDB0|ATPF_FRAAA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|111152816|emb|CAJ64560.1| ATP synthase B chain (Subunit I) [Frankia alni ACN14a]
          Length = 198

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 68/173 (39%), Gaps = 8/173 (4%)

Query: 4   SSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63
           S  SD +   PP       S+     + FG+        I P+++     R   I     
Sbjct: 14  SGHSDENVLIPPL------SELLIGTLAFGLLVAFFFWKIRPQIARTYAQRTERIEGGIA 67

Query: 64  KMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNA 123
           + ++A+RE ++++  Y   L  ARA A  I D       Q +E  R   ++++      A
Sbjct: 68  RAEAAQREAQALLEQYRAQLTEARAEAARIRDDAHTEGRQIVEELRASAQREIAEIKERA 127

Query: 124 QNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDA--DVQKILDRKRDGID 174
             ++   + +   +V   VG +  DL  K+     ++     +++D     +D
Sbjct: 128 DAQLAADRAQIVAQVRREVGVIAIDLASKIVGYQVESTATQARLVDDFIAALD 180


>gi|91206107|ref|YP_538462.1| F0F1 ATP synthase subunit B' [Rickettsia bellii RML369-C]
 gi|157826460|ref|YP_001495524.1| F0F1 ATP synthase subunit B' [Rickettsia bellii OSU 85-389]
 gi|91069651|gb|ABE05373.1| ATP synthase B chain [Rickettsia bellii RML369-C]
 gi|157801764|gb|ABV78487.1| F0F1 ATP synthase subunit B' [Rickettsia bellii OSU 85-389]
          Length = 157

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 69/155 (44%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + F + Y   ++FI+P++  ++  R++ I  +  K D    E+
Sbjct: 1   MPQFDINTYYSQIFWLIVTFSLLYIFVYKFIVPKIERVLNNRQSNIQDNIAKADELALEI 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +         +  + + + E     ++   E++L   ++    +I  + +
Sbjct: 61  EKLNKYYNEEITRISTEIDRLKKEKIDSLEAEFLIKKTNLEQNLRKLINQNIKDIKLVAE 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILD 167
           K           +   ++ K+  + +D ++ K + 
Sbjct: 121 KFRTSKVDATIMLAASIIEKITGTKADINLLKNIK 155


>gi|320008540|gb|ADW03390.1| ATP synthase F0, B subunit [Streptomyces flavogriseus ATCC 33331]
          Length = 181

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 67/156 (42%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           + +     I F I +    + +LP ++ ++E RR  I    EK D+A+ E +S++  Y+ 
Sbjct: 20  VPEIVIGLIAFAIVFGFLAKKLLPNINKVLEERREAIEGGIEKADAAQTEAQSVLEQYKA 79

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR  A  +  +        ++  R   ++     ++    +I+  +K A+  +   
Sbjct: 80  QLAEARHEAARLRQEAQEQGAVIIQEMRAEGQRQREEIIAAGHAQIEADRKAAASALRQD 139

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           VG +   L  KL        A     +DR  D ++A
Sbjct: 140 VGSLATALAGKLVGESLEDHARQSGTVDRFLDELEA 175


>gi|146309624|ref|YP_001190089.1| ATP synthase F0, B subunit [Pseudomonas mendocina ymp]
 gi|226694440|sp|A4Y191|ATPF_PSEMY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145577825|gb|ABP87357.1| ATP synthase F0 subcomplex B subunit [Pseudomonas mendocina ymp]
          Length = 156

 Score = 77.9 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   I F IF W   +F+ P L+  M+ R+  I+   +    A+R+++       + L 
Sbjct: 7   LFGQTIAFAIFVWFCMKFVWPPLTQAMQERQKKIAEGLDAAGRAERDLQLAQERAAQMLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +  A EI+D+    A   +E  +     +    ++ A+ EID    +A  ++ + V  
Sbjct: 67  ETKEQAAEILDRANKTANAIVEEAKAQARSEGEKLIAGAKAEIDLEVNRAKDQLRAQVAA 126

Query: 145 VTKDLVRKLGFS-VSDADVQKILDRKRDGI 173
           +      ++  S V  A    ++ +    +
Sbjct: 127 LAVTGAEQILQSTVDGAAHNDLVAKLASQL 156


>gi|325688345|gb|EGD30364.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK72]
          Length = 164

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    E+
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|256827617|ref|YP_003151576.1| ATP synthase, F0 subunit b [Cryptobacterium curtum DSM 15641]
 gi|256583760|gb|ACU94894.1| ATP synthase, F0 subunit b [Cryptobacterium curtum DSM 15641]
          Length = 199

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 40/173 (23%), Positives = 81/173 (46%), Gaps = 7/173 (4%)

Query: 5   SSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64
           ++S   +  P  D      +F  + + F I + +  +F  P    ++  R N I    EK
Sbjct: 30  AASGIEAIMPVMD------EFIPMLVAFIILWIILAKFGWPLFDKMLVKRENTIKESLEK 83

Query: 65  MDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQ 124
            + A++E E +++ Y++ LA A+A A +I+    AA            +++    ++ AQ
Sbjct: 84  SEEARQESERVLAQYKQELAEAKATAAQIVADAKAAGTAAKADITAQAQREASDMIAKAQ 143

Query: 125 NEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDAF 176
             ID  +K A  E+   V +V+  +  K +G  +SD + + +++R  +   +F
Sbjct: 144 VAIDAEKKAAIAELQGSVADVSIAVASKLIGSDLSDDEHRALIERYVNEAGSF 196


>gi|15082069|gb|AAK84015.1|AF393838_4 H+-ATPase F0-part b-subunit [Lactococcus lactis subsp. lactis]
          Length = 168

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 30/159 (18%), Positives = 65/159 (40%), Gaps = 1/159 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
            +T L     ++  F I   +   F    ++S+   R   IS D +  ++  ++   ++ 
Sbjct: 10  PNTVLGNIIVVSGAFIILLVLLRLFAWNAITSVFASRAKKISDDIDAAEANNKQAADLVK 69

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             +  LA ++  A  II      A QN      +  ++       AQ +I+  +K+A   
Sbjct: 70  QRQAELAASKEEAANIIQVANDTASQNRAKVLAIANEEATSLKKRAQEDIEQERKEALNT 129

Query: 138 VYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V   V +++  +  K +G S+  +  Q+++D     +  
Sbjct: 130 VKGDVADISVQIAEKLIGQSLDASAQQELIDSYLAKLGE 168


>gi|34581014|ref|ZP_00142494.1| ATP synthase B chain [Rickettsia sibirica 246]
 gi|229586251|ref|YP_002844752.1| F0F1 ATP synthase subunit B' [Rickettsia africae ESF-5]
 gi|28262399|gb|EAA25903.1| ATP synthase B chain [Rickettsia sibirica 246]
 gi|228021301|gb|ACP53009.1| ATP synthase B chain [Rickettsia africae ESF-5]
          Length = 157

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 70/147 (47%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL I FG+ Y   ++FI P+   I   R+  I  +  + D+   EV
Sbjct: 1   MPQFDIATYYSQIFWLIITFGLLYIFVYKFITPKAEEIFNNRQTNIQDNITQADTLTIEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +    A    +  + + + E     +++  E+DL + ++    +I+   K
Sbjct: 61  EKLNKYYNEEIDKTNAEIDRLKKEKIDSLESEFLIKKKNLEQDLKNAINQNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSD 159
           +      + + ++  +++ K+  + +D
Sbjct: 121 QFRTNKSAAIIKLAVNIIEKIAGTKAD 147


>gi|290473120|ref|YP_003465981.1| membrane-bound ATP synthase, F0 sector subunit b [Xenorhabdus
           bovienii SS-2004]
 gi|289172414|emb|CBJ79181.1| membrane-bound ATP synthase, F0 sector, subunit b [Xenorhabdus
           bovienii SS-2004]
          Length = 156

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK+ ++   ++  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLASAERAKKNLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKADAQAIIEQANKQKAQIIDDAKTEAELERNKIVAQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|270291024|ref|ZP_06197247.1| ATP synthase F0, B subunit [Pediococcus acidilactici 7_4]
 gi|304385300|ref|ZP_07367645.1| ATP synthase F0 sector subunit B [Pediococcus acidilactici DSM
           20284]
 gi|270280420|gb|EFA26255.1| ATP synthase F0, B subunit [Pediococcus acidilactici 7_4]
 gi|304328507|gb|EFL95728.1| ATP synthase F0 sector subunit B [Pediococcus acidilactici DSM
           20284]
          Length = 173

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 72/158 (45%), Gaps = 1/158 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           + ++    + AI+F +   +  +F    ++++++ R + IS+D E  + AK+E + +   
Sbjct: 14  TLYVGDMLFYAILFVVLMALIAKFAWGPVNAMLKERADRISNDIESAEQAKKEAQKLAEQ 73

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +E+L  + A A  II+    +  +  E      + +       A+ +I+  +  A +  
Sbjct: 74  RKEALDNSHAEATTIINNAKNSGAKERELIVGNAQAEAKSLKDKAKQDIEQERADALKSA 133

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
              +  ++ ++  K +   + +   ++++D   +G+  
Sbjct: 134 QDDIASLSIEIASKVIKKELDENSQKELIDSYIEGLGE 171


>gi|300781412|ref|ZP_07091266.1| ATP synthase F0 sector subunit B [Corynebacterium genitalium ATCC
           33030]
 gi|300533119|gb|EFK54180.1| ATP synthase F0 sector subunit B [Corynebacterium genitalium ATCC
           33030]
          Length = 198

 Score = 77.9 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 66/152 (43%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  ++F I + +  +F+LP+   ++  R + I    E+ +SA+ + ++ +      LA
Sbjct: 37  IVWSLVVFIIVFILFWKFVLPKFQEVLAEREDRIKGGIERAESAQAQAKAALEKNNAQLA 96

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI +      ++     R   E +    +   + ++   +++   E+ + +G+
Sbjct: 97  QARAEANEIREAAREKGKEIEAQARANAEAESRRIVEAGEKQLMASREQVIAELRNEIGQ 156

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            + +L  +L         ++   +D     +D
Sbjct: 157 NSINLAEELLGEELSDSTRRSNTIDSFLSQLD 188


>gi|332995983|gb|EGK15610.1| ATP synthase F0, B subunit [Shigella flexneri VA-6]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKLRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|269798592|ref|YP_003312492.1| ATP synthase F0 subunit beta [Veillonella parvula DSM 2008]
 gi|269095221|gb|ACZ25212.1| ATP synthase F0, B subunit [Veillonella parvula DSM 2008]
          Length = 165

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L ++M  R+  I+ D E  + A+ E E   + Y  
Sbjct: 6   LGTILAQMLNFFILVWLLARFAYKPLLAMMTERKERIAKDLEAAEQARAETEKFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            ++ AR  A++I++K +  AE     Q     + +  + + A+ +I   + +A   + + 
Sbjct: 66  QISNARVEAQQIVEKAIQEAENTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNE 125

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K +   ++     K+++     +D+
Sbjct: 126 VVSLSVAMAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|332361636|gb|EGJ39440.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1056]
 gi|332363074|gb|EGJ40861.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK355]
          Length = 164

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  +SA+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAESARKKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|317121014|ref|YP_004101017.1| ATP synthase F0 subunit beta [Thermaerobacter marianensis DSM
           12885]
 gi|315590994|gb|ADU50290.1| ATP synthase F0, B subunit [Thermaerobacter marianensis DSM 12885]
          Length = 160

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
            +  W  I F +F  +   F    +  +++ RR  I ++    + A+ E     + Y + 
Sbjct: 5   PELIWAFINFFVFVILMTVFFWRPMLELLDRRREEIEANLAAAERAREEAARSEAEYRQR 64

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA A+  A+ I+++    AE+  + + E   ++    L  A+  I+  +++A   +   V
Sbjct: 65  LAAAQREAQSILERATQLAEEERQQRLEAARREAEQLLERARATIEREKEQAIAALRREV 124

Query: 143 GEVTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
            ++T     + LG ++   D ++++    + +
Sbjct: 125 ADLTLLATERVLGRALDADDQRRLVAEAVEEV 156


>gi|258652333|ref|YP_003201489.1| ATP synthase F0 subunit B [Nakamurella multipartita DSM 44233]
 gi|258555558|gb|ACV78500.1| ATP synthase F0, B subunit [Nakamurella multipartita DSM 44233]
          Length = 181

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 61/148 (41%), Gaps = 2/148 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +   V  +F+ P+       R   I     K + A+ E ++ +  Y + LA AR 
Sbjct: 33  AIGFALLLVVLGKFVWPQFEKAFAARTKAIEGGIAKAEEAQNEAKAALDRYNQQLAGARE 92

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +I +   A A+   +        +     +  + ++D  + +   E+ S +G V+ D
Sbjct: 93  EAAKIREDARAQAQAIRDDMLAQAHAETERIAAAGRAQLDAQRAQIVAELRSDLGRVSVD 152

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGID 174
           L  ++       DA   + ++R    +D
Sbjct: 153 LAGRIVGESLDDDARQNRTVERFLAELD 180


>gi|241895229|ref|ZP_04782525.1| H(+)-transporting ATPase F(0) B subunit [Weissella
           paramesenteroides ATCC 33313]
 gi|241871535|gb|EER75286.1| H(+)-transporting ATPase F(0) B subunit [Weissella
           paramesenteroides ATCC 33313]
          Length = 171

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 64/154 (41%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L    ++ + F +   +  ++    +  +ME R   ++ D +  + A+++ E M +   E
Sbjct: 16  LGNMLFVLVAFLVLMLLLKKYAWGPVVKMMEKRAEKVAHDLDTAEEARQQAEEMAAKRSE 75

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR  A  I+     AA +  +      + D       A  +I   + +A  +V S 
Sbjct: 76  QLQSARTEANSIVSDAKTAAGKQRDQIVADAQADAQATKEQASAQIAQERSEAMADVKSE 135

Query: 142 VGEVTKDLVRKLGFSVSD-ADVQKILDRKRDGID 174
           V E++  + +K+        D + ++D   +G+ 
Sbjct: 136 VAELSVTIAQKIIQKELKLDDQKALIDAYIEGLG 169


>gi|127514774|ref|YP_001095971.1| F0F1 ATP synthase subunit B [Shewanella loihica PV-4]
 gi|226694480|sp|A3QJR4|ATPF_SHELP RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|126640069|gb|ABO25712.1| ATP synthase F0, B subunit [Shewanella loihica PV-4]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F IF W   +F+ P L + +E R+  I+      D A +++E   +   + L 
Sbjct: 7   LIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A EII++      Q ++  +   + +    ++  + EI+  + +  +++   V  
Sbjct: 67  EAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVAA 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   S+ +A    I+++    I
Sbjct: 127 LAIAGAEKILERSIDEAAHSDIVNKLVAEI 156


>gi|257452845|ref|ZP_05618144.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp.
           3_1_5R]
 gi|257466790|ref|ZP_05631101.1| ATP synthase B chain, sodium ion specific [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 168

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 60/152 (39%), Gaps = 1/152 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    +  I+  R+  I+S+      +K E +      E +L
Sbjct: 14  NLFWQIINFFILVFVFNKYFKTPIQRILTERKKKITSELHSATLSKEEAKVSAKQAETAL 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  A EI+ K    AE+                L  A  E+  ++ KA ++++  V 
Sbjct: 74  KEARDEAHEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKAKARRDLHQEVT 133

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
            +  +L  KL    +       ++D   + + 
Sbjct: 134 SLAVELAEKLMKKNIDKQTATDLIDDFIERVG 165


>gi|85712591|ref|ZP_01043638.1| F0F1-type ATP synthase, subunit b [Idiomarina baltica OS145]
 gi|85693582|gb|EAQ31533.1| F0F1-type ATP synthase, subunit b [Idiomarina baltica OS145]
          Length = 156

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 65/150 (43%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F +F W   +F+ P +   +E R+  I+      + A++++E       E L 
Sbjct: 7   IIGQTIAFAVFVWFCMKFVWPPIIKAIEERQKKIADGLSAGERAQKDLEKAQEDIAEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII++      + +E + +   ++    +++   E++  + +A +E+   V  
Sbjct: 67  EAKQQAAEIIEQAKKRGAKIVEDETQRGHEEREKIVASGHEEVEAERHRAREELRKQVAV 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +     +K+    + +   + I+++    +
Sbjct: 127 LAVTGAQKIIEREIDENAHRDIVEKLVAEL 156


>gi|126662881|ref|ZP_01733880.1| ATP synthase, subunit B (H(+)-transporting two-sector ATPase)
           [Flavobacteria bacterium BAL38]
 gi|126626260|gb|EAZ96949.1| ATP synthase, subunit B (H(+)-transporting two-sector ATPase)
           [Flavobacteria bacterium BAL38]
          Length = 183

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 63/162 (38%), Gaps = 2/162 (1%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                       FFW  +IF     +  +F    +   +  R   I +     ++AK+++
Sbjct: 18  MDKLINQFEFGLFFWQVLIFVGLILLLRKFAWKPILDAVNDREEGIKNALLAAENAKKDM 77

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
            ++ S  E+ LA ARA    ++ +     E+ +   +   +      + +A+  I+  + 
Sbjct: 78  LNLKSDNEKLLAEARAERDLMMKEAREIKEKMIADAKSEAQAQGEKMIESAKASIESEKN 137

Query: 133 KASQEVYSIVGEVTKDLVRKL--GFSVSDADVQKILDRKRDG 172
            A  E+ + V  ++ ++   L  G   +     K++++    
Sbjct: 138 AAMAELKNQVSSLSLEIAETLLKGELSNKEAQTKLVEKMLGD 179


>gi|327458649|gb|EGF04997.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1057]
          Length = 164

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISEDIDGAEAARQKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKDAQSELIDRYIKQLG 162


>gi|322385219|ref|ZP_08058866.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
 gi|321270843|gb|EFX53756.1| ATP synthase F0 sector subunit B [Streptococcus cristatus ATCC
           51100]
          Length = 164

 Score = 77.5 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 31  IFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHA 90
            F +  ++  +F    ++SI+E R   I+ D +  +SA+++ E +    E  LA +R  A
Sbjct: 18  SFLLLIFLVKKFAWGNITSILEERSKKITDDIDGAESARKKAEELAQKRENELAGSRQEA 77

Query: 91  KEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLV 150
             II+     AE+N         ++     + A  EI   + +A   +   V ++T  L 
Sbjct: 78  TTIIEHAKETAEKNKAGILADAAEEAGRLKAKANQEIAQSKAEALNSIKDDVADLTVSLA 137

Query: 151 RKLG-FSVSDADVQKILDRKRDGID 174
            K+    +      +++DR  D + 
Sbjct: 138 SKILSQQLDTKAHSELIDRYIDKLG 162


>gi|330991389|ref|ZP_08315340.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
 gi|329761408|gb|EGG77901.1| ATP synthase subunit b [Gluconacetobacter sp. SXCC-1]
          Length = 164

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 1/151 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           FW A+ F +F+ +  R +   L S ++ R   I ++ ++    +RE E M+         
Sbjct: 7   FWSAVAFVLFFVLFGRSLWKPLVSALDGRAERIRAELDEAARLRREAEQMLEDATRDREA 66

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           A A A+E+++  +  A       R+  E     +   A++ I   ++ A +EV     ++
Sbjct: 67  ALAEARELVEHSLREAANIAAQARKDAEDAAARREQMAKDRIASAERSALREVRETAVDI 126

Query: 146 TKDLV-RKLGFSVSDADVQKILDRKRDGIDA 175
                   L   +   D  KI+DR    + A
Sbjct: 127 AIQATRETLAAKLQADDDGKIVDRSIGDLSA 157


>gi|313890505|ref|ZP_07824133.1| ATP synthase F0, B subunit [Streptococcus pseudoporcinus SPIN
           20026]
 gi|313121022|gb|EFR44133.1| ATP synthase F0, B subunit [Streptococcus pseudoporcinus SPIN
           20026]
          Length = 164

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 62/143 (43%), Gaps = 1/143 (0%)

Query: 33  GIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKE 92
            + Y +  +F    +S I+E R   I++D +K + A++  E++    E  LA A+  A +
Sbjct: 20  LVLYLLIKKFAWGAISGILEERSVKIATDIDKAEEARQSAETLAQKRELELAGAKQEASQ 79

Query: 93  IIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK 152
           II       +   +       ++     + A+ +I   +  A   V + + +++  L  K
Sbjct: 80  IITDAKELGQVKGDQIIADASEEASRLKTQAEADIQQSKTDAIASVKAEMSDLSVLLAEK 139

Query: 153 L-GFSVSDADVQKILDRKRDGID 174
           + G ++      +++D   D + 
Sbjct: 140 IMGSNLDKDAQSQLIDTYLDELG 162


>gi|125717632|ref|YP_001034765.1| F0F1 ATP synthase subunit B [Streptococcus sanguinis SK36]
 gi|226696182|sp|A3CM10|ATPF_STRSV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|125497549|gb|ABN44215.1| Proton-translocating ATPase, F0 sector, subunit b, putative
           [Streptococcus sanguinis SK36]
 gi|332365950|gb|EGJ43706.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1059]
          Length = 164

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    E+
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|167748912|ref|ZP_02421039.1| hypothetical protein ANACAC_03686 [Anaerostipes caccae DSM 14662]
 gi|167651534|gb|EDR95663.1| hypothetical protein ANACAC_03686 [Anaerostipes caccae DSM 14662]
          Length = 161

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 60/154 (38%), Gaps = 1/154 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
           TF S   W  +   +F+ +  + +   +  ++E R  +IS   E  +    +   +   Y
Sbjct: 3   TFNSGLLWTFVNLIVFFLILKKLLFQPVMGMIEKREQMISGQIEDAEQKNTQAGLLKEKY 62

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           E  L  A   A  I+       ++  E        +    +++A   I+  ++KA Q + 
Sbjct: 63  EAELKNANQEAAMIVKTAKERGKEEYEKILRDAGAEASKIIADASKTIETEREKAVQGIQ 122

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           + + +V      K +  +V  A  +KILD     
Sbjct: 123 NEIAQVAIAAASKVIQENVDQASNEKILDDFLRE 156


>gi|259910320|ref|YP_002650676.1| F0F1 ATP synthase subunit B [Erwinia pyrifoliae Ep1/96]
 gi|224965942|emb|CAX57475.1| ATP synthase, F0 complex, b subunit [Erwinia pyrifoliae Ep1/96]
 gi|283480443|emb|CAY76359.1| ATP synthase subunit B protein [Erwinia pyrifoliae DSM 12163]
 gi|310765900|gb|ADP10850.1| F0F1 ATP synthase subunit B [Erwinia sp. Ejp617]
          Length = 156

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  ++      + AK++++   +S  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQASATDRLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKDDAQVIIEQANKRRAQILDEAKAEAEQERNKIVTQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|327468904|gb|EGF14376.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK330]
          Length = 164

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARQKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|196249756|ref|ZP_03148452.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16]
 gi|196210632|gb|EDY05395.1| ATP synthase F0, B subunit [Geobacillus sp. G11MC16]
          Length = 180

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/150 (16%), Positives = 64/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  + F +   +   F    L  +M+ R   I+++ ++ +  ++E E ++    E L 
Sbjct: 24  IIFQLVAFILLMLLLRIFAWGPLMGVMKQREEHIANEIDQAEKRRQEAEKLLEEQRELLK 83

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            +R  A+ I++     AE+  E        +       A+ EI+  +++A   +   V  
Sbjct: 84  QSRQEAQTILENARKLAEEQKEQIVASARAEAERVKEAAKQEIEREKEQAMAALREQVAS 143

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           ++  +  K +   +++ D +K+++     I
Sbjct: 144 LSVLIASKVIERELTEQDQRKLIEAYIKDI 173


>gi|299821857|ref|ZP_07053745.1| ATP synthase F0 sector subunit B [Listeria grayi DSM 20601]
 gi|299817522|gb|EFI84758.1| ATP synthase F0 sector subunit B [Listeria grayi DSM 20601]
          Length = 176

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 62/158 (39%), Gaps = 1/158 (0%)

Query: 18  TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMIS 77
                    +  + F I   +   F    L  IM+ R   I+S+ +  + ++ + E ++ 
Sbjct: 17  AEFAAGDVLFTLVAFIILLALIRIFAWKPLMGIMKEREEHIASEIDAAEESRAQAEGLLE 76

Query: 78  SYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137
             ++ L  AR  A+ +I+      E+  E   +    +       A+++I   ++ A   
Sbjct: 77  EQKQVLKEARVEAQNMIENAKQLGEKERESIIQTARSESERLKEEAKSDIAREKEDAIAA 136

Query: 138 VYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
           +   VG ++  +  K+    + +     +++   + +D
Sbjct: 137 LRDQVGSLSVLIASKVIEKNLDEEAQSSLIEEYIERLD 174


>gi|311743979|ref|ZP_07717785.1| ATP synthase F0 sector subunit B [Aeromicrobium marinum DSM 15272]
 gi|311313109|gb|EFQ83020.1| ATP synthase F0 sector subunit B [Aeromicrobium marinum DSM 15272]
          Length = 179

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +S+     ++FG+ +++  +F++P        R   I    E   +A++E ++ +  Y  
Sbjct: 21  VSEIIIGLVVFGLLFFLLRKFVVPMFEQAYAERTAAIEGGIEDAQAAQKEAQAALEKYNA 80

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR  A  I ++      Q L   R   + D     + A  +++  + +   ++ S 
Sbjct: 81  QLADARHEAARIREEAKEQGAQILAELRAQAQADAERITATAHAQVEAERAQVVAQLKSE 140

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           VG +   L  ++       DA  Q+ ++R    ++ 
Sbjct: 141 VGSMATQLASRIVGEALEDDARQQRTVERFIAELEE 176


>gi|197286885|ref|YP_002152757.1| F0F1 ATP synthase subunit B [Proteus mirabilis HI4320]
 gi|227354882|ref|ZP_03839297.1| H(+)-transporting two-sector ATPase [Proteus mirabilis ATCC 29906]
 gi|226694358|sp|B4F0E3|ATPF_PROMH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|194684372|emb|CAR46014.1| ATP synthase B chain [Proteus mirabilis HI4320]
 gi|227165035|gb|EEI49871.1| H(+)-transporting two-sector ATPase [Proteus mirabilis ATCC 29906]
          Length = 156

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK++++   +   E LA
Sbjct: 7   ILGQAIAFVLFVLFCMKYVWPPIMAAIEKRQKEIADGLSSAERAKKDLDLAKADAGEQLA 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II+       Q +E  +   E++    ++ AQ+E++  +K+A +E+   V  
Sbjct: 67  KAKAEAQAIIESANKQRTQMIEEAKAEAEQERSKIVAQAQSELEAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|188535587|ref|YP_001909384.1| F0F1 ATP synthase subunit B [Erwinia tasmaniensis Et1/99]
 gi|226741449|sp|B2VCA8|ATPF_ERWT9 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|188030629|emb|CAO98525.1| ATP synthase, F0 complex, b subunit [Erwinia tasmaniensis Et1/99]
          Length = 156

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  ++      + AK++++   +S  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEVADGLASAERAKKDLDLAQASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E++    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKDDAQVIIEQANKRRAQILDDAKAEAEQERNKIVTQAQAEIDAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|228471714|ref|ZP_04056487.1| ATP synthase F0, B subunit [Capnocytophaga gingivalis ATCC 33624]
 gi|228276867|gb|EEK15562.1| ATP synthase F0, B subunit [Capnocytophaga gingivalis ATCC 33624]
          Length = 163

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/160 (19%), Positives = 70/160 (43%), Gaps = 2/160 (1%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +     S  FW  I+F     +   F    +   ++ R + I+   E  D AK+E+ ++
Sbjct: 1   MNFIHPESLSFWTLIVFVCLLLLLRAFAWKPILKALKEREDSINHALEAADEAKKEMANL 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
            +  E+ L  AR   + I+ +     E+ +   +E    + L  +S A+  I+  +K A 
Sbjct: 61  KADNEKLLTEARQEREAILKEAREIKERLISQAKEEAHAEGLKIISQAKATIEGEKKMAI 120

Query: 136 QEVYSIVGEVTKDLVRKLGFSVSDAD--VQKILDRKRDGI 173
            E+   +  ++ D+ +K+      ++   +K+++   + I
Sbjct: 121 AEMKEQIASLSLDIAKKVLTKELASEVRQEKLVEDLLNEI 160


>gi|152985533|ref|YP_001351671.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PA7]
 gi|226694439|sp|A6VF36|ATPF_PSEA7 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|150960691|gb|ABR82716.1| ATP synthase F0, B subunit [Pseudomonas aeruginosa PA7]
          Length = 156

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EI+++    A Q ++  R+    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIVEQAKKRANQIVDEARDQARAEGERLKAQAQAEIEQELNSVKDALRAQVGTLAVTG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G S+     ++++ +    I
Sbjct: 132 AEKILGASIDANAHEQLVSKLAAEI 156


>gi|304398013|ref|ZP_07379888.1| ATP synthase F0, B subunit [Pantoea sp. aB]
 gi|308188715|ref|YP_003932846.1| ATP synthase subunit B protein [Pantoea vagans C9-1]
 gi|304354299|gb|EFM18671.1| ATP synthase F0, B subunit [Pantoea sp. aB]
 gi|308059225|gb|ADO11397.1| ATP synthase subunit B protein [Pantoea vagans C9-1]
          Length = 156

 Score = 77.5 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 69/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPLMAAIEKRQKEIAEGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E +    ++ AQ EID  +K+A +E+   V  
Sbjct: 67  KAKEDAQVIIEQANKRRAQILDEAKTEAENERNRIVTQAQAEIDAERKRAREELRKQVAL 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAMAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|116328617|ref|YP_798337.1| F0F1 ATP synthase subunit B [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331346|ref|YP_801064.1| F0F1 ATP synthase subunit B [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122280908|sp|Q04S14|ATPF_LEPBJ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122283596|sp|Q04ZU1|ATPF_LEPBL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116121361|gb|ABJ79404.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector
           [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116125035|gb|ABJ76306.1| B subunit of the H(+)-transporting two-sector ATPase, FO sector
           [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
          Length = 173

 Score = 77.5 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/155 (18%), Positives = 64/155 (41%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  I F +   V  +F    +   ++ R   + +D EK    + E E+++  YE 
Sbjct: 16  PGLVVWTLITFLVVVLVLKKFAWDVILKALDERAQAVQNDIEKASELRLEAEALLKDYEA 75

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A+  A  I+ +  + A +      E   +++  +   A  EI+  + KA +++ + 
Sbjct: 76  RLNSAKDEANAIVAEARSDALKLKNKLLEETNQEVKAQKDQAVKEIELAKGKALEQLQTQ 135

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
             E+T  +  K+    +   D +  ++ + + +  
Sbjct: 136 FVEMTITIAGKVLEKQLKAEDYKAFIETELNKLGK 170


>gi|150388189|ref|YP_001318238.1| ATP synthase F0, B subunit [Alkaliphilus metalliredigens QYMF]
 gi|226694435|sp|A6TK61|ATPF_ALKMQ RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|149948051|gb|ABR46579.1| ATP synthase F0, B subunit [Alkaliphilus metalliredigens QYMF]
          Length = 168

 Score = 77.5 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
              LS F +  I   I YWV  +F+    +  ME R+  I+   ++ +   +E +   + 
Sbjct: 6   EFVLSNFIFTLINLWIMYWVLKKFLFKPTTEYMEGRKKSIADSIQEAEMKNKEADESKAQ 65

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
           Y+  L   +    +IID+    AE+  +   +  E +    +  A  EI   ++K+  E+
Sbjct: 66  YDMKLQDIKKERSQIIDEATKRAEKRGDEIIKAAEDEAEKVIERAMTEIQREKQKSLNEM 125

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
            + + ++      K+    + +    K++ +  D +  
Sbjct: 126 KNEISQLAIAAATKVIEKDLDEGTHHKMIQQFIDEVGE 163


>gi|303230072|ref|ZP_07316844.1| ATP synthase F0, B subunit [Veillonella atypica ACS-134-V-Col7a]
 gi|302515282|gb|EFL57252.1| ATP synthase F0, B subunit [Veillonella atypica ACS-134-V-Col7a]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 67/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L S+M+ R+  I+ D     +A+ E E   + Y  
Sbjct: 6   LGTILAQMLNFFILVWILARFAYKPLVSMMQERKERIAKDLADAQAARNEAEQFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +A AR  A++I++K V  AE     Q     + +  +   A+ +I + + +A   + + 
Sbjct: 66  QIANARQEAQQIVEKAVQQAEATTREQLAAAREQIEREKERARQDIVNERDRAMNNLRNE 125

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K +   +      K+++     +D+
Sbjct: 126 VISLSVAMATKVVAKDMDSETNTKLIEDAIAKLDS 160


>gi|330812739|ref|YP_004357201.1| ATP synthase subunit B [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380847|gb|AEA72197.1| putative ATP synthase, B subunit [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 156

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAHEKVGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIIEQAKKRGTQIVDEAREQARVEADRVKAQAQAEIEQELNSVKDALRAQVGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 ASKILGATIDQNAHAELVNQLAAEI 156


>gi|134300985|ref|YP_001114481.1| ATP synthase F0 subunit B [Desulfotomaculum reducens MI-1]
 gi|226741433|sp|A4J9A3|ATPF_DESRM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|134053685|gb|ABO51656.1| ATP synthase F0 subcomplex B subunit [Desulfotomaculum reducens
           MI-1]
          Length = 189

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 61/153 (39%), Gaps = 1/153 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F          F +   +          +++E RR LI       +  K++ E + ++ +
Sbjct: 31  FNGTLLAQMFNFLVLLILLRAVAYKPFMNMLEKRRELIEGSIAAAEEDKKQAEQLRATLQ 90

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
             L  +R  A E++ +    AE+  +   E  + +      +A +EI   +++A  E+  
Sbjct: 91  ADLQRSREQATEMMARATKNAEEQAQQIIEAAKAEAARVKDSALSEIQREKERAVAELRD 150

Query: 141 IVGEVTKDLVRKLGF-SVSDADVQKILDRKRDG 172
            V  ++  +  K+    ++D   + ++++    
Sbjct: 151 QVATLSILVAGKIIDQKLNDDVQKDLVNKFVKE 183


>gi|325690060|gb|EGD32064.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK115]
 gi|328945467|gb|EGG39618.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1087]
          Length = 164

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|168185928|ref|ZP_02620563.1| ATP synthase F0, B subunit [Clostridium botulinum C str. Eklund]
 gi|169295924|gb|EDS78057.1| ATP synthase F0, B subunit [Clostridium botulinum C str. Eklund]
          Length = 159

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 68/157 (43%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
              +  F W  I F   + V   F+   ++ I++ R + I +D  +    K + + +  +
Sbjct: 2   EFAIPTFVWTIINFLALFAVLSHFLFKPVNQIIDKRSSDIENDINQAKIDKDKAQELRIA 61

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            EE    A+   K I++   A AE   E       K+    +  A+ EI   ++KA  EV
Sbjct: 62  NEEEYKTAKKEGKTIVENYKAKAENVSEEIISDAHKEAELIIERAKKEIQREREKAEDEV 121

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
            +   E++ +L +K L  S+ +   ++++D     + 
Sbjct: 122 KNRTIELSLELSKKALERSIDEKMHRELIDEFISKVG 158


>gi|71891797|ref|YP_277526.1| F0F1 ATP synthase subunit B [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|123641228|sp|Q494C7|ATPF_BLOPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71795903|gb|AAZ40654.1| ATP synthase, F0 sector, subunit b [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 160

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 1/151 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F +F W   +++     SI+E R+  IS +      AK E E + +     L 
Sbjct: 7   ILGQTISFVLFVWFCMKYVWYPFISIIEKRQKEISDNLVSATHAKTESERVNAEALLCLR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A+EII +      Q +   +   EK+    LS A+ +I   +K+ + E+   + E
Sbjct: 67  QARVKAQEIIKQANKCKMQIINEAKHEAEKEQSRILSQAREQIIYERKRVTDELRKQISE 126

Query: 145 VTKDLVRKLGFSVSDADVQ-KILDRKRDGID 174
           +  +   K+     +  +   +L+   + + 
Sbjct: 127 LVIEGTEKVIEHSINEMIDIDLLNNIINTLS 157


>gi|282849839|ref|ZP_06259223.1| ATP synthase F0, B subunit [Veillonella parvula ATCC 17745]
 gi|282580776|gb|EFB86175.1| ATP synthase F0, B subunit [Veillonella parvula ATCC 17745]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 69/155 (44%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L ++M  R+  I+ D E  + A+ E E+  + Y  
Sbjct: 6   LGTILAQMLNFFILVWLLARFAYKPLLAMMTERKERIAKDLEAAEQARAEAETFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            ++ AR  A++I++K +  AE     Q     + +  + + A+ +I   + +A   + + 
Sbjct: 66  QISNARVEAQQIVEKAIQEAENTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNE 125

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K +   ++     K+++     +D+
Sbjct: 126 VVSLSVAMAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|288799872|ref|ZP_06405331.1| ATP synthase F0, B subunit [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288333120|gb|EFC71599.1| ATP synthase F0, B subunit [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 65/155 (41%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
              FFW+ ++F I + +  +   P +++++  R+  I +  +K   A  ++ ++    E 
Sbjct: 8   FGLFFWMTVVFIIVFTILKKKGFPVITAMVNERKAFIDASLQKAHEANEKLANIKKEGES 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR     I+ +     ++ +E  +    ++    +  A+ +I + ++ A ++V   
Sbjct: 68  ILQEAREKQARILREAAETRDKIVEEAQLKAREEAHRIIEEARLQIANEKQNAIKDVKGQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGID 174
           V  ++  +  K+  +          ++D     + 
Sbjct: 128 VASISVQIAEKILHNKLSDSDSQMDLIDSILKDVS 162


>gi|294792753|ref|ZP_06757900.1| ATP synthase F0, B subunit [Veillonella sp. 6_1_27]
 gi|294794505|ref|ZP_06759641.1| ATP synthase F0, B subunit [Veillonella sp. 3_1_44]
 gi|294454835|gb|EFG23208.1| ATP synthase F0, B subunit [Veillonella sp. 3_1_44]
 gi|294456652|gb|EFG25015.1| ATP synthase F0, B subunit [Veillonella sp. 6_1_27]
          Length = 165

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L +IM  R+  I+ D E  + A+ E E   + Y  
Sbjct: 6   LGTILAQMLNFFILVWLLARFAYKPLLAIMTERKERIAKDLEAAEQARAEAEGFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +A AR  A++I++K V  AE     Q     + +  + + A+ +I   + +A   + + 
Sbjct: 66  QIANARIEAQQIVEKAVQEAENTTREQLSTAREQIEQEKNRARQDIAIERDRAMNSLRNE 125

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K +   ++     K+++     +D+
Sbjct: 126 VVSLSVAMAGKVVAKDMNSETNTKLIEDAIRQLDS 160


>gi|261409681|ref|YP_003245922.1| ATP synthase F0 subunit B [Paenibacillus sp. Y412MC10]
 gi|329923667|ref|ZP_08279092.1| ATP synthase F0, B subunit [Paenibacillus sp. HGF5]
 gi|261286144|gb|ACX68115.1| ATP synthase F0, B subunit [Paenibacillus sp. Y412MC10]
 gi|328941144|gb|EGG37444.1| ATP synthase F0, B subunit [Paenibacillus sp. HGF5]
          Length = 162

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 73/150 (48%), Gaps = 2/150 (1%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             I F I Y +  +F   +L  IME RR L+ S   +    +++  + +   +++L  AR
Sbjct: 11  TIIAFVILYLLLQKFAFSKLFGIMEQRRELVMSQMNEAAQTRQQATAYVEEQKKALEQAR 70

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
             A EII++    + +  E   E  +++ +   S A  +I++ +KKA +E+ S +G V+ 
Sbjct: 71  QDAHEIIERSRQTSNKQAEQIMEQAKEEAIRLKSEAVRDIENEKKKAVEELRSEIGSVSV 130

Query: 148 DLVRKLGFS--VSDADVQKILDRKRDGIDA 175
            +  KL      +D   ++++D+    +  
Sbjct: 131 KIATKLIEREVKNDQAQEELVDQYLKEVGG 160


>gi|315178657|gb|ADT85571.1| F0F1 ATP synthase subunit B [Vibrio furnissii NCTC 11218]
          Length = 154

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 63/142 (44%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F +F W   +++ P +   +E R+  I+   +  + AK++++   ++  +SL  A+ 
Sbjct: 9   ALSFALFVWFCMKYVWPPIIKAIEERQKKIADGLQAAERAKKDLDLAQANASDSLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I+       Q L+  RE  + +    L+ A  EI+  + +A  E+   V  +   
Sbjct: 69  TATEVIEAANKRKAQILDEAREEAQAERQKILAQADAEIEAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 129 GAEKILERTIDKDAHKDILDNI 150


>gi|332884315|gb|EGK04583.1| ATP synthase subunit B [Dysgonomonas mossii DSM 22836]
          Length = 166

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + F + ++V  +F  P ++ ++E R+N I    +    A  ++ S+    +E 
Sbjct: 9   GLLFWMLLSFIVVFFVLAKFGFPVITKMVEERKNYIQDSLDAAQKANEQLASIKEKSDEI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L+ A+A   +I+ +     ++ +   RE  +     ++   + +I   + +A +++   V
Sbjct: 69  LSSAKAEQVKILKEAADTRDRIINEAREQAKIAGAKEMEEIRKQIQMEKDQAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDG 172
            E++ D+  K+         +   ++DR  D 
Sbjct: 129 AELSVDVAEKVLRDTLKDPKEQMSMIDRLVDE 160


>gi|56461723|ref|YP_157004.1| F0F1 ATP synthase subunit B [Idiomarina loihiensis L2TR]
 gi|81678428|sp|Q5QZI2|ATPF_IDILO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|56180733|gb|AAV83455.1| F0F1-type ATP synthase, subunit b [Idiomarina loihiensis L2TR]
          Length = 156

 Score = 77.1 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 24/150 (16%), Positives = 60/150 (40%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F +F W   +F+ P +   +E R+  I+      + A++++E       E L 
Sbjct: 7   LIGQTIAFIVFVWFCMKFVWPPIIKAIEERQKKIADGLNAGERAQKDLEKAQQEIAEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII++      + +E + +   ++    ++    E+   + +  +E+   V  
Sbjct: 67  EAKQQAAEIIEQSKKRGAKIVEEETQRGHEEREKIVAAGHEEVAAERNRVREELRKQVAV 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +     +K+    +       I+++    +
Sbjct: 127 LAVSGAQKIIEREIDKDAHSDIVEKLVAEL 156


>gi|152998461|ref|YP_001343296.1| ATP synthase F0 subunit B [Marinomonas sp. MWYL1]
 gi|226694397|sp|A6W3T2|ATPF2_MARMS RecName: Full=ATP synthase subunit b 2; AltName: Full=ATP synthase
           F(0) sector subunit b 2; AltName: Full=ATPase subunit I
           2; AltName: Full=F-type ATPase subunit b 2;
           Short=F-ATPase subunit b 2
 gi|150839385|gb|ABR73361.1| ATP synthase F0, B subunit [Marinomonas sp. MWYL1]
          Length = 156

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F IF W   +++ P + + +E R   I+   E  + A R++E       + L  ++ 
Sbjct: 11  AISFAIFVWFCMKYVWPPVIAALEERSKKIADGLEAANRASRDLELAQEQASQILRESKE 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
           +A EII++    A Q ++  +E    D       AQ EI+    +A + + + V  +   
Sbjct: 71  NAAEIIEQANKRANQMVDEAKEQVIADGKRLREAAQAEIEQDVMRAKEALRAQVSVLAFA 130

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGI 173
              K LG ++ +    +I+++    +
Sbjct: 131 GAEKILGATIDEKAHSEIVEQLAKEL 156


>gi|282859100|ref|ZP_06268231.1| ATP synthase F0, B subunit [Prevotella bivia JCVIHMP010]
 gi|282588130|gb|EFB93304.1| ATP synthase F0, B subunit [Prevotella bivia JCVIHMP010]
          Length = 169

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/155 (17%), Positives = 72/155 (46%), Gaps = 2/155 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F I +++  ++  P +  +   R+  I     K   A  ++ ++    E  
Sbjct: 9   GLLFWMTLVFLIVFFILRKWGFPVILKMSSDRKEYIDGSIRKAKEAHEKLANIQKESESI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR     I+ +     E  +   ++   ++    +++A+  I++ ++ A +E+ + +
Sbjct: 69  LQEAREKQALILKEATTTRETIVSQAQDKAREEAARLVADAKIAIENEKQNALREIRNQM 128

Query: 143 GEVTKDLVRKLG-FSVSDADVQ-KILDRKRDGIDA 175
            E++ ++  K+    +S +DVQ   ++R  D + +
Sbjct: 129 TELSINISEKILRDKLSSSDVQMDYINRLLDDVSS 163


>gi|23336544|ref|ZP_00121756.1| COG0711: F0F1-type ATP synthase, subunit b [Bifidobacterium longum
           DJO10A]
 gi|189439990|ref|YP_001955071.1| F0F1 ATP synthase subunit B [Bifidobacterium longum DJO10A]
 gi|227545744|ref|ZP_03975793.1| F0F1 ATP synthase subunit B [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239622553|ref|ZP_04665584.1| ATP synthase B subunit [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|296453445|ref|YP_003660588.1| ATP synthase F0 subunit B [Bifidobacterium longum subsp. longum
           JDM301]
 gi|312133385|ref|YP_004000724.1| atpf [Bifidobacterium longum subsp. longum BBMN68]
 gi|317481931|ref|ZP_07940956.1| ATP synthase [Bifidobacterium sp. 12_1_47BFAA]
 gi|322690444|ref|YP_004220014.1| ATP synthase subunit B [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|226741310|sp|B3DTV4|ATPF_BIFLD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|189428425|gb|ACD98573.1| F0F1-type ATP synthase subunit b [Bifidobacterium longum DJO10A]
 gi|227213860|gb|EEI81699.1| F0F1 ATP synthase subunit B [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239514550|gb|EEQ54417.1| ATP synthase B subunit [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|291517462|emb|CBK71078.1| ATP synthase F0 subcomplex B subunit [Bifidobacterium longum subsp.
           longum F8]
 gi|296182876|gb|ADG99757.1| ATP synthase F0, B subunit [Bifidobacterium longum subsp. longum
           JDM301]
 gi|311772611|gb|ADQ02099.1| AtpF [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916498|gb|EFV37895.1| ATP synthase [Bifidobacterium sp. 12_1_47BFAA]
 gi|320455300|dbj|BAJ65922.1| ATP synthase subunit B [Bifidobacterium longum subsp. longum JCM
           1217]
          Length = 172

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     ++F +P+ ++I + R   I  +  K + A+++ +   + YE  L+
Sbjct: 18  IVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     ++AQ  I+   ++A   +   VG 
Sbjct: 78  TARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGA 137

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  +    +     ++D   D + A
Sbjct: 138 LATALAGKILGAKLEDNDVQSSMIDSMIDDLGA 170


>gi|302529786|ref|ZP_07282128.1| ATP synthase F0, B subunit [Streptomyces sp. AA4]
 gi|302438681|gb|EFL10497.1| ATP synthase F0, B subunit [Streptomyces sp. AA4]
          Length = 178

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 67/154 (43%), Gaps = 2/154 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           S+     + F I  ++  ++++PR     E R   I    EK + A+ E E  +S Y+  
Sbjct: 15  SELILGIVAFLILLFILKKYVVPRFEKAYEERAQKIEGGIEKAEKAQAEAEKALSEYKAQ 74

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA AR+ A +I D     AEQ     RE  E +    ++    ++   + +   E+ + +
Sbjct: 75  LADARSEAAKIRDDARLEAEQIKAELREQAEAESQRIVAQGHAQLQAQKAQIVAELRAEM 134

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
           G    +L  ++     + + ++   +DR    +D
Sbjct: 135 GRNAVELAGRIVGESLEDEARRRGTVDRFLAELD 168


>gi|184154913|ref|YP_001843253.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956]
 gi|226741492|sp|B2GAU1|ATPF_LACF3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|183226257|dbj|BAG26773.1| F1F0-ATPase B subunit [Lactobacillus fermentum IFO 3956]
          Length = 168

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 67/157 (42%), Gaps = 1/157 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +L    +  + F I   +   F    ++ +M+ R + I++D +    ++ E + + +  +
Sbjct: 11  YLGDMLFYLVSFLIMAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAKRQ 70

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  +R  A  I+D    A E          ++D  +  + AQ + +  ++ A +    
Sbjct: 71  EELKGSRQEAARIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQARQDALRGAKK 130

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
            +  ++ ++  KL    ++  D Q ++D   +G+   
Sbjct: 131 DIANLSIEIASKLIHKQLNADDQQALIDTYIEGLVKH 167


>gi|119471631|ref|ZP_01614016.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonadales
           bacterium TW-7]
 gi|119445410|gb|EAW26697.1| membrane-bound ATP synthase, F0 sector, subunit b [Alteromonadales
           bacterium TW-7]
          Length = 156

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +F     +F+ P L+  +E R+  I       D A++++E       E L  A+A
Sbjct: 11  LIAFTVFVLFCMKFVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQQKAAEQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +IID+    A   ++ +    +++    ++   +EI+  + + ++E+   V  +   
Sbjct: 71  QAADIIDQAKKRAVLIVDEETVRGQEEREKIIAQGHSEIESERNRVTEELRKQVATLAVV 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              ++    ++ A    I+++    +
Sbjct: 131 GAERILEREINQAAHSDIVEKLVAEL 156


>gi|292493908|ref|YP_003529347.1| ATP synthase F0 subunit beta [Nitrosococcus halophilus Nc4]
 gi|291582503|gb|ADE16960.1| ATP synthase F0, B subunit [Nitrosococcus halophilus Nc4]
          Length = 156

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 59/150 (39%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + FGI  W  +R++   L+ +ME R+  ++      +  K E E      +E+L 
Sbjct: 7   LIGQMVAFGILIWFVNRYLWGPLTRLMEERKKRVADGLAAAERGKHEQELAEKRAKETLH 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII +    A + +E  +E    +     + A  EI     +A +++   V  
Sbjct: 67  EAKEKAAEIISQAQKRANEIVEEAKESAHAEGERLKAAANAEIQQEMNRAREDLRGQVVS 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    + +   Q ++      I
Sbjct: 127 IAVAGASKILKRELDEEANQALVKELVGQI 156


>gi|226695883|sp|Q82J80|ATPF_STRAW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148878557|dbj|BAC70596.2| putative F-type proton-transporting ATPase b chain [Streptomyces
           avermitilis MA-4680]
          Length = 180

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 69/149 (46%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I ++V  + +LP ++ ++E RR  I    E+ ++ K E +S++  Y+  LA AR 
Sbjct: 26  LLAFAIVFFVLGKKLLPNINKVLEERRAAIEGGIEEAEAMKVEAQSVLEQYKAQLAEARH 85

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +++  +K A+Q +   VG +  D
Sbjct: 86  EAARLRQEAQEQGATLITEMRAEGQRQREEIIAAGHAQLEADRKAAAQALRQDVGTLATD 145

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   +++DR  DG++ 
Sbjct: 146 LAGKLVGESLEDHARQSRVIDRFLDGLEE 174


>gi|119963814|ref|YP_948318.1| ATP synthase F0, B subunit [Arthrobacter aurescens TC1]
 gi|226741351|sp|A1R7V6|ATPF_ARTAT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119950673|gb|ABM09584.1| ATP synthase F0, B subunit [Arthrobacter aurescens TC1]
          Length = 185

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 30/176 (17%), Positives = 69/176 (39%), Gaps = 4/176 (2%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +  S++++ ++   P   + +      + + F +  ++  +F++P        R   I  
Sbjct: 4   LIISAATEGAAEANPLVPNVWEMGV--VLVGFAVLMYIVVKFVVPMFEKTFAERAEAIEG 61

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
              K ++A+ E  + +  Y++ L  ARA A  I ++  A   Q L   +     +     
Sbjct: 62  GIAKAEAAQAEASAALEEYKQQLTDARAEANRIREEARAEGAQILADLKAKAAAESARIT 121

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKI--LDRKRDGID 174
             A   I+  ++ A   + S VG +   L  ++       D +    +DR    ++
Sbjct: 122 EQAHAAIESERQAAVVSLRSEVGTLATTLAGRIVGEALTDDQRAARVVDRFLADLE 177


>gi|269118838|ref|YP_003307015.1| ATP synthase F0 subunit beta [Sebaldella termitidis ATCC 33386]
 gi|268612716|gb|ACZ07084.1| ATP synthase F0, B subunit [Sebaldella termitidis ATCC 33386]
          Length = 164

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 29/147 (19%), Positives = 64/147 (43%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I  +V  R    ++  I++ R+ +++S   + +  +       +   E    A+ 
Sbjct: 18  IINFLILVYVFWRLFGKKIGPILDERKKIVTSKLLEAEEERTNARKATAEASELKREAKK 77

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EI+ +   +A++  E   +   +     L+ A+ +I+ M++ AS+E+   V  +   
Sbjct: 78  RANEILIRAEISADERKERIIKEANQSREKMLTTAEIDIEKMKQNASKELQKEVSSLAVT 137

Query: 149 LVRKLGFSVSDADVQKILDRKRDGIDA 175
           L  K+     D D  KI++   + +  
Sbjct: 138 LAEKILKENIDKDGDKIINNFIEEVGE 164


>gi|260771031|ref|ZP_05879959.1| ATP synthase B chain [Vibrio furnissii CIP 102972]
 gi|260613920|gb|EEX39111.1| ATP synthase B chain [Vibrio furnissii CIP 102972]
          Length = 154

 Score = 77.1 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 63/142 (44%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F +F W   +++ P +   +E R+  I+   +  + AK++++   ++  +SL  A+ 
Sbjct: 9   ALSFALFVWFCMKYVWPPIIKAIEERQKKIADGLQAAERAKKDLDLAQANASDSLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I+       Q L+  RE  + +    L+ A  EID  + +A  E+   V  +   
Sbjct: 69  TATEVIEAANKRKAQILDEAREEAQAERQKILAQADAEIDAERNRARDELRKQVATLAIA 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 129 GAEKILERTIDKDAHKDILDNI 150


>gi|254483167|ref|ZP_05096400.1| ATP synthase F0, B subunit [marine gamma proteobacterium HTCC2148]
 gi|214036538|gb|EEB77212.1| ATP synthase F0, B subunit [marine gamma proteobacterium HTCC2148]
          Length = 146

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F  F     +++ P + + M  R   I+      D A  ++E       E L  A+  
Sbjct: 2   IAFICFVVFCMKYVWPPIIAAMSEREQKIADGLAAADRASHDLELAKEKAVERLKEAKEE 61

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A  IID     A Q +E  ++    +     ++AQ EI+    +A +++   V  ++   
Sbjct: 62  ASGIIDSANKRAGQLVEEAKDAAVVEADRVKASAQAEIEQETNRAREQLRGQVAALSLAG 121

Query: 150 VRK-LGFSVSDADVQKILDRKRDGI 173
             K LG ++      +++++    +
Sbjct: 122 AEKVLGSAIDQEAHNELVEKLASEL 146


>gi|325693993|gb|EGD35911.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK150]
          Length = 164

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +R  A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRVEAVSIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVALASKILSQELDKEAQSELIDRYIKQLG 162


>gi|108760214|ref|YP_628675.1| ATP synthase F0 subunit B [Myxococcus xanthus DK 1622]
 gi|108464094|gb|ABF89279.1| ATP synthase F0, B subunit [Myxococcus xanthus DK 1622]
          Length = 172

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  + F I   V        + S++E R   I+S  E     + E E +++  + 
Sbjct: 5   PGLIFWTLVTFVIAAVVLKWKAWGPILSLVEEREKQIASSIESAKRERAEAEKLLADQKT 64

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           ++A AR  A E++ +     E+  E       K+      +A+ EID+ + KA  EV S+
Sbjct: 65  AIAEARREAAEMMRRNTQEMEKFREELMAKSRKEAEELKLSARREIDEQKAKAIAEVRSM 124

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
             ++  ++  KL    + D+  + + ++   G+ 
Sbjct: 125 AVDLAMEVAGKLISERMDDSKQRALAEQFVQGLP 158


>gi|23464960|ref|NP_695563.1| F0F1 ATP synthase subunit B [Bifidobacterium longum NCC2705]
 gi|81754473|sp|Q8G7A9|ATPF_BIFLO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|23325557|gb|AAN24199.1| protein with similarity to ATP synthase B chain [Bifidobacterium
           longum NCC2705]
          Length = 173

 Score = 77.1 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 65/153 (42%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     ++F +P+ ++I + R   I  +  K + A+++ +   + YE  L+
Sbjct: 19  IVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLS 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     ++AQ  I+   ++A   +   VG 
Sbjct: 79  TARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGA 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  +    +     ++D   D + A
Sbjct: 139 LATALAGKILGAKLEDNDVQSSMIDSMIDDLGA 171


>gi|315917938|ref|ZP_07914178.1| ATP synthase subunit B [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059386|ref|ZP_07923871.1| ATP synthase subunit B [Fusobacterium sp. 3_1_5R]
 gi|313685062|gb|EFS21897.1| ATP synthase subunit B [Fusobacterium sp. 3_1_5R]
 gi|313691813|gb|EFS28648.1| ATP synthase subunit B [Fusobacterium gonidiaformans ATCC 25563]
          Length = 163

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 60/152 (39%), Gaps = 1/152 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    +  I+  R+  I+S+      +K E +      E +L
Sbjct: 9   NLFWQIINFFILVFVFNKYFKTPIQRILTERKKKITSELHSATLSKEEAKVSAKQAETAL 68

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  A EI+ K    AE+                L  A  E+  ++ KA ++++  V 
Sbjct: 69  KEARDEAHEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKAKARRDLHQEVT 128

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
            +  +L  KL    +       ++D   + + 
Sbjct: 129 SLAVELAEKLMKKNIDKQTATDLIDDFIERVG 160


>gi|15600751|ref|NP_254245.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PAO1]
 gi|116053709|ref|YP_794036.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894661|ref|YP_002443531.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa LESB58]
 gi|254237766|ref|ZP_04931089.1| ATP synthase B chain [Pseudomonas aeruginosa C3719]
 gi|254243103|ref|ZP_04936425.1| ATP synthase B chain [Pseudomonas aeruginosa 2192]
 gi|296392425|ref|ZP_06881900.1| F0F1 ATP synthase subunit B [Pseudomonas aeruginosa PAb1]
 gi|81783492|sp|Q9HT16|ATPF_PSEAE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122256271|sp|Q02DF0|ATPF_PSEAB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|9951898|gb|AAG08943.1|AE004967_14 ATP synthase B chain [Pseudomonas aeruginosa PAO1]
 gi|115588930|gb|ABJ14945.1| ATP synthase B chain [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169697|gb|EAZ55208.1| ATP synthase B chain [Pseudomonas aeruginosa C3719]
 gi|126196481|gb|EAZ60544.1| ATP synthase B chain [Pseudomonas aeruginosa 2192]
 gi|218774890|emb|CAW30708.1| ATP synthase B chain [Pseudomonas aeruginosa LESB58]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EI+++    A Q ++  R+    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDALRAQVGALAVTG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G S+     ++++ +    I
Sbjct: 132 AEKILGASIDANAHEQLVSKLAAEI 156


>gi|325684410|gb|EGD26578.1| ATP synthase F0 sector subunit B [Lactobacillus delbrueckii subsp.
           lactis DSM 20072]
          Length = 168

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 66/149 (44%), Gaps = 1/149 (0%)

Query: 27  WLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIA 86
           W  I+F I       +    +  +ME RR  +  D ++  S +++ E + +  E +L  +
Sbjct: 19  WYLIVFSILLLAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAEILANEREAALKNS 78

Query: 87  RAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVT 146
           R  A +I+    + A++  +      + +       A+ +    +  A  E  + V +++
Sbjct: 79  RQEATQILSVAKSNAQKIGKQIVSEAKAEASAIRERAKADAAQAKTDALNEARNEVADLS 138

Query: 147 KDLVRK-LGFSVSDADVQKILDRKRDGID 174
             +  K +  ++S AD + ++D+   G++
Sbjct: 139 VTIAEKVIAKNLSAADQKDLVDQFIKGLN 167


>gi|4100653|gb|AAD00914.1| proton-translocating ATPase b subunit [Streptococcus sanguinis]
          Length = 164

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDGAEAARKKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +RA A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ALAGSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|324990544|gb|EGC22480.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK353]
          Length = 164

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 67/154 (43%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F ++A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFIFIAGSFLLLVFLIKKFAWGNIIGILDQRAQKISDDIDGAEAARKKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +RA A  I++     AE+N         ++     + A  EI   + +    +   
Sbjct: 69  ALAGSRAEAVAIVETAKETAEKNKAGILADAAEEAGRLKAKANQEIAQNKAETMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|15616320|ref|NP_244625.1| F0F1 ATP synthase subunit B [Bacillus halodurans C-125]
 gi|15213931|sp|Q9K6H1|ATPF_BACHD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|10176382|dbj|BAB07477.1| ATP synthase subunit b [Bacillus halodurans C-125]
          Length = 162

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/152 (17%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             +  I F +  W+  +F L  L  +ME R  +I+   ++ D  ++  +  +     ++ 
Sbjct: 9   IIYQLIAFCVLLWLLSKFALKPLMGVMEKREQMINDQIDQADKDRKAAQEYLEQQRLAVE 68

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A+EI+ K    +EQ  +   E    +       A  EI   +++A   +   V  
Sbjct: 69  KAREEAQEIVQKAKKLSEQQGQEIVEAARAEGERLKEAALAEIQREKEQAVASLREQVAS 128

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           ++  +  K +   + + + +K++      +  
Sbjct: 129 LSVLIATKVIEKELDEKEQEKLIAEYLKEVGE 160


>gi|313111491|ref|ZP_07797292.1| ATP synthase B chain [Pseudomonas aeruginosa 39016]
 gi|310883794|gb|EFQ42388.1| ATP synthase B chain [Pseudomonas aeruginosa 39016]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EI+++    A Q ++  R+    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIVEQAKKRANQIVDEARDQARTEGERMKAQAQAEIEQELNSVKDALRAQVGALAVTG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G S+     ++++ +    I
Sbjct: 132 AEKILGASIDANAHEQLVSKLAAEI 156


>gi|163754723|ref|ZP_02161845.1| ATP synthase, subunit B (H(+)-transporting two-sector ATPase)
           [Kordia algicida OT-1]
 gi|161325664|gb|EDP96991.1| ATP synthase, subunit B (H(+)-transporting two-sector ATPase)
           [Kordia algicida OT-1]
          Length = 164

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 24/154 (15%), Positives = 65/154 (42%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW+ I F     +        +   ++ R + I +  E  ++AK+E++++ +  E+
Sbjct: 8   IGLVFWVTIAFLALVIILRTAAWKPILGAVKEREDSIKNALEAAENAKKEMQNLHADNEK 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  ARA  + ++ +     E+ +   +   ++     ++ AQ  I   ++ A  E+ + 
Sbjct: 68  LLKEARAEREAMLKEAREIKEKMIADAKGEAQEQANKMIAQAQESIRSEKQSALAELKNQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++ ++  K+             ++D+    +
Sbjct: 128 VANISVEIAEKVVREELADKDKQLSLVDKMLGDV 161


>gi|332523942|ref|ZP_08400194.1| ATP synthase F0, B subunit [Streptococcus porcinus str. Jelinkova
           176]
 gi|332315206|gb|EGJ28191.1| ATP synthase F0, B subunit [Streptococcus porcinus str. Jelinkova
           176]
          Length = 164

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 61/143 (42%), Gaps = 1/143 (0%)

Query: 33  GIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKE 92
            + Y +  +F    +S I+E R   I++D +K + A++  E++    E  LA A+  A +
Sbjct: 20  LVLYLLIKKFAWGAISGILEERSAKIATDIDKAEEARQSAETLAQKRELELAGAKQEANQ 79

Query: 93  IIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK 152
           II       +   +       ++     + A+ +I   +  A   V + + +++  L  K
Sbjct: 80  IITDAKELGQVKGDKIIADASEEASRLKTQAEADIQQSKTDAIASVKAEMSDLSVLLAEK 139

Query: 153 L-GFSVSDADVQKILDRKRDGID 174
           + G ++       ++D   D + 
Sbjct: 140 IMGSNLDKDAQSHLIDTYLDELG 162


>gi|297585423|ref|YP_003701203.1| ATP synthase F0 subunit B [Bacillus selenitireducens MLS10]
 gi|297143880|gb|ADI00638.1| ATP synthase F0, B subunit [Bacillus selenitireducens MLS10]
          Length = 165

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 23/153 (15%), Positives = 59/153 (38%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
              +  + F    W+  R+    +  +ME R   ++   +  +  + E E  +    E++
Sbjct: 11  NAVYQILAFLFLMWLLKRYAFGPIMDMMEKREKHVADQIKSAEKNRDEAEQYLKEQREAI 70

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  AKEI++     ++Q           +       A+ EI+  +++A   +   V 
Sbjct: 71  QTARQEAKEIVENAKKMSDQQAADIVASARTEAERLKETAKAEINSEKEQAVSALREQVS 130

Query: 144 EVTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
            ++  +  K +   + + + +K++      +  
Sbjct: 131 TLSVLVASKVIEKELDEKEQEKLIQETLKEVGG 163


>gi|45593076|gb|AAS68121.1| ATP synthase B subunit [Bifidobacterium breve UCC2003]
          Length = 172

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 67/153 (43%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     ++F +P+ ++I + R   I  +  K + AK++ +   + YE  L+
Sbjct: 18  IVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIEGNIAKAEQAKKDADEAKAKYEAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     ++AQ  I+  Q++A   +   VG 
Sbjct: 78  TARVDAAKIRDDARAEASHIISDARSRAESDAAQITASAQRSIESQQQQAIVSLKGEVGA 137

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  +    +     ++D   D +DA
Sbjct: 138 LATALAGKILGAKLEDNDVQSSMIDSMIDDLDA 170


>gi|238018578|ref|ZP_04599004.1| hypothetical protein VEIDISOL_00405 [Veillonella dispar ATCC 17748]
 gi|237865049|gb|EEP66339.1| hypothetical protein VEIDISOL_00405 [Veillonella dispar ATCC 17748]
          Length = 165

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/155 (20%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L       + F I  W+  RF    L ++M  R+  I+ D E  + A+ E E   + Y  
Sbjct: 6   LGTILAQMLNFFILVWLLARFAYKPLLAMMTERKERIAKDLEAAEKARAEAEEFKADYAA 65

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            ++ AR  A++I++K +  AE     Q     + +  + + A+ +I   + +A   + + 
Sbjct: 66  QISNARVEAQKIVEKAIQEAENTTREQLATAREQIEQEKNRARQDIAIERDRAMNSLRNE 125

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           V  ++  +  K+    ++     K+++     +D+
Sbjct: 126 VVSLSVAMAGKIVAKDMNSETNTKLIEDAIRQLDS 160


>gi|330469848|ref|YP_004407591.1| ATP synthase F0 subunit B [Verrucosispora maris AB-18-032]
 gi|328812819|gb|AEB46991.1| ATP synthase F0, B subunit [Verrucosispora maris AB-18-032]
          Length = 176

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 66/148 (44%), Gaps = 2/148 (1%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F +  +V  +F+LPR+ ++ + R + I    ++ ++A+ E   ++  Y   LA  R  
Sbjct: 25  IAFALLCFVLMKFVLPRMETMYQARVDAIEGGLKRAEAAQAEANQLLEQYRAQLAEVRTE 84

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A +I D   A AE           ++    ++  +  +   ++   +E+ + VG +  DL
Sbjct: 85  AAQIRDDARADAESIRTEILAKAREESDRIIAAGRESLAVERQTIVRELRAEVGGLAVDL 144

Query: 150 VRKLGFS--VSDADVQKILDRKRDGIDA 175
             ++       +A  +  ++R    +++
Sbjct: 145 ASRIVGESLADEARRKGTVERFLTDLES 172


>gi|323490917|ref|ZP_08096112.1| ATP synthase B chain [Planococcus donghaensis MPA1U2]
 gi|323395397|gb|EGA88248.1| ATP synthase B chain [Planococcus donghaensis MPA1U2]
          Length = 173

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 61/152 (40%), Gaps = 1/152 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +       +IF     +  +F    L  +M+ R +LI S+ E  ++++ E + M+     
Sbjct: 17  IGDILATLVIFIGLMLLLKKFAWGPLMGVMQQREDLIKSEIETAENSRLESQKMLEEQRG 76

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR  A+EI++      E + E        +       A  EI + + KA   V   
Sbjct: 77  LLKDARTQAQEIVENAKKQGEVSREEIITTARAESSRMKEAAVQEIANERDKAISAVREE 136

Query: 142 VGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           V  ++     K L   +S+ D +++++     
Sbjct: 137 VVALSLLAATKVLEKEISEEDNRQLINETIAK 168


>gi|220936464|ref|YP_002515363.1| F0F1 ATP synthase subunit B [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997774|gb|ACL74376.1| F0F1 ATP synthase subunit B [Thioalkalivibrio sp. HL-EbGR7]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I FG+  WVT +F+ P +   M+ R+  I+      +  K E +      ++ L  A+  
Sbjct: 12  ITFGLLVWVTMKFVWPPIIQAMQERQKKIADGLAAAERGKHEQQLAEEKAKQVLHEAKQQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EI+ +    A + +E  ++    +     ++AQ EI+    +A +E+   VG +    
Sbjct: 72  AAEIVAQAQKRANEIVEASKDTARVEGERIKASAQTEIEQEVHRAREELRKQVGAIAVVG 131

Query: 150 VRKLG-FSVSDADVQKILDRKRDGI 173
             ++    +      +++      I
Sbjct: 132 AERILKKEIDPKAHDQVIQDLVAQI 156


>gi|153869493|ref|ZP_01999080.1| ATP synthase F0, subunit B [Beggiatoa sp. PS]
 gi|152074016|gb|EDN70920.1| ATP synthase F0, subunit B [Beggiatoa sp. PS]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 54/150 (36%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   + F        +F+   ++ +ME RR  I+      D  K ++E       + + 
Sbjct: 7   LFGQILTFAALVIFVWQFLWGPMTKMMEERRAKIADGLAAADRGKHDLELAEHRAAQIIR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A + I      A + +E  ++    +   +L  A +EI+    +A +++   V  
Sbjct: 67  DAKQDATDFIASGNKRATEIIEEAKQQARVEGKRQLDVALSEIEQEINRAREDLRKQVVN 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    V        +D     I
Sbjct: 127 LALKTAEKILEREVDVKTHDVFIDDMMKKI 156


>gi|330447616|ref|ZP_08311264.1| ATP synthase F0, B subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491807|dbj|GAA05761.1| ATP synthase F0, B subunit [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 75/146 (51%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F IF W+  +++ P L++++E R+  I+      ++A +E+E   ++ E+ L  A+ 
Sbjct: 11  AISFVIFVWLCMKYVWPPLTALIEQRQRDIAEGLIHTENASKELELAKANGEKLLDDAKK 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E++++      Q +E  +   EK+    ++  Q E++  + +  QE+ + + ++  +
Sbjct: 71  SANELVEQGNKRRAQIIEDAQAEGEKEKARIIAQGQAEVESDRNRLRQELRAEMSDMVIE 130

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGI 173
             +K +  ++     + ++++    +
Sbjct: 131 TAQKLIARNLDTDANRDLVNKLIKDM 156


>gi|145301176|ref|YP_001144017.1| F0F1 ATP synthase subunit B [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|226694427|sp|A4STP7|ATPF_AERS4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|142853948|gb|ABO92269.1| F0F1 ATP synthase subunit B [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F IF W   +F+ P L + +E R+  I+      + AK++++   ++  + L  A+ 
Sbjct: 11  TLAFIIFVWCCMKFVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKANATDQLKEAKL 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +II++      Q ++        +    L+  + EID  + +A +E+   V  +   
Sbjct: 71  QAAQIIEQANKRKAQIIDEAAVGAHTEREKILAQGRAEIDAERHRAKEELRKQVAALAIA 130

Query: 149 LVRKLGFS-VSDADVQKILDRKRDGI 173
              K+    +  A    I+D+    +
Sbjct: 131 GAEKILARHIDQAANSDIVDKLVAEL 156


>gi|329298806|ref|ZP_08256142.1| F0F1 ATP synthase subunit B [Plautia stali symbiont]
          Length = 154

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 67/147 (45%), Gaps = 1/147 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P + + +E R+  I+      + AK++++   ++  + L 
Sbjct: 7   ILGQAIAFILFVAFCMKYVWPPIMAAIEKRQKEIAEGLASAERAKKDLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q L+  +   E +    +S AQ EI+  + +A +E+   V  
Sbjct: 67  KAKEEAQVIIEQANKRRAQILDEAKTEAETERNRIVSQAQAEIEAERSRAREELRKQVAL 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKR 170
           +      K+   SV +A    I+D+  
Sbjct: 127 LALAGAEKIIERSVDEAANSDIVDKLV 153


>gi|86742392|ref|YP_482792.1| F0F1 ATP synthase subunit B [Frankia sp. CcI3]
 gi|123723516|sp|Q2J6M9|ATPF_FRASC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|86569254|gb|ABD13063.1| ATP synthase F0 subcomplex B subunit [Frankia sp. CcI3]
          Length = 196

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 71/175 (40%), Gaps = 8/175 (4%)

Query: 2   ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61
           A S  SD +   PP       S+     + F +        I P+++     R   I   
Sbjct: 11  AESGHSDENVLIPPL------SELLIGTLSFALLVAFFFWKIRPQIARTYAQRTERIEGG 64

Query: 62  QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLS 121
             + ++A+RE ++++  Y   LA AR  A  I ++  +   Q  E  R   ++++    +
Sbjct: 65  LARAEAAQREAQALLEQYRAQLAEARTEAARIREEAHSEGRQITEELRAAAQREIAEIKA 124

Query: 122 NAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF--SVSDADVQKILDRKRDGID 174
            A  ++   + +   +V   VGE+  DL  K+      S A   +++D     +D
Sbjct: 125 RADAQLAADRAQIVAQVRREVGEIAVDLASKIVGFQLESSATQNRLIDDFIAALD 179


>gi|77361908|ref|YP_341483.1| F0F1 ATP synthase subunit B [Pseudoalteromonas haloplanktis TAC125]
 gi|123589152|sp|Q3IK46|ATPF_PSEHT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|76876819|emb|CAI88041.1| membrane-bound ATP synthase, F0 sector, subunit b
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +F     +F+ P L+  +E R+  I       D A++++E       E L  A+ 
Sbjct: 11  LIAFTVFVLFCMKFVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQKKAAEQLKDAKV 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +IID+    A   ++ +    +++    ++   +EI+  + + ++E+   V  +   
Sbjct: 71  QAADIIDQAKKRAVLIVDEETVRGQQEREKIIAQGHSEIESERNRVTEELRKQVATLAVV 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
             +++    ++ A    I+++    +
Sbjct: 131 GAQRILEREINQAAHSDIVEKLVAEL 156


>gi|299537988|ref|ZP_07051274.1| ATP synthase B chain [Lysinibacillus fusiformis ZC1]
 gi|298726570|gb|EFI67159.1| ATP synthase B chain [Lysinibacillus fusiformis ZC1]
          Length = 172

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 60/154 (38%), Gaps = 1/154 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
                     +IF     +  +F    L  IM+ R  L++S+ E  + A++E    +   
Sbjct: 14  FNSGDIIATLVIFIGLMLLLRKFAWGPLMGIMQQREELVASEIEAAEKARKESHQFLEEQ 73

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           +  L  AR  A+ I++      E   E    V   +      +A  EI+  ++KA   V 
Sbjct: 74  KSLLKEARTEAQSIVEGAKKQGELQKEEILTVARNEANRLKESALREIESEKEKAIAAVR 133

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
             V  ++     K L   +S+AD + +++     
Sbjct: 134 DEVVSLSVLAASKVLSKEISEADNRALIEETIAK 167


>gi|227514477|ref|ZP_03944526.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus fermentum
           ATCC 14931]
 gi|227087163|gb|EEI22475.1| H(+)-transporting ATPase F(0) B subunit [Lactobacillus fermentum
           ATCC 14931]
          Length = 168

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 67/157 (42%), Gaps = 1/157 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +L    +  + F I   +   F    ++ +M+ R + I++D +    ++ E + + +  +
Sbjct: 11  YLGDMLFYLVSFLIMAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAKRQ 70

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  +R  A  I+D    A E          ++D  +  + AQ + +  ++ A +    
Sbjct: 71  EELKGSRQEAATIVDNAKQAGESQRAEIIATAQQDAQNLKNQAQKDAEQARQDALRGAKK 130

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
            +  ++ ++  KL    ++  D Q ++D   +G+   
Sbjct: 131 DIANLSIEIASKLIHKQLNADDQQALIDTYIEGLVKH 167


>gi|255009225|ref|ZP_05281351.1| putative ATP synthase B chain [Bacteroides fragilis 3_1_12]
 gi|313146973|ref|ZP_07809166.1| ATP synthase B subunit [Bacteroides fragilis 3_1_12]
 gi|313135740|gb|EFR53100.1| ATP synthase B subunit [Bacteroides fragilis 3_1_12]
          Length = 165

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 64/153 (41%), Gaps = 2/153 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ + FGI + V  ++  P +  ++E R+  I    E    A  ++  +    E  
Sbjct: 9   GLIFWMLLSFGIVFAVLAKYGFPVIIKMVEGRKTYIDESLEVAREANAQLSRLKEEGEAI 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +A A      I+ + +   E+ +   R+  E     +L   + +I   +++A +++   V
Sbjct: 69  VAAANKEQGRIMKEAMQEREKIIYEARKQAEIAAQKELDEVKRQIQIEKEEAIRDIRRQV 128

Query: 143 GEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
             ++ D+  K+         +   ++DR  D +
Sbjct: 129 ALLSVDIAEKVIRKNLADKQEQMGMIDRMLDEV 161


>gi|302542484|ref|ZP_07294826.1| ATP synthase F0, B subunit [Streptomyces hygroscopicus ATCC 53653]
 gi|302460102|gb|EFL23195.1| ATP synthase F0, B subunit [Streptomyces himastatinicus ATCC 53653]
          Length = 187

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/149 (20%), Positives = 65/149 (43%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ +++ RR  I    EK ++ + E + ++  Y   LA AR 
Sbjct: 27  LIAFAIVFIFFAKKLLPNINRVLDERRAAIEGGMEKAEATQAEAQQVLEDYRAQLADARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +I+  +K+A   +   VG++  D
Sbjct: 87  EAARLRQEAQEQGAALIAEMRAEGQRQREEIIAAGHAQIEAERKQAGTALRQDVGKLATD 146

Query: 149 LVRKLGFSVSD--ADVQKILDRKRDGIDA 175
           L  K+     +  A   + +DR  D ++A
Sbjct: 147 LAGKIVGESLEDVARQSRTIDRFLDDLEA 175


>gi|126653445|ref|ZP_01725541.1| AtpF [Bacillus sp. B14905]
 gi|126589801|gb|EAZ83934.1| AtpF [Bacillus sp. B14905]
          Length = 173

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 60/154 (38%), Gaps = 1/154 (0%)

Query: 20  TFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSY 79
                     +IF +  ++  +     L  IM+ R  L++S+ E  + A+++    +   
Sbjct: 15  FNSGDIIATLVIFLVLMFLLKKVAWGPLMGIMQQREELVASEIEAAEKARKDSHQFLEEQ 74

Query: 80  EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVY 139
           +  L  AR  A+ I++      E   +        +      +A  EI+  ++KA   V 
Sbjct: 75  KSLLKEARTEAQSIVEGAKKQGELQKDEILTAARNEANRLKESALREIESEKEKAIAAVR 134

Query: 140 SIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDG 172
             V  ++     K L   +S+AD + +++     
Sbjct: 135 DEVVSLSVLAASKVLSKEISEADNRALIEETIAK 168


>gi|90578416|ref|ZP_01234227.1| hypothetical ATP synthase B chain [Vibrio angustum S14]
 gi|90441502|gb|EAS66682.1| hypothetical ATP synthase B chain [Vibrio angustum S14]
          Length = 156

 Score = 76.7 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/146 (18%), Positives = 74/146 (50%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F IF W+  +++ P L+++++ R+  I+      ++A +E+E   ++ E+ L  A+ 
Sbjct: 11  AISFVIFVWLCMKYVWPPLTALIDQRQREIAEGLIHTENASKELELAKANGEKLLDDAKK 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E++++      Q +E  +   EK+    ++    E++  + +  QE+ + + ++  +
Sbjct: 71  SANELVEQGNKRRAQIIEEAQAEGEKEKARIIAQGNAEVESDRNRLRQELRAEMSDMVIE 130

Query: 149 LVRKLG-FSVSDADVQKILDRKRDGI 173
             +KL   ++     + ++++    +
Sbjct: 131 TAQKLINRNLDTDANRDLVNKLIKDM 156


>gi|282861126|ref|ZP_06270191.1| ATP synthase F0, B subunit [Streptomyces sp. ACTE]
 gi|282563784|gb|EFB69321.1| ATP synthase F0, B subunit [Streptomyces sp. ACTE]
          Length = 181

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 67/156 (42%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           + +     I F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+ 
Sbjct: 20  VPEIIIGLIAFAIVFGFLAKKLLPNINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKA 79

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA AR  A  +  +        ++  R   ++     ++    +I+  +K A+  +   
Sbjct: 80  QLAEARHEAARLRQEAQEQGAVIIQEMRAEGQRQREEIIAAGHAQIEADRKAAASALRQD 139

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           VG +   L  KL        A     +DR  D ++A
Sbjct: 140 VGTLATALAGKLVGESLEDHARQSGTVDRFLDELEA 175


>gi|313123403|ref|YP_004033662.1| ATP synthase subunit b [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
 gi|312279966|gb|ADQ60685.1| ATP synthase subunit b [Lactobacillus delbrueckii subsp. bulgaricus
           ND02]
          Length = 168

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 66/149 (44%), Gaps = 1/149 (0%)

Query: 27  WLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIA 86
           W  I+F I       +    +  +ME RR  +  D ++  S +++ E + +  E +L  +
Sbjct: 19  WYLIVFSILLLAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAEILANEREAALKNS 78

Query: 87  RAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVT 146
           R  A +I+    + A++  +      + +       A+ +    +  A  E  + V +++
Sbjct: 79  RQEATQILSVAKSNAQKTGKQIVSEAKAEASAIRERAKADAAQAKSDALNEARNEVADLS 138

Query: 147 KDLVRK-LGFSVSDADVQKILDRKRDGID 174
             +  K +  ++S AD + ++D+   G++
Sbjct: 139 VTIAEKVIAKNLSAADQKDLVDQFIKGLN 167


>gi|325696687|gb|EGD38575.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK160]
 gi|327461561|gb|EGF07892.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1]
 gi|327489415|gb|EGF21208.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK1058]
          Length = 164

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 65/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++SI E R   IS D +  +SA+++ E +    E 
Sbjct: 9   IGNFILVAGSFLLLIVLIKKFAWGNITSIFEERAKKISDDIDSAESARQKAEELAQKREH 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +RA A  I++     AE+N         ++     + A  EI   + +A   +   
Sbjct: 69  ELAGSRAEAVTIVETAKETAEKNKAGILANAAEEAGRLKAKANQEIAQNKAEAMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|322688425|ref|YP_004208159.1| ATP synthase subunit beta [Bifidobacterium longum subsp. infantis
           157F]
 gi|320459761|dbj|BAJ70381.1| ATP synthase subunit B [Bifidobacterium longum subsp. infantis
           157F]
          Length = 172

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/153 (26%), Positives = 70/153 (45%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  II  I     ++F +P+ ++I + R   I  +  K + A+++ +   + YE  L+
Sbjct: 18  IVWSLIILVIVAVFFYKFFMPKFNAIFDERAAKIQGNIAKAEQARKDADEAKAKYEAQLS 77

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D   A A   +   R   E D     ++AQ  I+   ++A   +   VG 
Sbjct: 78  TARVDAAKIRDDARAEASHIIADARSRAESDAAQITASAQRSIESQHQQAIVSLKGEVGA 137

Query: 145 VTKDLVRKL-GFSVSDADVQ-KILDRKRDGIDA 175
           +   L  K+ G  + D+DVQ  ++D   D + A
Sbjct: 138 LATALAGKILGAKLEDSDVQSSMIDSMIDDLGA 170


>gi|260774966|ref|ZP_05883866.1| ATP synthase B chain [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609056|gb|EEX35215.1| ATP synthase B chain [Vibrio coralliilyticus ATCC BAA-450]
          Length = 156

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/142 (21%), Positives = 63/142 (44%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P L   +E R+  I+   +  + A ++++   ++  E +  A+ 
Sbjct: 11  AISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASEQMKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q L+  RE  + +    LS A+ E++  + +A  E+   V  +   
Sbjct: 71  TATEVIEQANKRKAQILDEAREEAQAERQKILSQAEAELEAERNRARDELRKQVATLAVA 130

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D  K +    
Sbjct: 131 GAEKIIERSIDKDAHKDILDNI 152


>gi|295107522|emb|CBL05065.1| ATP synthase F0 subcomplex B subunit [Gordonibacter pamelaeae
           7-10-1-b]
          Length = 194

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 71/150 (47%), Gaps = 1/150 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
           + +IF + + V  +   P+  +++  R  +I    EK + A+ E E ++  Y   LA A+
Sbjct: 42  MLVIFILLWIVLAKLGWPKFEAMLSKRETMIKDALEKSEEARIESERVLEEYRVQLADAK 101

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
           A A +I+       E          + +    ++ A+  I+  +K A  E+ S V + + 
Sbjct: 102 AQAAQIVADAKQTGEAAKADITAKAQSEATDMIAKARTAIEAEKKAAIAELQSSVADTSV 161

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGIDAF 176
            +  + +G  +S+++ +K+++R  +   +F
Sbjct: 162 AVAARLIGEDLSESEHRKMIERYVNEAGSF 191


>gi|330961490|gb|EGH61750.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 156

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + +  R+  I+   +    A R++E       + L  A+  
Sbjct: 12  VAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDKVGQQLREAKTQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + AQ EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNSVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|231608|sp|P21904|ATPF_PROMO RecName: Full=ATP synthase subunit b, sodium ion specific; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I; AltName: Full=F-type ATPase
           subunit b; Short=F-ATPase subunit b
 gi|581457|emb|CAA37913.1| unnamed protein product [Propionigenium modestum]
          Length = 168

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 66/153 (43%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +   ++    ++ +++ R+  I++D ++ +  K          +  +
Sbjct: 14  NMFWQIINFLILMFFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIV 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A+  A E++ +    A++  E   +         L +A+ EI+ M+++A +E+   V 
Sbjct: 74  KSAKTEANEMLLRAEKKADERKETILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVT 133

Query: 144 EVTKDLVRKLGFSVSDADVQK-ILDRKRDGIDA 175
           ++   L  K+     DA +   +LD+    +  
Sbjct: 134 DLAVKLAEKMINEKVDAKIGANLLDQFIGEVGE 166


>gi|322372409|ref|ZP_08046945.1| ATP synthase F0, B subunit [Streptococcus sp. C150]
 gi|321277451|gb|EFX54520.1| ATP synthase F0, B subunit [Streptococcus sp. C150]
          Length = 165

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 62/163 (38%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                 ST L           + Y++  +F   +++ I   R   I++D +  ++A++E 
Sbjct: 1   MSLLINSTTLGNIIITLGSVFLLYYLIRKFAWDQITGIFAAREKKIATDIDSAENARQEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ES+    ++ LA AR  A +IID      +            +       A  +I   + 
Sbjct: 61  ESLAQKRQDELAGARTEAAQIIDGAKETGKTQESKIIAEAHDEAKRLKDKANQDIAQSRV 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
           +A   V   V ++T  L  K+   ++       ++D   D + 
Sbjct: 121 EALAGVKGEVADLTVLLAEKVMKQNLDAKAQSDLIDSYLDQLG 163


>gi|223041780|ref|ZP_03611971.1| FOF1 ATP synthase subunit B [Actinobacillus minor 202]
 gi|240950015|ref|ZP_04754323.1| F0F1 ATP synthase subunit B [Actinobacillus minor NM305]
 gi|223017406|gb|EEF15826.1| FOF1 ATP synthase subunit B [Actinobacillus minor 202]
 gi|240295493|gb|EER46236.1| F0F1 ATP synthase subunit B [Actinobacillus minor NM305]
          Length = 156

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/150 (24%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F +F W   +F+ P L + +E R+  I+      + AK+E        E+ L 
Sbjct: 7   LIGQLIAFALFVWFCMKFVWPPLINAIETRQANIADALASAEKAKQEQADTKVLVEQELV 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A+ IID       + LE  +   E + L  +     E++  +K+  +E+   V  
Sbjct: 67  KAREEAQHIIDLATKRRNEILESVQAEAEAERLRIIEQGYAEVESERKRVQEELRQKVAA 126

Query: 145 VTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
           +      K+ G SV  A    I+D+    +
Sbjct: 127 LAVAGAEKIVGRSVDAAANNDIIDKLVAEL 156


>gi|149200617|ref|ZP_01877621.1| ATP synthase F0, B subunit [Lentisphaera araneosa HTCC2155]
 gi|149136291|gb|EDM24740.1| ATP synthase F0, B subunit [Lentisphaera araneosa HTCC2155]
          Length = 190

 Score = 76.4 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/170 (16%), Positives = 66/170 (38%), Gaps = 2/170 (1%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           M + ++    +     + +  ++   W  I F    +V  +     + + ++ R   I  
Sbjct: 19  MPTMAAGGADAGQYGENAAIPMAIISW--ICFFSLLFVGGKIAWKPILANLDARETRIRE 76

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             E  D    ++    +S ++ ++ A A AK I+      A++  +   +  + +     
Sbjct: 77  SLENADRIDSQLADTEASTKKLISDAEASAKSIVTGAKETAQKLAKEINDTAKAEAQSLR 136

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKR 170
            NA  +I++ + KA   +     E+   L  KL     D++  ++L  K 
Sbjct: 137 ENALKDIENARAKAVSSLRDESAELAVTLAGKLIGENLDSEKSRVLTDKI 186


>gi|253582458|ref|ZP_04859680.1| ATP synthase, B chain [Fusobacterium varium ATCC 27725]
 gi|251835603|gb|EES64142.1| ATP synthase, B chain [Fusobacterium varium ATCC 27725]
          Length = 168

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 62/153 (40%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    L  ++E R+  I+SD  + ++ K     +    E+ L
Sbjct: 14  NMFWQIINFFILVFVFNKYFKKPLGKMLEARKTKITSDLNEANANKEAAMKLQKEAEDIL 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A+  A EI+      A++  E      ++     +  A+ E   M+    +E+   V 
Sbjct: 74  KKAKYQANEILKTAEHKADERRENILNEAKEQRDKIIKTAELEAVKMKSDVRKELQDEVK 133

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           ++   L  KL    ++      ++D   + +  
Sbjct: 134 DLAVRLAEKLIEEKINPKLESTLIDEFIEEVGE 166


>gi|322389183|ref|ZP_08062744.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
 gi|321144088|gb|EFX39505.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           903]
          Length = 164

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 72/155 (46%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    ++ I+E R   I+ D +  +SA+++ E + S  EE
Sbjct: 9   IGNFILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  A  I++     AE+N         ++ +     AQ EI   +++A   +   
Sbjct: 69  ELAGSRKEAASIVENAKETAEKNKSQILSEATQEAVRLKEKAQQEIAHNKEEALNSIKGD 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T +L  KL    +     ++++DR  D +  
Sbjct: 129 VADLTVNLAGKLLSQQLDAEGQRQLIDRYLDELGE 163


>gi|83594573|ref|YP_428325.1| H+-transporting two-sector ATPase, subunit B/B' [Rhodospirillum
           rubrum ATCC 11170]
 gi|114626|sp|P15013|ATPF_RHORU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b; Flags: Precursor
 gi|123525687|sp|Q2RPA7|ATPF_RHORT RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46374|emb|CAA31249.1| ATPase F-0-subunit b (AA 1 - 182) [Rhodospirillum rubrum]
 gi|152602|gb|AAA26458.1| ATP synthase F-0 sector, b subunit [Rhodospirillum rubrum]
 gi|83577487|gb|ABC24038.1| H+-transporting two-sector ATPase, B/B' subunit [Rhodospirillum
           rubrum ATCC 11170]
          Length = 182

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 65/176 (36%), Gaps = 1/176 (0%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +A ++ +             F    FW++I F +     +     ++   ++ R   + +
Sbjct: 4   LALAAETAEHGGEAASHGGLFADPAFWVSIAFLMVVGFVYIKAKNKILGALDGRGAAVKA 63

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             ++    + + +++++ Y+     A   A EII      A +         E  +  + 
Sbjct: 64  KLDEARKLRDDAQALLAEYQRRQRDAMKEADEIIRHAKDEAARLRAKAEADLEASIRRRE 123

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
             A + I   + +A  +V +   +V     R L   S++ AD  +++D     +  
Sbjct: 124 QQAVDRIAQAEAQALAQVRNEAVDVAVSAARSLMAGSLAKADQNRLIDAAIADLPG 179


>gi|77166524|ref|YP_345049.1| F0F1 ATP synthase subunit B [Nitrosococcus oceani ATCC 19707]
 gi|123593194|sp|Q3J6M7|ATPF_NITOC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|76884838|gb|ABA59519.1| ATP synthase F0 subcomplex B subunit [Nitrosococcus oceani ATCC
           19707]
          Length = 156

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 61/150 (40%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + FGI  W  +RF+   L+++ME R+  ++      +  K E E      +E+L 
Sbjct: 7   LIGQMVAFGILVWFVNRFLWGPLTNLMEERKKRVADGLAAAERGKHERELAEKRAKETLH 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII +    A + +E  +E  + +      +A  EI     +A +++   V  
Sbjct: 67  EAKEKAAEIITQAQKRAGEIIEEAKEAAQAEGERLKVSANAEIQQEMNRAREDLRGQVVS 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    + +   + ++      I
Sbjct: 127 IAVAGASKILKRELDEKANEALVKELVAQI 156


>gi|303237187|ref|ZP_07323757.1| ATP synthase F0, B subunit [Prevotella disiens FB035-09AN]
 gi|302482574|gb|EFL45599.1| ATP synthase F0, B subunit [Prevotella disiens FB035-09AN]
          Length = 170

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/155 (14%), Positives = 67/155 (43%), Gaps = 2/155 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
              FW+ ++F I   +  +F  P + +++  R+  I     K   A +++ ++    E  
Sbjct: 9   GLLFWMTLVFLIVAVIVIKFGFPVIINMVNERKEYIDDSLRKAKEANQKLSNIQKEGESV 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           +  AR     ++ +  A  +  +   ++   ++    ++ A+ EI+  ++ A  ++   V
Sbjct: 69  MQQAREQQALLLKEATATRDAIVGKAQDKAHEESARIIAEAKTEIEAEKQNAFNDIRGQV 128

Query: 143 GEVTKDLVRKL--GFSVSDADVQKILDRKRDGIDA 175
            E++  +  ++  G    +    +++ +  D + +
Sbjct: 129 AEISVKVAEQILRGQLADNDKQMELIGKLLDNVSS 163


>gi|260663292|ref|ZP_05864183.1| ATP synthase F0, B subunit [Lactobacillus fermentum 28-3-CHN]
 gi|260552144|gb|EEX25196.1| ATP synthase F0, B subunit [Lactobacillus fermentum 28-3-CHN]
          Length = 168

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 67/157 (42%), Gaps = 1/157 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           +L    +  + F I   +   F    ++ +M+ R + I++D +    ++ E + + +  +
Sbjct: 11  YLGDMLFYLVSFLIMAALVWHFAWKPVTQMMQKRADKIANDIDSAAQSREEAQKLAAKRQ 70

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  +R  A  I+D    A E          ++D  +  + AQ + +  ++ A +    
Sbjct: 71  EELKGSRQEAATIVDNAKQAGESQRAEIIARAQQDAQNLKNQAQKDAEQARQDALRGAKE 130

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDAF 176
            +  ++ ++  KL    ++  D Q ++D   +G+   
Sbjct: 131 DIANLSIEIASKLIHKQLNADDQQALIDTYIEGLVKH 167


>gi|66048349|ref|YP_238190.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae
           B728a]
 gi|302185827|ref|ZP_07262500.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae 642]
 gi|81307752|sp|Q4ZL20|ATPF_PSEU2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|63259056|gb|AAY40152.1| ATP synthase F0, subunit B [Pseudomonas syringae pv. syringae
           B728a]
 gi|330970312|gb|EGH70378.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 156

 Score = 76.4 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + AQ EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|291437212|ref|ZP_06576602.1| H(+)-transporting two-sector ATPase chain b protein [Streptomyces
           ghanaensis ATCC 14672]
 gi|291340107|gb|EFE67063.1| H(+)-transporting two-sector ATPase chain b protein [Streptomyces
           ghanaensis ATCC 14672]
          Length = 181

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 27  LLAFVIVFGFLAKKLLPNINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 86

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +++  +K AS  +   +G++  D
Sbjct: 87  EAARLRQEAQEQGAALIAEMRAEGQRQREEIIAAGHTQVEADRKAASAALRQDIGKLATD 146

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   +++DR  D ++ 
Sbjct: 147 LAGKLVGESLEDHARQSRVIDRFLDQLEE 175


>gi|59713175|ref|YP_205951.1| F0F1 ATP synthase subunit B [Vibrio fischeri ES114]
 gi|197334093|ref|YP_002157355.1| ATP synthase F0, B subunit [Vibrio fischeri MJ11]
 gi|75353171|sp|Q5E1N3|ATPF_VIBF1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226698356|sp|B5FCZ5|ATPF_VIBFM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|59481276|gb|AAW87063.1| ATP synthase F0, B subunit [Vibrio fischeri ES114]
 gi|197315583|gb|ACH65030.1| ATP synthase F0, B subunit [Vibrio fischeri MJ11]
          Length = 154

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 61/142 (42%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+      + A ++++   ++  + L  A+ 
Sbjct: 9   AIAFTLFVWFCMKYVWPPIMEAIEERQKKIADGLSAAERAAKDLDLAQANASDQLKEAKR 68

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q L+  RE    +    L+  + E++  + +A  E+   V  +   
Sbjct: 69  AATEIIEQANKRKSQILDEAREEALVERQKILTQGEAELESERNRARDELRKQVATLAVI 128

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D + QK +    
Sbjct: 129 GAEKILERSIDVEAQKDILDNI 150


>gi|167628986|ref|YP_001679485.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1]
 gi|226741468|sp|B0TI54|ATPF_HELMI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|167591726|gb|ABZ83474.1| ATP synthase f0, b subunit [Heliobacterium modesticaldum Ice1]
          Length = 169

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/149 (15%), Positives = 59/149 (39%), Gaps = 1/149 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
           + I F I  ++  +     +   ++ RR  +     + ++   E   M +     LA AR
Sbjct: 18  MLISFLILVFILQQVAFKPILKALDERRQKVEESISRAENDLEEANRMRAENAAELAKAR 77

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
             A ++I +     E+  +      + +       A  +I   ++KA +E+ S V  ++ 
Sbjct: 78  QEAHDLIARATKVGEEKAQEIVAAAQAEANRLKEKAVADIQREKEKALEELRSHVVNLSI 137

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGIDA 175
               K +  ++ +   ++++D   + +  
Sbjct: 138 LAAEKVIRKNLDEPTQRQLVDEVINEVGK 166


>gi|290580099|ref|YP_003484491.1| FoF1 membrane-bound proton-translocating ATPase b subunit
           [Streptococcus mutans NN2025]
 gi|1773262|gb|AAD13379.1| ATPase, b subunit [Streptococcus mutans]
 gi|254996998|dbj|BAH87599.1| FoF1 membrane-bound proton-translocating ATPase b subunit
           [Streptococcus mutans NN2025]
          Length = 165

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 61/163 (37%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                  T L     +   F +   +  +F   +L++I + R   I+ D +  +++++  
Sbjct: 1   MSTLINGTSLGNLLIVTGSFILLLLLVKKFAWSQLAAIFKTREEKIAKDIDDAENSRQNA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           + + +  +  L  A+  A +IID      +           ++       A  +I   + 
Sbjct: 61  QVLENKRQVELNQAKDEAAQIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +A   V + V +++  L  K+   ++       ++D   D + 
Sbjct: 121 EALSSVKADVADLSVLLAEKIMAKNLDKTAQGDLIDSYLDKLG 163


>gi|28872702|ref|NP_795321.1| ATP synthase F0 subunit B [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213968455|ref|ZP_03396598.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato T1]
 gi|301384258|ref|ZP_07232676.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato Max13]
 gi|302063891|ref|ZP_07255432.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato K40]
 gi|302131975|ref|ZP_07257965.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|81728855|sp|Q87TT0|ATPF_PSESM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|28855958|gb|AAO59016.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213926743|gb|EEB60295.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. tomato T1]
 gi|330876340|gb|EGH10489.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|331017740|gb|EGH97796.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDKVGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + AQ EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|83649677|ref|YP_438112.1| F0F1 ATP synthase subunit B [Hahella chejuensis KCTC 2396]
 gi|123529926|sp|Q2S6N7|ATPF_HAHCH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|83637720|gb|ABC33687.1| F0F1-type ATP synthase, subunit b [Hahella chejuensis KCTC 2396]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F IF     +++ P +   +  R   I+   +  + A++++E       + L  A+ 
Sbjct: 11  AIAFFIFVVFCMKYVWPPVIQALREREKKIADGLQAAEHAQKDLELAQEKVAKQLREAKQ 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++    A Q LE  ++    +    ++ A+ EID  + +A + + + V  +   
Sbjct: 71  QAAEIIEQANKRANQMLEEAKDQARTEGERLITAAKAEIDQEKNRAKESLRAEVAALALA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   SV       +LD+    +
Sbjct: 131 GAEKILETSVDAGAHSNMLDKLAAEL 156


>gi|300721118|ref|YP_003710386.1| membrane-bound ATP synthase, F0 sector subunit b [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627603|emb|CBJ88122.1| membrane-bound ATP synthase, F0 sector, subunit b [Xenorhabdus
           nematophila ATCC 19061]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               A  F +F     +++ P + + +E R+  I+      + AK+ ++   ++  + L 
Sbjct: 7   ILGQAFAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLASAERAKKNLDLAQANATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q ++  +   E +    L  A  EI+  +K+A +E+   V  
Sbjct: 67  KAKADAQVIIEQANKQKAQIIDDAKAEAELERNKILVQANAEIEAERKRAREELRKQVAM 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAIAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|322387997|ref|ZP_08061604.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
 gi|321141270|gb|EFX36768.1| ATP synthase F0 sector subunit B [Streptococcus infantis ATCC
           700779]
          Length = 164

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/161 (22%), Positives = 73/161 (45%), Gaps = 1/161 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
              ST +  F  +A  F +  ++  ++    ++S+++ R   ISSD +  + A+++ E +
Sbjct: 3   LTISTIIGDFILIAGSFLLLIFLVKKYAWGNITSVLDERAEKISSDIDGAEEARKKAEEL 62

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
            S  E  LA +R  AK II+     AE++        + +       A  EI   + +A 
Sbjct: 63  ASKREAELAGSRTEAKTIIENAKETAEKSKADILAEAKLEAGRLKEKANQEIAQNKAEAL 122

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           Q V   V ++T  L  K+   ++     ++++D+  D +  
Sbjct: 123 QSVKGDVADLTISLAGKIISQNLDGQAHKELIDQYIDQLGE 163


>gi|296876804|ref|ZP_06900852.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|312867266|ref|ZP_07727476.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
 gi|296432306|gb|EFH18105.1| ATP synthase F0 sector subunit B [Streptococcus parasanguinis ATCC
           15912]
 gi|311097395|gb|EFQ55629.1| ATP synthase F0, B subunit [Streptococcus parasanguinis F0405]
          Length = 164

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 72/155 (46%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    ++ I+E R   I+ D +  +SA+++ E + S  EE
Sbjct: 9   IGNFILIAGSFLLLIFLIKKFAWNNINGILEARAKKITDDIDGAESARQKAEELASKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  A  I++     AE+N         ++ +     AQ EI   +++A   +   
Sbjct: 69  ELAGSRKEAASIVENAKETAEKNKSQILSEATQEAVRLKEKAQQEIAHNKEEALNSIKGD 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T +L  KL    +     ++++DR  D +  
Sbjct: 129 VADLTVNLASKLLSQQLDAEGQRQLIDRYLDELGE 163


>gi|104773791|ref|YP_618771.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513797|ref|YP_812703.1| F0F1 ATP synthase subunit B [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122275433|sp|Q04BA7|ATPF_LACDB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122397274|sp|Q1GAW9|ATPF_LACDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|103422872|emb|CAI97534.1| H+ transporting ATPase / ATP synthase, B subunit [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116093112|gb|ABJ58265.1| ATP synthase F0 subcomplex B subunit [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|325125455|gb|ADY84785.1| H+-transporting ATP synthase chain B [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
          Length = 168

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 65/149 (43%), Gaps = 1/149 (0%)

Query: 27  WLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIA 86
           W  I+F I       +    +  +ME RR  +  D ++  S +++ E++ +  E +L  +
Sbjct: 19  WYLIVFSILLLAVKHYAWGPVKDMMEKRRQKVIDDLDQAASDRKKAETLANEREAALKNS 78

Query: 87  RAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVT 146
           R  A +I+    + A++  +        +       A+ +    +  A  E    V +++
Sbjct: 79  RQEATQILSDAKSNAQKTGKQIVSEAMAEASAIREKAKADAAQAETDALNEAREEVADLS 138

Query: 147 KDLVRK-LGFSVSDADVQKILDRKRDGID 174
             +  K +  ++S AD + ++D+   G++
Sbjct: 139 VTIAEKVIAKNLSAADQKDLVDQFIKGLN 167


>gi|228478369|ref|ZP_04062977.1| ATP synthase F0, B subunit [Streptococcus salivarius SK126]
 gi|312864174|ref|ZP_07724408.1| ATP synthase F0, B subunit [Streptococcus vestibularis F0396]
 gi|322517280|ref|ZP_08070157.1| ATP synthase F0 sector subunit B [Streptococcus vestibularis ATCC
           49124]
 gi|228250048|gb|EEK09318.1| ATP synthase F0, B subunit [Streptococcus salivarius SK126]
 gi|311100175|gb|EFQ58384.1| ATP synthase F0, B subunit [Streptococcus vestibularis F0396]
 gi|322124110|gb|EFX95649.1| ATP synthase F0 sector subunit B [Streptococcus vestibularis ATCC
           49124]
          Length = 165

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/163 (19%), Positives = 62/163 (38%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                 ST L           + Y++  +F   +++ I   R   I++D +  ++A++E 
Sbjct: 1   MSLLINSTTLGNIIITLGSVFLLYYLIRKFAWDQITGIFAAREKKIATDIDSAENARQEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           ES+    ++ LA AR  A +IID      +            +       A  +I   + 
Sbjct: 61  ESLAQKRQDELAGARTEAAQIIDGAKETGKTQESKIIAEAHDEAKRLKEKANQDIAQSRV 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
           +A   V   V ++T  L  K+   ++       ++D   D + 
Sbjct: 121 EALAGVKGEVADLTVLLAEKVMKQNLDAKAQSDLIDSYLDQLG 163


>gi|15616634|ref|NP_239846.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11131206|sp|P57120|ATPF_BUCAI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|25290590|pir||D84930 H+-transporting two-sector ATPase (EC 3.6.3.14) B chain [imported]
           - Buchnera sp. (strain APS)
 gi|10038697|dbj|BAB12732.1| ATP synthase B chain [Buchnera aphidicola str. APS (Acyrthosiphon
           pisum)]
          Length = 161

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   ++I P +   +E R+  I         A+ E+  +     +++ 
Sbjct: 7   ILGQAISFVLFVWFCMKYIWPPIILAIETRQKEIKESLTNAKKARDELYILEKKIHQNII 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  I++         LE  R    ++    + N Q+EI+     A + ++  V +
Sbjct: 67  DAKQKASNILNSANKQKVSILEDARNQALEESKKIILNTQSEINIAITHARKNLHKEVVD 126

Query: 145 VTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           ++  +  K+    +S  D Q++LD     +  
Sbjct: 127 LSISMAEKIIKKNISKDDNQELLDELVTSLSQ 158


>gi|317064912|ref|ZP_07929397.1| ATP synthase subunit B [Fusobacterium ulcerans ATCC 49185]
 gi|313690588|gb|EFS27423.1| ATP synthase subunit B [Fusobacterium ulcerans ATCC 49185]
          Length = 163

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    L  ++E R+  I+SD    +  K     +    EE L
Sbjct: 9   NMFWQIINFFILVFVFNKYFKKPLGKMLETRKAKITSDLNDANVNKEAAMKLQKEAEELL 68

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A+  A EI+      A++  E+     +      + NA+ E   M+    +E+   V 
Sbjct: 69  KKAKFQANEILKTAEHKADERREYILSEAKDQRDKIIKNAELEAVKMKSDVRKELQDEVK 128

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           ++   L  KL    ++      ++D   + +  
Sbjct: 129 DLAVRLAEKLIEEKINPKLESTLIDEFIEEVGE 161


>gi|257470707|ref|ZP_05634797.1| ATP synthase B chain, sodium ion specific [Fusobacterium ulcerans
           ATCC 49185]
          Length = 168

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    L  ++E R+  I+SD    +  K     +    EE L
Sbjct: 14  NMFWQIINFFILVFVFNKYFKKPLGKMLETRKAKITSDLNDANVNKEAAMKLQKEAEELL 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A+  A EI+      A++  E+     +      + NA+ E   M+    +E+   V 
Sbjct: 74  KKAKFQANEILKTAEHKADERREYILSEAKDQRDKIIKNAELEAVKMKSDVRKELQDEVK 133

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           ++   L  KL    ++      ++D   + +  
Sbjct: 134 DLAVRLAEKLIEEKINPKLESTLIDEFIEEVGE 166


>gi|297570963|ref|YP_003696737.1| ATP synthase F0 subunit beta [Arcanobacterium haemolyticum DSM
           20595]
 gi|296931310|gb|ADH92118.1| ATP synthase F0, B subunit [Arcanobacterium haemolyticum DSM 20595]
          Length = 186

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +    W  + F I     ++F  P   S ++ R   I +  +  D A+ E+    +  +E
Sbjct: 22  VPDLVWGTVAFLIVATAIYKFAWPAFMSTLDERAEKIENGLKAADIARAEITEERADLDE 81

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +  A   A++I +K  A A+  +   +     +    +  AQ  I      A + + S 
Sbjct: 82  QIRNAHRDAEQIREKATANAKSIVSDAQAQARTEAGQIIDTAQLRIVADTDAARRTLRSD 141

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKIL-DRKRDGIDA 175
           VG +  +L  ++ G S++D ++ K + DR  D ++A
Sbjct: 142 VGALATELASRIVGESLTDVELAKRVTDRFLDELEA 177


>gi|74318819|ref|YP_316559.1| F-type H+-transporting ATP synthase subunit B [Thiobacillus
           denitrificans ATCC 25259]
 gi|123611105|sp|Q3SF62|ATPF_THIDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|74058314|gb|AAZ98754.1| F-type H+-transporting ATP synthase, subunit B [Thiobacillus
           denitrificans ATCC 25259]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +     +I F  F W + +F+ P + + +E R+  I+      D  K E+E       
Sbjct: 3   FNATLIGQSITFIFFVWFSMKFVWPPIMNALETRKKQIADGLAAADRGKHELELAAKKAG 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           +++  A+A A E+I +    A Q +E  +   +++   +L+ AQ  I+    +A + +  
Sbjct: 63  DNMRDAKAQAAEVIAQAEKRAAQIVEEAKLAAKEEGDRQLAAAQANIEQEANRAREGLRE 122

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
            V  +      K+    V+      +L + +  +
Sbjct: 123 QVAALAVAGAEKILRREVNAQTHADLLSQLKAEL 156


>gi|226227894|ref|YP_002762000.1| ATP synthase subunit b [Gemmatimonas aurantiaca T-27]
 gi|226091085|dbj|BAH39530.1| ATP synthase subunit b [Gemmatimonas aurantiaca T-27]
          Length = 166

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 59/155 (38%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW  IIF + + V  +F    L + +E R   +    E     + E E+ ++    
Sbjct: 8   AGLMFWTLIIFALLFVVLAKFAFKPLFAAVEAREKALEDAIEGAKRDRAEAEAALAQQRA 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR  A+ II +  A AE+         +      +  A+  I+  +  A  E+   
Sbjct: 68  QLEAARTEAQGIIAESRATAEKMRTDLLAQTKHQQEEMIEQARRAIEGEKASAIAELRRE 127

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
             ++      ++   ++  A  ++I++     +D 
Sbjct: 128 AVDLAIAGASRVIEQNLDSAGNRQIVESFLASLDG 162


>gi|330505860|ref|YP_004382729.1| ATP synthase F0 subunit B [Pseudomonas mendocina NK-01]
 gi|328920146|gb|AEB60977.1| ATP synthase F0, B subunit [Pseudomonas mendocina NK-01]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 62/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + ++ R+  I+   +  + A R++E       + L  A+  
Sbjct: 12  VAFFIFVLFCMKFVWPPVITALQERQKKIADGLDAANRAARDLELAHEKVAQQLREAKGQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++    A Q ++  R+    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIIEQANKRAAQIVDEARDQARVEADRVKAQAQAEIEQEINGIKDALRAQVGSLAVSG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G S+      +++++    I
Sbjct: 132 AEKILGASIDQNAHAELVNKLAAEI 156


>gi|239928885|ref|ZP_04685838.1| F0F1 ATP synthase subunit B [Streptomyces ghanaensis ATCC 14672]
          Length = 170

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 67/149 (44%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F I +    + +LP ++ ++E RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 16  LLAFVIVFGFLAKKLLPNINKVLEERREAIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 75

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +  +        +   R   ++     ++    +++  +K AS  +   +G++  D
Sbjct: 76  EAARLRQEAQEQGAALIAEMRAEGQRQREEIIAAGHTQVEADRKAASAALRQDIGKLATD 135

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   +++DR  D ++ 
Sbjct: 136 LAGKLVGESLEDHARQSRVIDRFLDQLEE 164


>gi|298245827|ref|ZP_06969633.1| ATP synthase F0, B subunit [Ktedonobacter racemifer DSM 44963]
 gi|297553308|gb|EFH87173.1| ATP synthase F0, B subunit [Ktedonobacter racemifer DSM 44963]
          Length = 178

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 70/171 (40%), Gaps = 6/171 (3%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           +  + +S  S      + + F+SQ     I FG+ + +  R+  P L  IM+ R+ +I  
Sbjct: 4   LILAQASASSGGL-GINGAFFISQL----ISFGVVFLILWRWGFPALLKIMDKRQAIIRE 58

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
             E  + AKR++    +  E+ L  AR  + E I++    A+Q      E  +       
Sbjct: 59  GIENAEKAKRDLAEANNRAEQLLLEARRQSAETIERASKNAQQEANRIIEEAQARAEQVG 118

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKR 170
                 I     +A  E+   V  ++ +   K +  SV   D +++++   
Sbjct: 119 QQQIARIQQEANRARNELSRQVINLSIEAAGKVINKSVDSKDNRRLVEDFI 169


>gi|162146972|ref|YP_001601433.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544036|ref|YP_002276265.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|226741476|sp|A9HDM4|ATPF_GLUDA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|161785549|emb|CAP55120.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531713|gb|ACI51650.1| H+transporting two-sector ATPase B/B' subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 164

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 65/151 (43%), Gaps = 1/151 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           FW A+ F +F+ +  + +   L++ ++ R + I +D ++    +RE E M+         
Sbjct: 7   FWSAVAFVLFFVLFGKKLWTPLAAALDSRADRIRADLDEAARLRREAEQMLEDATRERET 66

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           A   A+ +++  +  A +  +  R   E     +   A++ I   ++ A +EV  +  +V
Sbjct: 67  AMVEARALVEHSLIEAARIADEARREAEAVATRREQMARDRIAASERSAVREVRQVAIDV 126

Query: 146 TKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
                R  L  ++       I+DR    + +
Sbjct: 127 AIQATRDVLATALPAGADHAIVDRAIADLPS 157


>gi|126667604|ref|ZP_01738573.1| F0F1 ATP synthase subunit B [Marinobacter sp. ELB17]
 gi|126627873|gb|EAZ98501.1| F0F1 ATP synthase subunit B [Marinobacter sp. ELB17]
          Length = 187

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 62/145 (42%), Gaps = 1/145 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF     + + P + + ++ R+  I+      D A+R++E       + L 
Sbjct: 7   ILGQAIAFFIFVVFCMKMVWPPVIAALQERQKKIADGLAASDRAERDLELAQEKSAQELR 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  +I++    A Q +E  ++   K+    +  A+ EI     +A + + + +G 
Sbjct: 67  EAKQQAAGLIEQANKRAAQIVEASKDDARKEGEKLIEQAKAEIVQELNQAREALRAEIGV 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDR 168
           +      K+   SV  +   ++L+ 
Sbjct: 127 IAIAGAEKILETSVDASKHNEMLEN 151


>gi|209696447|ref|YP_002264378.1| F0F1 ATP synthase subunit B [Aliivibrio salmonicida LFI1238]
 gi|226694433|sp|B6EHU1|ATPF_ALISL RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|208010401|emb|CAQ80747.1| ATP synthase B chain [Aliivibrio salmonicida LFI1238]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 62/142 (43%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P +   +E R+  I+      + A ++++   ++  + L  A+ 
Sbjct: 11  AIAFALFVWFCMKYVWPPIMEAIEERQKKIADGLSAAERAAKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q L+  RE    +  + L+  + E++  + +A  E+   V  +   
Sbjct: 71  AATEIIEQANKRKGQILDEAREEALTERQNILTQGEAELETERNRARDELRKQVATLAVI 130

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     + + QK +    
Sbjct: 131 GAEKILERSINLEAQKDILDNI 152


>gi|309390209|gb|ADO78089.1| ATP synthase F0, B subunit [Halanaerobium praevalens DSM 2228]
          Length = 166

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 67/150 (44%), Gaps = 1/150 (0%)

Query: 27  WLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIA 86
           W  + F +  ++  +F+   +  +++ R   I+ D +  ++ ++E E + + YE+ L  A
Sbjct: 10  WQLVNFFVLLFLLRKFLYAPIKGMLDQRAAQINGDLDDAEARRKEAEELKAKYEQKLKEA 69

Query: 87  RAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVT 146
            + A+EIID     A +  +      E+   +  +    EI+  +K+A+ E+   + + T
Sbjct: 70  HSEAQEIIDNAETRANKKAKEIINEAEEKAENLKAKKLEEIEQAKKEATAELRDSLADYT 129

Query: 147 KDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
                 L    +     Q+++    D +D 
Sbjct: 130 ILAANNLIQEQLDKEKHQQMIMSFIDDLDK 159


>gi|90413750|ref|ZP_01221738.1| ATP synthase subunit B [Photobacterium profundum 3TCK]
 gi|90325219|gb|EAS41716.1| ATP synthase subunit B [Photobacterium profundum 3TCK]
          Length = 156

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 58/136 (42%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F     +++ P L   +E R+  I+      D A +++    ++  + L  A+ 
Sbjct: 11  AIAFFLFVVFCMKYVWPPLMEAIEERQTKIADGLAAADRAAKDLNLAQANASDQLKDAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E+I++      Q ++  +   + +  + L+  Q EI+  + +A  ++   V  +   
Sbjct: 71  TASELIEQANKRKAQIIDEAKMEAQAERKNILAQGQAEIEAERNRARDDLRKQVATLAVI 130

Query: 149 LVRKLGFSVSDADVQK 164
              K+     D DV  
Sbjct: 131 GAEKIIERTIDKDVHA 146


>gi|116873897|ref|YP_850678.1| F0F1 ATP synthase subunit B [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461425|sp|A0ALL7|ATPF_LISW6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|116742775|emb|CAK21899.1| ATP synthase F0, B subunit [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 170

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 61/157 (38%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  +M+ R   I S+ +  + ++ + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+ +I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|407170|emb|CAA81449.1| Adenosine Triphosphatase [Streptococcus pneumoniae]
 gi|1589420|prf||2211259C F0F1 ATPase:SUBUNIT=b
          Length = 164

 Score = 76.0 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +   F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AEQ+        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENAKETAEQSKANILADAKVEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   ++++D+  D +  
Sbjct: 129 VADLTVSLAGKIISKNLDSHAHKELIDQYIDQLGE 163


>gi|153956283|ref|YP_001397048.1| F0F1 ATP synthase subunit B [Clostridium kluyveri DSM 555]
 gi|146349141|gb|EDK35677.1| AtpF [Clostridium kluyveri DSM 555]
          Length = 159

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 65/148 (43%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             I F + Y +   F    + +++  R+  I+S  +     +++ + +++ +E  L  +R
Sbjct: 11  TIINFVVLYIILRHFFFKPVDNVLTSRQQEINSKIKNAYENEKKSKELVTKHEALLKGSR 70

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              K I++     AEQ  E       ++    L  A+NE D  ++KA  ++ + V ++  
Sbjct: 71  EEGKNIVEGYKNKAEQISENVLNEARREAQLILDRAKNEADREREKAQDDIKNQVVDLAI 130

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            +  K L  S+ +   +K++      + 
Sbjct: 131 LVSSKALEGSIDEEQHRKLIKDFIAKVG 158


>gi|332143477|ref|YP_004429215.1| F0F1 ATP synthase subunit B [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553499|gb|AEB00218.1| F0F1 ATP synthase subunit B [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 156

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 70/154 (45%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F + F    I F +F     +++ P L + +E R+  I+   E  + A++++E   +   
Sbjct: 3   FNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  A+A A EII++    A Q ++ + +    +    +++   EI+  + +A +++  
Sbjct: 63  EQLKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYAEIEAERNRAKEDLRK 122

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
            V  +     +++    +  +    I+++    +
Sbjct: 123 QVSALAVAGAQQILQREIDASAQNDIVEKLVAEL 156


>gi|289435794|ref|YP_003465666.1| ATP synthase F0, B subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172038|emb|CBH28584.1| ATP synthase F0, B subunit [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 170

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 59/150 (39%), Gaps = 1/150 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           F+    F I   +   +    L  IM+ R   I S+ +  +  + + E +++  +  L  
Sbjct: 18  FFTLFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQAEQLLAEQKSVLQQ 77

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           AR  ++ +I+      E+  E   +   ++       A+ +I   ++ A   +   VG +
Sbjct: 78  ARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALREQVGSL 137

Query: 146 TKDLVRKLGFS-VSDADVQKILDRKRDGID 174
           +  +  K+    + + +   ++    + + 
Sbjct: 138 SVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|46908705|ref|YP_015094.1| F0F1 ATP synthase subunit B [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47094112|ref|ZP_00231836.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858]
 gi|226225081|ref|YP_002759188.1| H+-transporting ATP synthase chain b [Listeria monocytogenes
           Clip81459]
 gi|254825344|ref|ZP_05230345.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194]
 gi|254853938|ref|ZP_05243286.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503]
 gi|254932225|ref|ZP_05265584.1| F0F1 ATP synthase subunit B [Listeria monocytogenes HPB2262]
 gi|254993668|ref|ZP_05275858.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J2-064]
 gi|255519771|ref|ZP_05387008.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-175]
 gi|300764967|ref|ZP_07074955.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017]
 gi|81565274|sp|Q71WP5|ATPF_LISMF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|46881977|gb|AAT05271.1| ATP synthase F0, B subunit [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017519|gb|EAL08328.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 4b H7858]
 gi|225877543|emb|CAS06257.1| Putative H+-transporting ATP synthase chain b [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258607327|gb|EEW19935.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-503]
 gi|293583782|gb|EFF95814.1| F0F1 ATP synthase subunit B [Listeria monocytogenes HPB2262]
 gi|293594587|gb|EFG02348.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-194]
 gi|300514267|gb|EFK41326.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL N1-017]
 gi|308445536|gb|ADO32954.1| AtpF [Listeria monocytogenes]
 gi|332312963|gb|EGJ26058.1| ATP synthase subunit b [Listeria monocytogenes str. Scott A]
          Length = 170

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 62/157 (39%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  +M+ R   I S+ +  + ++ + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+++I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|38233642|ref|NP_939409.1| F0F1 ATP synthase subunit B [Corynebacterium diphtheriae NCTC
           13129]
 gi|81401538|sp|Q6NHT3|ATPF_CORDI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|38199902|emb|CAE49568.1| ATP synthase B chain [Corynebacterium diphtheriae]
          Length = 188

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  ++F I   +  +F+ P+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 30  IVWSLVVFIIVLILFWKFVRPKYQEVLTEREDRIKGGIQRAEAAQAEAKAALEKYNAQLA 89

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI ++  A  +Q     +    ++    + + + ++   +++   E+   +G+
Sbjct: 90  EARAEAAEIREEARAKGKQIEAEMKAKATEESNRIIESGEKQLAAQREQVVTELRREMGQ 149

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            +  L  +L       DV++   +D+    +D
Sbjct: 150 NSISLAERLLGDQLSDDVKRSGTIDKFLAELD 181


>gi|90409879|ref|ZP_01217896.1| hypothetical ATP synthase B chain [Photobacterium profundum 3TCK]
 gi|90329232|gb|EAS45489.1| hypothetical ATP synthase B chain [Photobacterium profundum 3TCK]
          Length = 156

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 76/146 (52%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F IF W+  +++ P L+++++ R+  I+    +MD A +E+E   ++ ++ +  A+ 
Sbjct: 11  AISFVIFVWLCMKYVWPPLTALIDERQREIAEGLSQMDLAAKELELAKANGDQLMVEAKQ 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +++++      Q +E  +   + +    ++  Q+E++  + +  QE+   + ++  +
Sbjct: 71  SASDLVEQGNKRRSQIIEDAKLEGDTEKARIIAQGQSELESERNRLRQELRQEMSDLVIE 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              KL   ++ +A  ++ +++    +
Sbjct: 131 SAEKLIKRNLDNAANREFVNKLITEM 156


>gi|71736509|ref|YP_277284.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257485612|ref|ZP_05639653.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289628227|ref|ZP_06461181.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649117|ref|ZP_06480460.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298489525|ref|ZP_07007534.1| ATP synthase B chain [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|123634474|sp|Q48BG1|ATPF_PSE14 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71557062|gb|AAZ36273.1| ATP synthase F0, B subunit [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298155952|gb|EFH97063.1| ATP synthase B chain [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|320321674|gb|EFW77773.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331123|gb|EFW87094.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330870062|gb|EGH04771.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330881921|gb|EGH16070.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330890264|gb|EGH22925.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. mori str.
           301020]
 gi|330952348|gb|EGH52608.1| F0F1 ATP synthase subunit B [Pseudomonas syringae Cit 7]
 gi|330987006|gb|EGH85109.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331011901|gb|EGH91957.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 156

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + AQ EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEARETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|226941918|ref|YP_002796992.1| AtpF [Laribacter hongkongensis HLHK9]
 gi|226716845|gb|ACO75983.1| AtpF [Laribacter hongkongensis HLHK9]
          Length = 156

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 62/143 (43%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F I  W T +F+ P L+++M+ R   I+      +  K+++E      +E + +A+ 
Sbjct: 11  AITFAILVWFTMKFVWPPLTNLMDERAKRIADGLAAAERGKQDLEQASKRVDEQIRLAKQ 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A E++      A Q ++  ++  + +    L +A+ +I     +A +++   V ++   
Sbjct: 71  QASELVLMAEKRAAQIVDEAKQAAKTESEKILVDARAQIGQEVLRAKEDLRGQVADLAVV 130

Query: 149 LVRKLGFSVSDADVQKILDRKRD 171
              K+     DA     L     
Sbjct: 131 GAEKILKREIDASKHADLLASIK 153


>gi|324993290|gb|EGC25210.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis SK405]
          Length = 164

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/154 (20%), Positives = 66/154 (42%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +  ++  +F    +  I++ R   IS D +  ++A+++ E +    EE
Sbjct: 9   IGNFILIAGSFLLLVFLIKKFAWGNIVGILDQRAQKISDDIDSAEAARKKAEDLAQKREE 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +LA +RA A  I++     AE+N         ++     + A  EI   + +    +   
Sbjct: 69  ALAGSRAEAVAIVETAKETAEKNKAGILADAVEEAGRLKAKANQEIAQNKAETMSSIKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           V ++T  L  K+    +      +++DR    + 
Sbjct: 129 VADLTVTLASKILSQELDKEAQSELIDRYIKQLG 162


>gi|121999212|ref|YP_001003999.1| F0F1 ATP synthase subunit B [Halorhodospira halophila SL1]
 gi|121590617|gb|ABM63197.1| ATP synthase F0, B subunit [Halorhodospira halophila SL1]
          Length = 146

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F +F W T +F+ P +   +  R+  I+      +  K E++   +  E  L  AR  
Sbjct: 2   ISFALFVWFTMKFVWPPIQQALADRQKQIADGLAAGERGKEELDKAQAEVEAMLRDAREQ 61

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A +II++      + +E  R     +    L++A+ EID   ++A +++   V  +    
Sbjct: 62  ASQIINQANKRQAEMIEEARAEARSEADRILASAREEIDQEIQRAREDLRKQVSTIAVQA 121

Query: 150 VRKLGF-SVSDADVQKILDRKRDGI 173
             ++    V     + ++D     I
Sbjct: 122 SSQILKREVDAKAHKDLIDELATQI 146


>gi|315304774|ref|ZP_07874944.1| ATP synthase F0, B subunit [Listeria ivanovii FSL F6-596]
 gi|313626853|gb|EFR95816.1| ATP synthase F0, B subunit [Listeria ivanovii FSL F6-596]
          Length = 170

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 60/150 (40%), Gaps = 1/150 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           F+    F I   +   +    L  IM+ R   I S+ +  + ++ + E +++  +  L  
Sbjct: 18  FFTLFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAEQKSVLQQ 77

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           AR  ++ +I+      E+  E   +   ++       A+ +I   ++ A   +   VG +
Sbjct: 78  ARVESQTMIENAKLLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISALREQVGSL 137

Query: 146 TKDLVRKLGFS-VSDADVQKILDRKRDGID 174
           +  +  K+    + + +   ++    + + 
Sbjct: 138 SVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|6625699|gb|AAF19358.1|AF188265_4 ATP synthase subunit b [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 156

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 70/150 (46%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI   +F     +++ P L + +E R+  I++     + A ++++   +S  + L 
Sbjct: 7   ILGQAIAIVLFVLFCMKYVWPPLMAAIEKRQKEIANGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   SV +A    I+D+    +
Sbjct: 127 LAVAGAEKIIERSVDEAANSDIVDKLVAEL 156


>gi|219856600|ref|YP_002473722.1| hypothetical protein CKR_3257 [Clostridium kluyveri NBRC 12016]
 gi|219570324|dbj|BAH08308.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 163

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 65/148 (43%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             I F + Y +   F    + +++  R+  I+S  +     +++ + +++ +E  L  +R
Sbjct: 15  TIINFVVLYIILRHFFFKPVDNVLTSRQQEINSKIKNAYENEKKSKELVTKHEALLKGSR 74

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              K I++     AEQ  E       ++    L  A+NE D  ++KA  ++ + V ++  
Sbjct: 75  EEGKNIVEGYKNKAEQISENVLNEARREAQLILDRAKNEADREREKAQDDIKNQVVDLAI 134

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            +  K L  S+ +   +K++      + 
Sbjct: 135 LVSSKALEGSIDEEQHRKLIKDFIAKVG 162


>gi|84385789|ref|ZP_00988819.1| hypothetical ATP synthase B chain [Vibrio splendidus 12B01]
 gi|86145160|ref|ZP_01063491.1| hypothetical ATP synthase B chain [Vibrio sp. MED222]
 gi|218676673|ref|YP_002395492.1| ATP synthase subunit B [Vibrio splendidus LGP32]
 gi|84379105|gb|EAP95958.1| hypothetical ATP synthase B chain [Vibrio splendidus 12B01]
 gi|85836737|gb|EAQ54857.1| hypothetical ATP synthase B chain [Vibrio sp. MED222]
 gi|218324941|emb|CAV26757.1| ATP synthase subunit B [Vibrio splendidus LGP32]
          Length = 156

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 73/149 (48%), Gaps = 1/149 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           F  AI F IF W+  +++ P L+++++ R+  I+      ++A +E+E   S+  + +A 
Sbjct: 8   FGQAISFVIFVWLCMKYVWPPLTAMLDERQKEIADGLRHSENAAKELELAKSNGAQLVAD 67

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           A+ +  E+I++      + +    +  E++    L   + E++  ++K  +E+ + + + 
Sbjct: 68  AKKNVTELIEQGKKRRNEIITLAHQEGEQEKARILEQGRAELEGERQKLRRELQADMADA 127

Query: 146 TKDLVRKLG-FSVSDADVQKILDRKRDGI 173
                +KL   ++     + ++D+    +
Sbjct: 128 VIQSAQKLISKNLDSETNRALVDQMISEL 156


>gi|152965234|ref|YP_001361018.1| ATP synthase F0, B subunit [Kineococcus radiotolerans SRS30216]
 gi|226741488|sp|A6W7G5|ATPF_KINRD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|151359751|gb|ABS02754.1| ATP synthase F0, B subunit [Kineococcus radiotolerans SRS30216]
          Length = 188

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 65/141 (46%), Gaps = 2/141 (1%)

Query: 36  YWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIID 95
           Y V  + ++PRL ++ E RR  I  + EK + A+ E +  +  Y+  LA AR  A  I +
Sbjct: 39  YAVIAKKVVPRLEAMYEERRAAIEGNVEKAEKAQAEAQVALEQYKAQLADARGEANRIRE 98

Query: 96  KVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGF 155
           +      Q L   RE  + +     + A+  I+  + +A+ ++ + VG +  DL  ++  
Sbjct: 99  EARQQGAQILAEMREQAQAESERITTAARATIEAERVQATAQLRAEVGRLATDLAGRIVG 158

Query: 156 SV--SDADVQKILDRKRDGID 174
                 A    ++DR    ++
Sbjct: 159 ESLQDSARQSGVVDRFLADLE 179


>gi|114322020|ref|YP_743703.1| F0F1 ATP synthase subunit B [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228414|gb|ABI58213.1| ATP synthase F0, B subunit [Alkalilimnicola ehrlichii MLHE-1]
          Length = 146

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 62/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F +F W T +++ P + + M  R+  I+      +  ++E++   S  ++ L  AR  
Sbjct: 2   ISFALFVWFTMKYVWPPIQTAMADRQKQIADGLAAGERGQKELDQAKSEVDKMLREAREQ 61

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A ++I +      + +E  RE   ++    L+ A++EID    +A   +   V  +    
Sbjct: 62  ASQVIAQANKRQSELVEQAREEARQEAERVLAQARSEIDTEISQARDALRKEVVNLAVAG 121

Query: 150 VRKLGF-SVSDADVQKILDRKRDGI 173
             ++    +     + ++D     +
Sbjct: 122 SSRILKREIDAKAHKDLIDDLVKQL 146


>gi|257785100|ref|YP_003180317.1| ATP synthase F0, B subunit [Atopobium parvulum DSM 20469]
 gi|257473607|gb|ACV51726.1| ATP synthase F0, B subunit [Atopobium parvulum DSM 20469]
          Length = 203

 Score = 75.6 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 59/147 (40%), Gaps = 1/147 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I + V  +F+ P +  +++ R+  I  D +    ++ E           +  A+ 
Sbjct: 52  LIAFLIIFAVVAKFVWPSVLRMLDKRQEKIQGDLDAAAKSREEANKDREIAAAGIDAAKQ 111

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EI+       E+      E  + + +  ++  +  ++  ++ A  E+   V ++  D
Sbjct: 112 QANEIVSAAKREGEEERARIIEQAKAEAVEIITKGKGVVESERRHAMAELSDSVVDLAVD 171

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGID 174
           +  K +G  +S    + + ++    + 
Sbjct: 172 IAGKIIGNELSVEQQRALAEKYLAEVG 198


>gi|16801738|ref|NP_472006.1| F0F1 ATP synthase subunit B [Listeria innocua Clip11262]
 gi|255023753|ref|ZP_05295739.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL J1-208]
 gi|81774204|sp|Q927W0|ATPF_LISIN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|16415213|emb|CAC97903.1| atpF [Listeria innocua Clip11262]
 gi|313622353|gb|EFR92833.1| ATP synthase F0, B subunit [Listeria innocua FSL J1-023]
          Length = 170

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/157 (13%), Positives = 61/157 (38%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  +M+ R   I S+ +  + ++ + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFAILLVLIRIYAWKPLMGVMKEREEHIGSEIDAAEESRAQAEQLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+ +I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKADIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|47096956|ref|ZP_00234532.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854]
 gi|217963364|ref|YP_002349042.1| ATP synthase F0, B subunit [Listeria monocytogenes HCC23]
 gi|254900329|ref|ZP_05260253.1| F0F1 ATP synthase subunit B [Listeria monocytogenes J0161]
 gi|254913432|ref|ZP_05263444.1| ATP synthase F0 [Listeria monocytogenes J2818]
 gi|254937813|ref|ZP_05269510.1| ATP synthase F0 [Listeria monocytogenes F6900]
 gi|290892696|ref|ZP_06555688.1| ATP synthase F0 [Listeria monocytogenes FSL J2-071]
 gi|47014666|gb|EAL05623.1| ATP synthase F0, B subunit [Listeria monocytogenes str. 1/2a F6854]
 gi|217332634|gb|ACK38428.1| ATP synthase F0, B subunit [Listeria monocytogenes HCC23]
 gi|258610417|gb|EEW23025.1| ATP synthase F0 [Listeria monocytogenes F6900]
 gi|290557756|gb|EFD91278.1| ATP synthase F0 [Listeria monocytogenes FSL J2-071]
 gi|293591439|gb|EFF99773.1| ATP synthase F0 [Listeria monocytogenes J2818]
 gi|307572060|emb|CAR85239.1| ATP synthase F0, B subunit [Listeria monocytogenes L99]
 gi|313606755|gb|EFR83455.1| ATP synthase F0, B subunit [Listeria monocytogenes FSL F2-208]
          Length = 170

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 62/157 (39%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  IM+ R   I S+ +  + ++ + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFSILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEESRAQAEQLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+++I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|289677533|ref|ZP_06498423.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. syringae FF5]
 gi|330898622|gb|EGH30041.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330937316|gb|EGH41322.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330976389|gb|EGH76446.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 156

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + A  EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEARETARVEADRVKAQAHAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|117618536|ref|YP_858683.1| F0F1 ATP synthase subunit B [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|226694386|sp|A0KQY2|ATPF_AERHH RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|117559943|gb|ABK36891.1| ATP synthase F0, B subunit [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 156

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F IF     +++ P L + +E R+  I+      + AK++++   ++  + L  A+ 
Sbjct: 11  AIAFFIFVVFCMKYVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKANATDQLKEAKL 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q ++        +    L+  + EI+  + +A +E+   V  +   
Sbjct: 71  QAAEIIEQANKRKAQIIDEAAAGAHSEREKILAQGRAEIEAERHRAKEELRKQVAALAIA 130

Query: 149 LVRKL-GFSVSDADVQKILDRKRDGI 173
              K+    +  A    I+D+    +
Sbjct: 131 GAEKILARQIDQAANSDIVDKLVAEL 156


>gi|293365285|ref|ZP_06612002.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307703825|ref|ZP_07640766.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
 gi|291316735|gb|EFE57171.1| ATP synthase F0 sector subunit B [Streptococcus oralis ATCC 35037]
 gi|307622660|gb|EFO01656.1| ATP synthase F0, B subunit [Streptococcus oralis ATCC 35037]
          Length = 164

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  ++    L+S+ E R N I++D +  + A+++ E++    E+
Sbjct: 9   IGNFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   ++++D+  D +  
Sbjct: 129 VADLTVSLAGKIISKNLDSHAHKELIDQYIDQLGE 163


>gi|221135165|ref|ZP_03561468.1| F0F1 ATP synthase subunit B [Glaciecola sp. HTCC2999]
          Length = 156

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +F+ P L   +E R+  I+   E  D A++++    +   E L 
Sbjct: 7   LIGQAIAFAVFVWFCMKFVWPPLLGAIEERQKKIADGLEASDRAEQDLADAQAQAAEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A +II++    A   ++ + +    +    ++    EI+  + +A +++   V  
Sbjct: 67  EAKAQAADIIEQAKKRANVLVDEETQRGHSEREKIIAQGYAEIEAERNRAKEDLRKQVSA 126

Query: 145 VTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
           +      K+    +       I+ +  D +
Sbjct: 127 LAIAGAEKILAREIDKDAQADIVAKLVDEL 156


>gi|224823528|ref|ZP_03696637.1| ATP synthase F0, B subunit [Lutiella nitroferrum 2002]
 gi|224603983|gb|EEG10157.1| ATP synthase F0, B subunit [Lutiella nitroferrum 2002]
          Length = 156

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 61/151 (40%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F +     AI F I  W T +F+ P L+++M+ R   I+      +  K+++E+      
Sbjct: 3   FNATLLGQAITFAILVWFTMKFVWPPLTNMMDERAKRIADGLAAAERGKQDLEAAEKRAG 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           + L  A+  A EI+      A Q +E  +E    +    ++ A+++ID    +A + +  
Sbjct: 63  DELRKAKQQATEIVMAAEKRASQIVEEAKETARTEGARLVAEAKSDIDQEVLRAKETLRE 122

Query: 141 IVGEVTKDLVRKLGFSVSDADVQKILDRKRD 171
            V  +      K+     D      L     
Sbjct: 123 HVASLAVAGAEKILRHEIDKAKHAELLASIK 153


>gi|257056932|ref|YP_003134764.1| ATP synthase F0 subcomplex B subunit [Saccharomonospora viridis DSM
           43017]
 gi|256586804|gb|ACU97937.1| ATP synthase F0 subcomplex B subunit [Saccharomonospora viridis DSM
           43017]
          Length = 182

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 2/155 (1%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           S+     I F +  +V  +F+ PR   + E R   I    EK + A+ E E  ++ Y+  
Sbjct: 16  SEIIIGLIAFLLLLFVMTKFVKPRFEKVYEERAAKIEGGIEKAEKAQAEAEQALAQYKAQ 75

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA AR+ A +I D   A AEQ  E  R   E++    ++  + ++   + +   E+   +
Sbjct: 76  LAEARSEAAKIRDDARAEAEQIKEELRAQAEEEARRIVAQGEAQLQAQRAQLIAELREDL 135

Query: 143 GEVTKDLVRKLGFSVSDADVQK--ILDRKRDGIDA 175
           G     L  ++     + + ++   +DR  D ++A
Sbjct: 136 GRNAVLLAGRIVGESLEDEARRRGTVDRFLDELEA 170


>gi|225376571|ref|ZP_03753792.1| hypothetical protein ROSEINA2194_02213 [Roseburia inulinivorans DSM
           16841]
 gi|225211608|gb|EEG93962.1| hypothetical protein ROSEINA2194_02213 [Roseburia inulinivorans DSM
           16841]
          Length = 168

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 61/142 (42%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
              +  I   I Y+   +F++  ++++ME RR +I            +   + S YE++L
Sbjct: 9   NVLFTIINLLILYFGLRKFLIKPVTNVMEQRRQMIEGQMADAKKTTEQANELKSQYEDAL 68

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A   +  I++K    A+   E +    +++    ++NA   ID  ++K  Q++ + + 
Sbjct: 69  KQAHDESAHIVEKARKTAQAEYESRVNAADQEAEKIIANAHKTIDLEREKTVQDLQTQIA 128

Query: 144 EVTKDLVRKLGFSVSDADVQKI 165
            +      K+      A+  K+
Sbjct: 129 GLAMMAAGKVLGKADAAEQNKL 150


>gi|118443791|ref|YP_879000.1| F0F1 ATP synthase subunit B [Clostridium novyi NT]
 gi|226741361|sp|A0Q2Z8|ATPF_CLONN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|118134247|gb|ABK61291.1| ATP synthase F0, B subunit [Clostridium novyi NT]
          Length = 159

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 68/157 (43%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +  +  F W  I F +   V   F+   ++ I++ R   I  D E+    K + E +  +
Sbjct: 2   NFSIPTFVWTIINFLLLLVVLSYFLFKPVNEIIDKRSKDIEGDIEQARIDKDKAEELRIA 61

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            EE    A+   K I++   A AE   E       K+    +  A+ EI   ++KA  E+
Sbjct: 62  NEEEYKAAKKEGKIIVENYKAKAENVSEEIISDAHKEAEIIIERAKKEIQREREKAEYEI 121

Query: 139 YSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
            +   E++ +L +K L  S+ +   +++++     + 
Sbjct: 122 KNKTIELSLELSKKALERSIDEKMHRELIEEFISKVG 158


>gi|45603|emb|CAA46896.1| ATPase b subunit [Propionigenium modestum]
 gi|45610|emb|CAA38580.1| ATPase b subunit [Propionigenium modestum]
 gi|45651|emb|CAA41370.1| F0 subunit [Propionigenium modestum]
          Length = 163

 Score = 75.6 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 66/153 (43%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +   ++    ++ +++ R+  I++D ++ +  K          +  +
Sbjct: 9   NMFWQIINFLILMFFFKKYFQKPIAKVLDARKEKIANDLKQAEIDKEMAAKANGEAQGIV 68

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A+  A E++ +    A++  E   +         L +A+ EI+ M+++A +E+   V 
Sbjct: 69  KSAKTEANEMLLRAEKKADERKETILKEANTQREKMLKSAEVEIEKMKEQARKELQLEVT 128

Query: 144 EVTKDLVRKLGFSVSDADVQK-ILDRKRDGIDA 175
           ++   L  K+     DA +   +LD+    +  
Sbjct: 129 DLAVKLAEKMINEKVDAKIGANLLDQFIGEVGE 161


>gi|330964194|gb|EGH64454.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFFIFVLFCMKYVWPPVIAALHERQKKIADGLDAASRAARDLELAQDKVGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++   E    +     + AQ EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEALETARVEADRVKAQAQAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|259046355|ref|ZP_05736756.1| ATP synthase B chain [Granulicatella adiacens ATCC 49175]
 gi|259036992|gb|EEW38247.1| ATP synthase B chain [Granulicatella adiacens ATCC 49175]
          Length = 168

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 76/160 (47%), Gaps = 1/160 (0%)

Query: 17  DTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMI 76
           +TST L     + +   +  ++   F   ++++++E RR+ IS D ++    K+  E + 
Sbjct: 9   NTSTVLGDTLVVLVSMTLLLFLVKYFAWDKVNAMLESRRDKISKDLDEAAEKKKAAEEIQ 68

Query: 77  SSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQ 136
           ++  E +  A     +I++    AA +  +   +  ++ +    +  Q E+D M+++A  
Sbjct: 69  ANANEIIHKAELKGSDILNNAREAASKTQDEMIKEGKEVVSRMKAEGQREVDSMKQRAIA 128

Query: 137 EVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           +V   + +++  L  ++    V+    Q++++    G++ 
Sbjct: 129 QVQDEIVDLSIQLASQILEKEVTKERHQEVIESFIKGLEG 168


>gi|327441432|dbj|BAK17797.1| F0F1-type ATP synthase, subunit b [Solibacillus silvestris StLB046]
          Length = 173

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 59/146 (40%), Gaps = 1/146 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             +IF     +  +F    L  IM  R  L++S  +  + AK+E ++++   +  L  AR
Sbjct: 23  TLVIFLGLMALLKKFAWGPLMGIMREREELVASGIDAAEKAKKETQALLEEQKSLLKEAR 82

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
             A+ II+      E   E        +      +A  +I+  ++KA   V   V  ++ 
Sbjct: 83  TEAQSIIENAKKQGEATREEIVVTARAEANRLKESAVRDIEAEREKAIAAVREEVVSLSV 142

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDG 172
               K LG  +S+AD   ++      
Sbjct: 143 LAASKVLGKEISEADNSALIKETIAK 168


>gi|269128117|ref|YP_003301487.1| ATP synthase F0 subunit B [Thermomonospora curvata DSM 43183]
 gi|268313075|gb|ACY99449.1| ATP synthase F0, B subunit [Thermomonospora curvata DSM 43183]
          Length = 182

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 74/156 (47%), Gaps = 2/156 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
            ++  +  I F I   V    ++P++   +  R + I    ++ + A+RE ++ ++ Y++
Sbjct: 19  PAELIFGTISFAIVLIVVGWKLVPQIQKTLAERTDAIEGGLKRAEEAQREAQATLAEYQK 78

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA ARA A  + +K      Q +   RE  + +    + +AQ  I+  +++A Q++ + 
Sbjct: 79  QLAEARAEAARLREKAREEGAQIVAQMREEAQAEARRIVESAQATIEAERQQALQQLRTE 138

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           VG +  +L  ++        A   +++DR    ++ 
Sbjct: 139 VGALAVELASRVVGEALADQAAQSRVIDRFLAELEE 174


>gi|213620860|ref|ZP_03373643.1| F0F1 ATP synthase subunit B [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
          Length = 145

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 63/139 (45%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P L + +E R+  I+      + A ++++   +S  + L 
Sbjct: 7   ILGQAIAFILFVWFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A+ II++      Q L+  +   E++    ++ AQ EI+  +K+A +E+   V  
Sbjct: 67  KAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQAQAEIEAERKRAREELRKQVAI 126

Query: 145 VTKDLVRKLGFSVSDADVQ 163
           +      K+     D    
Sbjct: 127 LAVAGAEKIIERSVDEAAN 145


>gi|24379921|ref|NP_721876.1| F0F1 ATP synthase subunit B [Streptococcus mutans UA159]
 gi|26006946|sp|P95785|ATPF_STRMU RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24377901|gb|AAN59182.1|AE014985_6 FoF1 membrane-bound proton-translocating ATPase, b subunit
           [Streptococcus mutans UA159]
          Length = 165

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/163 (14%), Positives = 61/163 (37%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                  T L     +   F +   +  +F   +L++I + R   I+ D +  +++++  
Sbjct: 1   MSTLINGTSLGNLLIVTGSFILLLLLVKKFAWSQLAAIFKAREEKIAKDIDDAENSRQNA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           + + +  +  L  A+  A +IID      +           ++       A  +I   + 
Sbjct: 61  QVLENKRQVELNQAKDEAAQIIDNAKETGKAQESKIITEAHEEAGRLKDKANQDIATSKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +A   V + V +++  L  K+   ++       ++D   D + 
Sbjct: 121 EALSSVKADVADLSVLLAEKIMAKNLDKTAQGDLIDSYLDKLG 163


>gi|322383106|ref|ZP_08056933.1| F0F1 ATP synthase subunit B-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321152768|gb|EFX45394.1| F0F1 ATP synthase subunit B-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/148 (20%), Positives = 68/148 (45%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
              F I YW+ +++    L  IME R  L+    +  ++ + + E +++  +E++  AR 
Sbjct: 4   IFAFAILYWLLNKYAFGPLFGIMEKRAELVQEQLKSAETNRTQAEQLVAEQKEAIQEARK 63

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  I+++   A+ +  E      ++D       A  +I+  + KA   +   VG+++  
Sbjct: 64  DAYNIVEQAKQASTRQAEEIVHKAKEDASRIKEEAVRDIESEKNKAIAALREQVGDMSVL 123

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +  K L   V   + QK++++    ++ 
Sbjct: 124 IASKVLEKEVDAGEQQKLVNQYLKEVEG 151


>gi|295425480|ref|ZP_06818173.1| ATP synthase F0 sector subunit B [Lactobacillus amylolyticus DSM
           11664]
 gi|295064819|gb|EFG55734.1| ATP synthase F0 sector subunit B [Lactobacillus amylolyticus DSM
           11664]
          Length = 168

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 26/155 (16%), Positives = 65/155 (41%), Gaps = 1/155 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           ++    W  ++F I   +   +    +S +ME RR  +  D +  +S +++ E + +  E
Sbjct: 13  YIGNTIWYLVVFAILMLLVKHYAWGPVSDMMEKRRQKVIEDLDSAESNRKKAEILANERE 72

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
            +L  +R  A +I+      A++           D       A+ +    +  A  +   
Sbjct: 73  AALKNSRQEATQILSDAKTNAQKIGSQIVADANNDAASIREKAEADAKKAKADAINDARR 132

Query: 141 IVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGID 174
            V +++  +  K +  ++S  D + ++D+   G++
Sbjct: 133 EVADISVAIAEKIIAKNLSAEDQKDLVDQFIKGLN 167


>gi|315128173|ref|YP_004070176.1| F0F1 ATP synthase subunit B [Pseudoalteromonas sp. SM9913]
 gi|315016686|gb|ADT70024.1| F0F1 ATP synthase subunit B [Pseudoalteromonas sp. SM9913]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +F     +++ P L+  +E R+  I       D A++++E       E L  A+A
Sbjct: 11  LIAFTVFVLFCMKYVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQHKAAEQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +II++    A   ++ +    +++    ++   +EI+  + + ++E+   V  +   
Sbjct: 71  QAADIIEQAKKRAVLIVDEETVRGQQEREKIIAQGHSEIESERNRVTEELRKKVATLAVV 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              ++    ++ A    I+++    +
Sbjct: 131 GAERILEREINQAAHSDIVEKLVAEL 156


>gi|308051491|ref|YP_003915057.1| ATP synthase F0 subcomplex B subunit [Ferrimonas balearica DSM
           9799]
 gi|307633681|gb|ADN77983.1| ATP synthase F0 subcomplex B subunit [Ferrimonas balearica DSM
           9799]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 60/150 (40%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F IF W   +F+ P L + +E R+  I+      + A ++++       + + 
Sbjct: 7   LIGQAIAFIIFVWFCMKFVWPPLLAAIEERQKKIADGLANAERASKDLDLAQLKATDQIK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
             +  A EII++      Q +E  +   E      ++    EI+  + +A  ++ + V  
Sbjct: 67  EGKQQAAEIIEQANKRGAQIVEEAKAEAEAVRAKIIAQGHAEIEAERNRARDQLRAQVAT 126

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
           +      K+   S+       I+++    +
Sbjct: 127 LAVAGAEKILQRSIDADAHSDIVEKLAAEL 156


>gi|291615440|ref|YP_003525597.1| ATP synthase F0, B subunit [Sideroxydans lithotrophicus ES-1]
 gi|291585552|gb|ADE13210.1| ATP synthase F0, B subunit [Sideroxydans lithotrophicus ES-1]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I+F +F W   +F+   + + ++ R+  I+      + AK+++E       E L  A+ 
Sbjct: 11  TIMFVLFVWFCMKFVWTPIVAALDARKKQIADGLADAERAKQDLELASKRSAEILREAKE 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EI+      A + +E  +   + +    ++ A+ EID    +A +++ + V  +   
Sbjct: 71  KAGEIVANGEKRASEIVEEAKGQAKLEGDRIIAGAKAEIDQEVFRAKEQLRTQVSAIALA 130

Query: 149 LVRKL-GFSVSDADVQKILDRKRDGI 173
              K+ G  +       +LD+    I
Sbjct: 131 GAGKILGREIDAKAHNDLLDKLVAEI 156


>gi|229817109|ref|ZP_04447391.1| hypothetical protein BIFANG_02366 [Bifidobacterium angulatum DSM
           20098]
 gi|229784898|gb|EEP21012.1| hypothetical protein BIFANG_02366 [Bifidobacterium angulatum DSM
           20098]
          Length = 174

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 66/153 (43%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W AII  I     ++F LP+  ++ + R   I     K + A+++ ++  + YE  L+
Sbjct: 19  IVWSAIILVIVALFFYKFFLPKFQAVFDERAAKIEGGIAKAEQAQKDADAAKAKYEAQLS 78

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +I D     A   +   R   E D     ++AQ  I   Q++A   +   VG 
Sbjct: 79  NARVEASKIRDDARTEASHIVADARSRAEADANQITASAQRAIASQQQQALVSLKGEVGA 138

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +   L  K+  S    +     ++D+  D +D+
Sbjct: 139 LATALAGKILGSELQDEKVQSSMIDQMIDSMDS 171


>gi|119776780|ref|YP_929520.1| F0F1 ATP synthase subunit B [Shewanella amazonensis SB2B]
 gi|226694475|sp|A1SBU4|ATPF_SHEAM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119769280|gb|ABM01851.1| ATP synthase F0, B subunit [Shewanella amazonensis SB2B]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 63/150 (42%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F IF W   +++ P L + +E R+  I+      D A +++E   +   E L 
Sbjct: 7   LIGQTVAFIIFVWFCMKYVWPPLMNAIEERQKRIADGLANADRAAKDLELAQAKATEQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A EII+       Q +E  +   + +    ++  + EI+  + +  +E+   V  
Sbjct: 67  EAKATANEIIESANKRKAQIVEEAKAEADAERARIIAQGKAEIEAERNRVKEELRKQVAT 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   S+  A    I+++    I
Sbjct: 127 LALAGAEKILERSIDAAAHSDIVEKLVAEI 156


>gi|322392089|ref|ZP_08065551.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
 gi|321144989|gb|EFX40388.1| ATP synthase F0 sector subunit B [Streptococcus peroris ATCC
           700780]
          Length = 164

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 70/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    L+SI E R   I++D +  + A+++ E++    E+
Sbjct: 9   IGNFILIAGSFILLIVLVKKFAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK IID     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIDNAKDTAEKSKADILAEAKLEAGRLKDKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T  L  K+   ++     ++++D+  D +  
Sbjct: 129 VADLTVSLAGKIISKNLDGHAHKELIDQYIDQLGE 163


>gi|310778007|ref|YP_003966340.1| ATP synthase F0, B subunit [Ilyobacter polytropus DSM 2926]
 gi|309747330|gb|ADO81992.1| ATP synthase F0, B subunit [Ilyobacter polytropus DSM 2926]
          Length = 168

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +   ++    +S +++ R+  I+++ ++ ++ ++         +  L
Sbjct: 14  NMFWQIINFLILMFFFKKYFQKPISKMLDARKEKIANELKQAETDRKMAAEANEETQGIL 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             A+A A EI+ +    A++  E   +         + +A+ E++ M+K+A +E+ S V 
Sbjct: 74  KAAKAEANEILLRAEKKADERKETILKEANAQREKTIKSAELEVEKMKKQARKELQSEVT 133

Query: 144 EVTKDLVRKLGFSVSDADV-QKILDRKRDGIDA 175
            +   L  K+     D+ + + +L+   + +  
Sbjct: 134 ALAVSLAEKMINERLDSKLGENLLNDFIEEVGE 166


>gi|262273116|ref|ZP_06050933.1| ATP synthase B chain [Grimontia hollisae CIP 101886]
 gi|262222872|gb|EEY74180.1| ATP synthase B chain [Grimontia hollisae CIP 101886]
          Length = 156

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 66/150 (44%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   +++ P +   +E R+  I+      + A ++++   ++  + L 
Sbjct: 7   LIGQAIAFTMFVWFCMKYVWPPIMQAIEERQKKIADGLAAAERAAKDLDLAQANASDQLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII+       Q L+  RE  + +  + L+  + E++  + +A  E+   V  
Sbjct: 67  EAKRAASEIIESANKRKAQILDEAREEAKAERENILNQGKAELEAERNRARDELRKQVAT 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+   S+ +   + ILD+    +
Sbjct: 127 LAVMGAEKILERSIDENAHKDILDKITAEL 156


>gi|251782138|ref|YP_002996440.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390767|dbj|BAH81226.1| ATP synthase B chain [Streptococcus dysgalactiae subsp. equisimilis
           GGS_124]
 gi|323126992|gb|ADX24289.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 164

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 62/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     +   +  +F    + SI++ R   IS D ++ + ++   + + +  + 
Sbjct: 9   VGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAESQA 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +L  +R+ A +II       +   +        +       A  +I+  +  A   V + 
Sbjct: 69  NLDASRSEASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTE 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           + ++T  L  K+ G ++  A   +++D   D +  
Sbjct: 129 MSDLTVLLAEKIMGANLDKAAQSQLIDSYLDDLGE 163


>gi|212550724|ref|YP_002309041.1| F-type ATP synthase B subunit [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|226741296|sp|B6YR08|ATPF_AZOPC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|212548962|dbj|BAG83630.1| F-type ATP synthase B subunit [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 162

 Score = 75.2 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 63/155 (40%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW+ + FGI ++V  ++  P +  +++ R   I+   E+   A + +  +    E 
Sbjct: 8   IGLLFWMLLSFGIVFFVAAKYGFPVIVKMVDERNAFINKSLEEAKQANKRLRGIKEEEER 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L         II +      + +   +E    +    + NA+  I   ++ A Q++   
Sbjct: 68  LLKETYNKRIFIIKEANEMRIKIINDAKEKANFESNRLMKNAKENIQKEKELAMQDIRQQ 127

Query: 142 VGEVTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
           +  ++ D+  ++     D   ++  +++     ++
Sbjct: 128 IAALSIDIAERVLRKSLDNKHEQLNLINELIKELN 162


>gi|320546475|ref|ZP_08040790.1| ATP synthase F0 sector subunit B [Streptococcus equinus ATCC 9812]
 gi|320448860|gb|EFW89588.1| ATP synthase F0 sector subunit B [Streptococcus equinus ATCC 9812]
          Length = 165

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 65/163 (39%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                 ST L     +   F +   +   F   +L+ + + R   IS+D +  ++A+ + 
Sbjct: 1   MSTLINSTSLGNIIIVTGSFLLLLVLIKIFAWEQLTGVFKAREEKISNDIDGAEAAREKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E++    +E LA AR  A +IID      +           ++     + A  +I+  + 
Sbjct: 61  EALAVKRQEELAGARTEATQIIDDAKETGKNQEAKIVAEAREEASRLKAKANQDIEQSKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +A   V S V ++T  L  K+   ++       ++D   D + 
Sbjct: 121 EALSSVKSDVADLTVLLAEKIMTTNLDKEAQSNLIDSYLDKLG 163


>gi|256380133|ref|YP_003103793.1| ATP synthase F0, B subunit [Actinosynnema mirum DSM 43827]
 gi|255924436|gb|ACU39947.1| ATP synthase F0, B subunit [Actinosynnema mirum DSM 43827]
          Length = 182

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 4/169 (2%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
                  P   + +     W A+   I  +V  + +LP    ++  R   I     + ++
Sbjct: 8   AAEGAVNPLIPAVYD--IVWSAVCLAIIGFVFWKKVLPLFQKVLAERTEKIEGGIARAEA 65

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
           A+ E    +  Y+E LA ARA A  I D   A  +Q +E  R+  + +    +++  NE+
Sbjct: 66  AQAEASRTLEEYKEQLAEARAEAARIRDDARAEGQQIVEEMRDRAQAEYDRIVAHGHNEL 125

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADV--QKILDRKRDGID 174
           D  + +   E+ + +G V  DL  K+     +     +  +DR  + +D
Sbjct: 126 DAHRARIVSELRADLGRVAVDLAGKVVGESLEDQALRRGTVDRFLNELD 174


>gi|239993098|ref|ZP_04713622.1| F0F1 ATP synthase subunit B [Alteromonas macleodii ATCC 27126]
          Length = 156

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 69/154 (44%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F + F    I F +F     +++ P L + +E R+  I+   E  + A++++E   +   
Sbjct: 3   FNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E L  A+A A EII++    A Q ++ + +    +    +++   EI+  + +A +++  
Sbjct: 63  EQLKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYAEIEAERNRAKEDLRK 122

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
            V  +     +++    +       I+++    +
Sbjct: 123 QVSALAVAGAQQILQREIDANAQNDIVEKLVAEL 156


>gi|219681393|ref|YP_002467778.1| ATP synthase B chain [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|219681949|ref|YP_002468333.1| ATP synthase B chain [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|257471066|ref|ZP_05635065.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|219621682|gb|ACL29838.1| ATP synthase B chain [Buchnera aphidicola str. Tuc7 (Acyrthosiphon
           pisum)]
 gi|219624236|gb|ACL30391.1| ATP synthase B chain [Buchnera aphidicola str. 5A (Acyrthosiphon
           pisum)]
 gi|311085754|gb|ADP65836.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086331|gb|ADP66412.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311086906|gb|ADP66986.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
          Length = 161

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   ++I P +   +E R+  I         A+ E+  +     +++ 
Sbjct: 7   ILGQAISFVLFVWFCMKYIWPPIILAIETRQKEIKESLTNAKKAQDELYILEKKIHQNII 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  I++         LE  R    ++    + N Q+EI+     A + ++  V +
Sbjct: 67  DAKQKASNILNSANKQKVSILEDARNQALEESKKIILNTQSEINIAITHARKNLHKEVVD 126

Query: 145 VTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           ++  +  K+    +S  D Q++LD     +  
Sbjct: 127 LSISMAEKIIKKNISKDDNQELLDELVTSLSQ 158


>gi|312132271|ref|YP_003999611.1| ATP synthase f0 subcomplex b subunit [Leadbetterella byssophila DSM
           17132]
 gi|311908817|gb|ADQ19258.1| ATP synthase F0 subcomplex B subunit [Leadbetterella byssophila DSM
           17132]
          Length = 169

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 59/144 (40%), Gaps = 1/144 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  I+FGI  ++  +F    + + ++ R   I    +  +  + E+  + +  ++
Sbjct: 13  PGLVIWQLIVFGILVFILRKFAWTPIINGLKEREGEIEGALKMAEETRAEMAKLKADNDK 72

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +A AR    EI+ +   AA + +   +   +      L +A+  I   ++     V   
Sbjct: 73  LVAEARRERDEIVKEAKEAANRLIAEAKADAQTQSAKILEDARATIAHEKEVMIASVKQD 132

Query: 142 VGEVTKDLVRKLG-FSVSDADVQK 164
           V  ++ ++  K+    +SD   Q+
Sbjct: 133 VANLSIEIAEKILRKELSDKAAQQ 156


>gi|148988556|ref|ZP_01819989.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|168483879|ref|ZP_02708831.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|168487555|ref|ZP_02712063.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|147925757|gb|EDK76832.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP6-BS73]
 gi|172042717|gb|EDT50763.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1873-00]
 gi|183569630|gb|EDT90158.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC1087-00]
 gi|332073846|gb|EGI84324.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41301]
 gi|332200072|gb|EGJ14145.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47368]
          Length = 164

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 65/146 (44%), Gaps = 1/146 (0%)

Query: 31  IFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHA 90
            F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+ LA +R  A
Sbjct: 18  SFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKREDELAGSRKEA 77

Query: 91  KEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLV 150
           K II+     AEQ+        + +  H    A  EI   + +A Q V   V ++T  L 
Sbjct: 78  KTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGEVADLTISLA 137

Query: 151 RKLGFSVSDA-DVQKILDRKRDGIDA 175
            K+     D+   + ++D+  D +  
Sbjct: 138 GKIISQNLDSHAHKALIDQYIDQLGE 163


>gi|148975560|ref|ZP_01812431.1| hypothetical ATP synthase B chain [Vibrionales bacterium SWAT-3]
 gi|145964988|gb|EDK30239.1| hypothetical ATP synthase B chain [Vibrionales bacterium SWAT-3]
          Length = 156

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 72/149 (48%), Gaps = 1/149 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           F  AI F IF W+  +++ P L+++++ R+  I+      ++A +E+E   S+  + +  
Sbjct: 8   FGQAISFVIFVWLCMKYVWPPLTAMLDERQKEIADGLRHSENAAKELELAKSNGAQLVED 67

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
           A+ +  E+I++      + +    E  E++    L   + E++  ++K  +E+ + + + 
Sbjct: 68  AKRNVTELIEQGKKRRNEIISLAHEEAEQEKARILEQGRAELESERQKLRRELQADMADA 127

Query: 146 TKDLVRKLG-FSVSDADVQKILDRKRDGI 173
                +KL   ++     + ++D+    +
Sbjct: 128 VIQSAQKLINKNLDSETNRALVDQLISEL 156


>gi|114328533|ref|YP_745690.1| ATP synthase B' chain [Granulibacter bethesdensis CGDNIH1]
 gi|114316707|gb|ABI62767.1| ATP synthase B' chain [Granulibacter bethesdensis CGDNIH1]
          Length = 219

 Score = 75.2 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/172 (20%), Positives = 75/172 (43%), Gaps = 3/172 (1%)

Query: 2   ASSSSSDFSSRFPPFDTSTFL--SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLIS 59
           A    S      P  + +  L  SQ  W+A+I   FY +  ++ LP++S +++ R   I 
Sbjct: 44  AMDPESPEHEGMPQLNFANPLTTSQVVWMALILLAFYLLLSKWALPQVSQVVDDRNASIM 103

Query: 60  SDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHK 119
            D +    AK E  + +    +++  A    +  I+K V+AA+   + +       L  +
Sbjct: 104 GDLDSAHLAKAEANAAVEEMNDAIRRANLEGQAEIEKTVSAAKAKAQQEAAEAHARLERQ 163

Query: 120 LSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKR 170
           L++A+  I   +  A   +  +  + T+ L+ +L     +   V++ + +  
Sbjct: 164 LADAEARIASSRDTAMGALRDVATDTTQALIARLTGQFPAQDTVEQAVGQAL 215


>gi|258512720|ref|YP_003186154.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257479446|gb|ACV59765.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 167

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 69/164 (42%), Gaps = 1/164 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                    +  F +  I F I +++  RF    L+ ++E RR  I +   + + ++ E 
Sbjct: 1   MFQVGGIFQVGTFIFSVISFLIVFFIIQRFAFKPLARMLEQRRIHIETQISEAEKSREEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +++  +  L  AR  A+ ++D+    A++      +  E++    L  ++  I   + 
Sbjct: 61  ERLLAEQQRLLEEARKEARNLLDQARIRADEQAREIVQKAEEEAARILEESRQAIVRERD 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           +A   V   V E++ +L  KL    V+    ++++      +  
Sbjct: 121 EALAAVTKRVAELSVELTTKLLRDHVTAELHKELVAEAESKLGE 164


>gi|306833165|ref|ZP_07466295.1| ATP synthase F0 sector subunit B [Streptococcus bovis ATCC 700338]
 gi|304424739|gb|EFM27875.1| ATP synthase F0 sector subunit B [Streptococcus bovis ATCC 700338]
          Length = 165

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 66/163 (40%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                 ST L     +   F +   +   F   +L+ + + R   IS+D +  ++A+ + 
Sbjct: 1   MSTLINSTSLGNIIIVTGSFLLLLVLIKIFAWEQLTGVFKAREEKISNDIDGAEAAREKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E++ +  +E LA AR  A +IID      +           ++     + A  +I+  + 
Sbjct: 61  EALAAKRQEELAGARTEATQIIDDAKETGKNQEAKIVAEAREEANRLKAKANQDIEQSKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +A   V S V ++T  L  K+   ++       ++D   D + 
Sbjct: 121 EALSSVKSDVADLTVLLAEKIMTTNLDKEAQSNLIDSYLDKLG 163


>gi|269977544|ref|ZP_06184511.1| ATP synthase F0, B subunit [Mobiluncus mulieris 28-1]
 gi|306817947|ref|ZP_07451685.1| ATP synthase F0 sector subunit B [Mobiluncus mulieris ATCC 35239]
 gi|307701289|ref|ZP_07638310.1| ATP synthase F0, B subunit [Mobiluncus mulieris FB024-16]
 gi|269934147|gb|EEZ90714.1| ATP synthase F0, B subunit [Mobiluncus mulieris 28-1]
 gi|304649290|gb|EFM46577.1| ATP synthase F0 sector subunit B [Mobiluncus mulieris ATCC 35239]
 gi|307613450|gb|EFN92698.1| ATP synthase F0, B subunit [Mobiluncus mulieris FB024-16]
          Length = 184

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W AIIF I  +V  +  LP+ +++ + R   +    +    A  E +   S     L 
Sbjct: 27  IVWSAIIFAIILFVIVKVALPKYNTLADERAMKLQEGLDATTKAHEESQKAESRIAAELT 86

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A +I D+ VA AE  +   +   E++    +  AQ +I+  +  A Q + + VG 
Sbjct: 87  EAKAEAAKIRDQAVAQAEDIVARAQARAEQEAKRIVETAQRQIEAERVAAEQSLRAEVGG 146

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +   L  K+       +A   +++DR  D +D 
Sbjct: 147 LATQLAEKIVGEQLKDEALSARVVDRFLDELDK 179


>gi|254420750|ref|ZP_05034474.1| ATP synthase B/B' CF(0) family [Brevundimonas sp. BAL3]
 gi|196186927|gb|EDX81903.1| ATP synthase B/B' CF(0) family [Brevundimonas sp. BAL3]
          Length = 190

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/158 (19%), Positives = 65/158 (41%)

Query: 3   SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQ 62
           ++++   S   P F    +  Q  +L I+F I Y +  +   PRL  +M+ R + IS+  
Sbjct: 23  ATAAEHGSGGLPQFQFEHWAGQIGYLLILFVILYVLVSKVFAPRLRKVMDERADTISNAV 82

Query: 63  EKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122
                 + E     +  +  +A ARA A+ +     A   ++   ++   E  +  +++ 
Sbjct: 83  ATARQVQAEAADQAAQAQAEVAKARADARAMAAAAKARVTEDAAARQAAEEAVVNARIAE 142

Query: 123 AQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDA 160
           A+  I   +  A   V  I  +    +V +L    + +
Sbjct: 143 AETAIGKTRDAAMANVAVIASDAAAAMVERLTGKAATS 180


>gi|306829404|ref|ZP_07462594.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315613054|ref|ZP_07887965.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|322374420|ref|ZP_08048934.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
 gi|304428490|gb|EFM31580.1| ATP synthase F0 sector subunit B [Streptococcus mitis ATCC 6249]
 gi|315315164|gb|EFU63205.1| ATP synthase F0 sector subunit B [Streptococcus sanguinis ATCC
           49296]
 gi|321279920|gb|EFX56959.1| ATP synthase F0, B subunit [Streptococcus sp. C300]
          Length = 164

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  ++    L+S+ E R N I++D +  + A+++ E++    E+
Sbjct: 9   IGNFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   ++++D+  D +  
Sbjct: 129 VADLTISLAGKIISKNLDSHAHKELIDQYIDQLGE 163


>gi|35436116|gb|AAO45674.1| AtpB [Streptococcus viridans]
          Length = 164

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +   F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AEQ+        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T  L  K+   ++     ++++D+  D +  
Sbjct: 129 VADLTISLAGKIISQNLDGHAHKELIDQYIDQLGE 163


>gi|35436123|gb|AAO45677.1| AtpB [Streptococcus viridans]
          Length = 164

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           V ++T  L  K+    +     ++++D+  D +  
Sbjct: 129 VADLTISLAGKIISENLDGHAHKELIDQYIDQLGE 163


>gi|300853447|ref|YP_003778431.1| F1Fo ATPase subunit B [Clostridium ljungdahlii DSM 13528]
 gi|300433562|gb|ADK13329.1| F1Fo ATPase, subunit B [Clostridium ljungdahlii DSM 13528]
          Length = 159

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 68/148 (45%), Gaps = 1/148 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
             I F I Y++   F    +++ +  R+  I +     D  +++ + +++ ++E L  ++
Sbjct: 11  TIINFIILYFILKHFFFKPVNNTITNRQQEIDNKIRTADENEKKSKQLVTQHQELLKNSK 70

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
              K I++     A++  E      +K+    L  A+ E +  ++KA  ++ + V ++  
Sbjct: 71  QEGKAIVEDYKNKADKVSENIVNDAQKEAQLILDRAKVEAEREREKAKDDIKNQVVDLAL 130

Query: 148 DLVRK-LGFSVSDADVQKILDRKRDGID 174
            +  K L  S+++   +K+++     + 
Sbjct: 131 LVSSKALEGSINEQQHRKLIEDFIAKVG 158


>gi|120556783|ref|YP_961134.1| ATP synthase F0, B subunit [Marinobacter aquaeolei VT8]
 gi|226741522|sp|A1U7H8|ATPF_MARAV RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120326632|gb|ABM20947.1| ATP synthase F0 subcomplex B subunit [Marinobacter aquaeolei VT8]
 gi|302608312|emb|CBW44762.1| membrane-bound ATP synthase, F0 sector, subunit b [Marinobacter
           hydrocarbonoclasticus]
          Length = 156

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           I F IF W   +++ P +++ ME R+  I+      D A  ++E       + L  A+  
Sbjct: 12  IAFAIFVWFCVKYVWPPITAAMEARQKKIADGLSAADRASLDLELAQEKATKELQKAKEE 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A  +ID+    A Q +E  +E   K+    +  A+ EI   + +A   + + V  +    
Sbjct: 72  AAALIDQANKRAAQIVEASKEDARKEGEKLIEQARAEIQQERVQARDALRAEVATLAVAG 131

Query: 150 VRKLGF-SVSDADVQKILDRKRDGI 173
             K+   SV      ++L++    +
Sbjct: 132 AEKILETSVDAKAHSEMLEKLAAEL 156


>gi|157803207|ref|YP_001491756.1| F0F1 ATP synthase subunit B' [Rickettsia canadensis str. McKiel]
 gi|157784470|gb|ABV72971.1| F0F1 ATP synthase subunit B' [Rickettsia canadensis str. McKiel]
          Length = 155

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 71/155 (45%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
            P FD +T+ SQ FWL + FG+ Y   ++FI+P+   I   R+  I  +  + D    EV
Sbjct: 1   MPQFDIATYYSQIFWLIVTFGLLYIFIYKFIIPKAEEIFNNRQTNIQDNITQADILTLEV 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +   Y E +         +    + + E     +++  E+DL + ++    +I+   K
Sbjct: 61  EKLNKYYNEEVEKTNTAIDRLKKAKIYSLESEFLIKKKNLEQDLKNSINKNIEDINLAAK 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILD 167
           +        + ++  +++ K+  + +D D+ K + 
Sbjct: 121 QFRTNKSEAIIKLAVNIIEKVAGTKADIDLLKKIK 155


>gi|313631930|gb|EFR99069.1| ATP synthase F0, B subunit [Listeria seeligeri FSL N1-067]
 gi|313636295|gb|EFS02099.1| ATP synthase F0, B subunit [Listeria seeligeri FSL S4-171]
          Length = 170

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 59/157 (37%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  IM+ R   I S+ +  +  + + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQAEQLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+ +I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKTDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    +   +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDXKEQSNLIQDYIERLG 167


>gi|251799782|ref|YP_003014513.1| ATP synthase F0 subunit beta [Paenibacillus sp. JDR-2]
 gi|247547408|gb|ACT04427.1| ATP synthase F0, B subunit [Paenibacillus sp. JDR-2]
          Length = 160

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 70/154 (45%), Gaps = 1/154 (0%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           S      + F I  ++  R+    L S+ME RR  ++      +++K+E E  +   +++
Sbjct: 6   SSLVIQLVAFLILLYLLKRYAFGPLLSVMEQRRQYVAEQIANAETSKKEAEQQLEQQKQA 65

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           L  AR  A +II++  A + +  +   +V + +       A  +I+  + KA   +   V
Sbjct: 66  LQEARKEAYDIIEQAKATSTKQADDIIQVAKSESTRLKDEAVKDIESEKNKAVAALREEV 125

Query: 143 GEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           G ++  +  K+    V +   ++++++    + +
Sbjct: 126 GGISVKIASKIIEKQVDEKSQEQLVNQYLKEVGS 159


>gi|227824605|ref|ZP_03989437.1| ATP synthase F0 [Acidaminococcus sp. D21]
 gi|226905104|gb|EEH91022.1| ATP synthase F0 [Acidaminococcus sp. D21]
          Length = 161

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 36/149 (24%), Positives = 68/149 (45%), Gaps = 1/149 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F I  W+  +F    L   M+ RRN I  D +  + A++E E++   Y   L 
Sbjct: 8   IIAQIVNFIILLWILAKFAYKPLLKAMDDRRNRIVKDLDSAEHARKEAETLKLEYANQLK 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A +II K  A A++  +      +K+    L + +  ++  +KKA  +V   V  
Sbjct: 68  TARKEASDIIAKANADAQKLHDEALAQAQKERDALLESGRERVEAEKKKALLDVREQVIA 127

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDG 172
           ++ ++  + L   ++  + Q ++ RK D 
Sbjct: 128 LSTEIASRVLQAKLTSEEDQALVARKTDE 156


>gi|302669536|ref|YP_003829496.1| ATP synthase F0 B subunit AtpF1 [Butyrivibrio proteoclasticus B316]
 gi|302394009|gb|ADL32914.1| ATP synthase F0 B subunit AtpF1 [Butyrivibrio proteoclasticus B316]
          Length = 191

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 74/161 (45%), Gaps = 5/161 (3%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
               TF+ Q   L I      ++  +F+   ++ I+E RRNL      +   A+ + +S+
Sbjct: 35  LVPWTFIIQIINLFIQ----VFLIKKFLFKPINDILEKRRNLADKSIREAREAQDKADSL 90

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
              YE SL  A A A EI+ +    A+   +   +  E+      + A  +I+  +KKA 
Sbjct: 91  KEQYESSLTKAHAEAAEIVSEAQKEAQVKADTIVQEAEQQAAGIKARAAADIEQEKKKAI 150

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            E    +G +  D+  K+    +++AD +K++D   + + A
Sbjct: 151 NEAKDEIGGLAMDIAGKVVEKEINEADHRKLIDDFINKVGA 191


>gi|18146847|dbj|BAB82480.1| F0F1-ATPase subunit b [Colwellia maris]
          Length = 156

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 29/146 (19%), Positives = 57/146 (39%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +F     +F+ P +   +E R+  I+      D A +++E      +  L  A+ 
Sbjct: 11  LIAFVVFVIFCMKFVWPPIIGAIEERQATIADGLAASDRAAQDLELAQEKAKSQLKDAKV 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  I+D       + +E      + +    L+    EI+  + +A +E+   V  +   
Sbjct: 71  QAASIVDAAKKLEAKIVEETAGKAQVEKDRILATGHAEIETERNRAREELRKEVAILAVA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+  A    ILD+    +
Sbjct: 131 GAEKILERSIDGAAHSDILDKLVAEL 156


>gi|88705413|ref|ZP_01103124.1| ATP synthase B chain [Congregibacter litoralis KT71]
 gi|88700503|gb|EAQ97611.1| ATP synthase B chain [Congregibacter litoralis KT71]
          Length = 156

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 60/150 (40%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F  F     +++ P + + M+ R   IS      D A  ++E       E L 
Sbjct: 7   LIGQMLAFVAFVVFCMKYVWPPILAAMQEREQKISEGLAAADQASHDLELAKEKAVERLK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  I+D     A Q ++  +E    +     + AQ EI+    +A +++   V  
Sbjct: 67  EAKEEAAGIVDAANRRAAQIVDEAKEAAVAEADRVKAAAQAEIEQESNRAREQLRGQVAM 126

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           ++     K LG S+  +   +++D+    +
Sbjct: 127 LSLAGAEKVLGASIDASAHAELVDKLAAEL 156


>gi|332995864|gb|AEF05919.1| F0F1 ATP synthase subunit B [Alteromonas sp. SN2]
          Length = 156

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/154 (17%), Positives = 69/154 (44%), Gaps = 1/154 (0%)

Query: 21  FLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYE 80
           F + F    I F +F     +++ P L + +E R+  I+   E  + A++++E   +   
Sbjct: 3   FNATFIGQLIAFAVFVVFCMKYVWPPLMAAIEERQKKIADGLEASERAEKDLELAQAKAT 62

Query: 81  ESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYS 140
           E +  A+A A EII++    A Q ++ + +    +    +++   EI+  + +A +++  
Sbjct: 63  EQMKDAKAQAAEIIEQAKKRANQLVDEETQKGHAEREKIIASGYTEIEAERNRAKEDLRK 122

Query: 141 IVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
            V  +     +++    +       I+++    +
Sbjct: 123 QVSALAVAGAQQILQREIDANAQNDIVEKLVAEL 156


>gi|326334719|ref|ZP_08200926.1| ATP synthase F0 sector subunit B [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325693169|gb|EGD35101.1| ATP synthase F0 sector subunit B [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 164

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 25/161 (15%), Positives = 72/161 (44%), Gaps = 2/161 (1%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            +     S  FW  I+F     +   +    +   ++ R   I++  +  D AK+E+ ++
Sbjct: 1   MNLVHIESLSFWTIIVFVCLLLLLRAYAWKPILKALKEREQSINNALDAADEAKKEMANL 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
            +  E+ L+ AR     ++ +     E+ +   +E    +    ++ A+  I++ +K A 
Sbjct: 61  KADNEKLLSEARLERDNMLKEAREIKERIISQAKEEAHNEGAKLIAQAKVSIENEKKIAI 120

Query: 136 QEVYSIVGEVTKDLVRKLGFSVSDADVQ--KILDRKRDGID 174
            ++   V  ++ ++ +K+      ++V+  ++++   + I+
Sbjct: 121 AQLKEQVASLSIEIAKKVLTKELASEVKQEQLVESLLNEIN 161


>gi|300870197|ref|YP_003785068.1| putative F0F1 type ATP synthase subunit B [Brachyspira pilosicoli
           95/1000]
 gi|300687896|gb|ADK30567.1| putative F0F1 type ATP synthase subunit B [Brachyspira pilosicoli
           95/1000]
          Length = 166

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 56/155 (36%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
                W  I F +   V        +   +  R + I  D E+ +  +   +  +++Y E
Sbjct: 8   PGIIIWTWITFLLVLAVLGASTWKIILKGLNARADKIQEDLEEAEKTRENAKKSLAAYRE 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +  A+A A  II+     A +  +       ++     +   +EID  + +A   V   
Sbjct: 68  QIDNAKAEASSIIENARIEANRVRDKIIGNAREEAESHRNKILSEIDRAKDEAMGNVRKQ 127

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
             ++   +   +   ++   D Q +++   +  + 
Sbjct: 128 AVDIAVVMAETILKRNIDKNDNQALINEFVNNFEK 162


>gi|77461951|ref|YP_351458.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens Pf0-1]
 gi|123602672|sp|Q3K437|ATPF_PSEPF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|77385954|gb|ABA77467.1| ATP synthase F0 subcomplex B subunit [Pseudomonas fluorescens
           Pf0-1]
          Length = 156

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 59/145 (40%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q +E   E    D       AQ EI+        ++ + VG +    
Sbjct: 72  AAEIIEQAKKRGNQIVEEAVEKARIDADRVKVQAQAEIEQELNSVKDKLRAQVGLLAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNQLAAEI 156


>gi|16804571|ref|NP_466056.1| F0F1 ATP synthase subunit B [Listeria monocytogenes EGD-e]
 gi|224499886|ref|ZP_03668235.1| F0F1 ATP synthase subunit B [Listeria monocytogenes Finland 1988]
 gi|224503227|ref|ZP_03671534.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL R2-561]
 gi|254828108|ref|ZP_05232795.1| atpF [Listeria monocytogenes FSL N3-165]
 gi|255016866|ref|ZP_05288992.1| F0F1 ATP synthase subunit B [Listeria monocytogenes FSL F2-515]
 gi|284802971|ref|YP_003414836.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5578]
 gi|284996112|ref|YP_003417880.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5923]
 gi|81768746|sp|Q8Y4B8|ATPF_LISMO RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|16412021|emb|CAD00611.1| atpF [Listeria monocytogenes EGD-e]
 gi|258600493|gb|EEW13818.1| atpF [Listeria monocytogenes FSL N3-165]
 gi|284058533|gb|ADB69474.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5578]
 gi|284061579|gb|ADB72518.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 08-5923]
          Length = 170

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 61/157 (38%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  IM+ R   I S+ +  +  + + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+++I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|332637154|ref|ZP_08416017.1| ATP synthase B chain [Weissella cibaria KACC 11862]
          Length = 171

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 61/154 (39%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           L    ++ + F +   +   F    +  +ME R + +S D +  + A+++ E+  +    
Sbjct: 16  LGNMLFVLVAFLVLMLLIKHFAWGPVVKMMESRADKVSRDLDSAEEARKQAEADAAERSA 75

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR  A  II     AA +  +                A  +I+  + +A   V + 
Sbjct: 76  QLQTARTDANGIIADAKTAAGKQRDQIVADAHAAAQATKDQASAQIEQERAEAMAGVKND 135

Query: 142 VGEVTKDLVRKLGFSVSD-ADVQKILDRKRDGID 174
           V E++  + +K+        D + ++D   +G+ 
Sbjct: 136 VAELSVSIAQKIIQKELKLDDQKALIDAYIEGLG 169


>gi|229593485|ref|YP_002875604.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens SBW25]
 gi|229365351|emb|CAY53731.1| ATP synthase B chain [Pseudomonas fluorescens SBW25]
          Length = 156

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 58/145 (40%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E         L  A+A 
Sbjct: 12  VAFFIFVVFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKVGHQLRDAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q +E   E    +     ++A  EI+         + + +G +    
Sbjct: 72  AAEIIEQAKKRGNQIVEEAVEKARVEADRVKASAHAEIEQELNGVKDALRAQLGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|298373446|ref|ZP_06983435.1| ATP synthase F0, B subunit [Bacteroidetes oral taxon 274 str.
           F0058]
 gi|298274498|gb|EFI16050.1| ATP synthase F0, B subunit [Bacteroidetes oral taxon 274 str.
           F0058]
          Length = 165

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/153 (13%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW+ + FGI +++  +F  P + + ++ R+  I        +A   +  ++   E+
Sbjct: 8   IGLLFWMLVCFGIVFFLLAKFGFPIIVNKVDERKKFIDDSLNSAKAANERLAGIVKESED 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            +  +R     I+ +      + +   ++  ++++   +++++  I+  ++KA  ++ + 
Sbjct: 68  IIRHSREEEVRILKEATEIKAKIIAEAKQQAQEEVARMIADSKLAIEKEKEKAMNDINNA 127

Query: 142 VGEVTKDLVRKLGFSVSD--ADVQKILDRKRDG 172
           + E++  +  K+     D   + +  +D+    
Sbjct: 128 IAEMSIAIAEKIMRKQLDRSEEQRAFVDKLIAE 160


>gi|253574258|ref|ZP_04851600.1| ATP synthase F0, B subunit [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251846735|gb|EES74741.1| ATP synthase F0, B subunit [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 162

 Score = 74.8 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 30/149 (20%), Positives = 65/149 (43%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I  GI Y++ +++    L S+ME RR L+     +    + +  + +   + +L  AR 
Sbjct: 12  LIAIGILYFLLNKYAFGPLFSVMEKRRELVQQQLSEAAQTREQANAYVEEQKAALQQARK 71

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++    + +      E  + +       A  +I + + +A +++ S VG V+  
Sbjct: 72  EAYEIIEQSKQTSSKQAAQMLEEAKNEAARLKEEAVRDIQNEKNRAVEQLRSEVGAVSVK 131

Query: 149 LVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +  KL       D+   +++D+    +  
Sbjct: 132 IASKLIEKEVSEDSVQGELVDKYLKEVGG 160


>gi|268315887|ref|YP_003289606.1| ATP synthase F0, B subunit [Rhodothermus marinus DSM 4252]
 gi|262333421|gb|ACY47218.1| ATP synthase F0, B subunit [Rhodothermus marinus DSM 4252]
          Length = 171

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 59/137 (43%), Gaps = 1/137 (0%)

Query: 40  HRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVA 99
           ++F    +   ++ R   I +   + + A  E   + +  E     A   A+ I+ +   
Sbjct: 32  YKFAWKPILQALKEREESIDTSLRRAERALAEARQIQAENERIRREAEQEAQRILREARE 91

Query: 100 AAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSD 159
            AE+  + + +     +    + A+ EI+  ++ A  E+ ++V ++      K+     D
Sbjct: 92  EAERLRQEELQKTRVQIQQMQAQARAEIEREKQGALDELRAVVADLAIQAAEKILRESLD 151

Query: 160 AD-VQKILDRKRDGIDA 175
           AD  +++++R  + + A
Sbjct: 152 ADRQRRLVERFLESLPA 168


>gi|288904994|ref|YP_003430216.1| F0F1 ATP synthase b chain [Streptococcus gallolyticus UCN34]
 gi|306831065|ref|ZP_07464226.1| ATP synthase F0 sector subunit B [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977961|ref|YP_004287677.1| F0F1 ATP synthase subunit B [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288731720|emb|CBI13281.1| F0F1 ATP synthase b chain [Streptococcus gallolyticus UCN34]
 gi|304426631|gb|EFM29742.1| ATP synthase F0 sector subunit B [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177889|emb|CBZ47933.1| F0F1 ATP synthase subunit B [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 165

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 32/163 (19%), Positives = 66/163 (40%), Gaps = 1/163 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                 ST L     +   F +   +   F   +L+ + + R   IS+D +  ++A+ + 
Sbjct: 1   MSTLINSTSLGNIIIVTGSFLLLLVLIKIFAWEQLTGVFKAREEKISNDIDGAEAAREKA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E++ +  +E LA AR  A +IID      +           ++     + A  +I+  + 
Sbjct: 61  EALAAKRQEELAGARTEATQIIDDAKETGKNQEAKIVAEAREEASRLKAKANQDIEQSKA 120

Query: 133 KASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKRDGID 174
           +A   V S V ++T  L  K+   ++       ++D   D + 
Sbjct: 121 EALSSVKSDVADLTVLLAEKIMTTNLDKEAQSNLIDSYLDKLG 163


>gi|307706800|ref|ZP_07643605.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
 gi|307617885|gb|EFN97047.1| ATP synthase F0, B subunit [Streptococcus mitis SK321]
          Length = 164

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEILAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENARETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T  L  K+   ++     ++++D+  D +  
Sbjct: 129 VADLTISLAGKIISQNLDGHAHKELIDQYIDQLGE 163


>gi|331266493|ref|YP_004326123.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
 gi|326683165|emb|CBZ00783.1| proton-translocating ATPase, F0F1 ATP synthase subunit B
           [Streptococcus oralis Uo5]
          Length = 164

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 72/155 (46%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  ++    L+S+ E R N I++D +  + A+++ E++    E+
Sbjct: 9   IGNFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRNEAKTIIENAKETAEKSKADILADAKVEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   ++++D+  D ++ 
Sbjct: 129 VADLTISLAGKIISKNLDSHAHKELIDQYIDQLEE 163


>gi|237801677|ref|ZP_04590138.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024536|gb|EGI04592.1| F0F1 ATP synthase subunit B [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 156

 Score = 74.8 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 60/145 (41%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFFIFVIFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + A  EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGTQIVDEARETARVEADRVKAQALAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|308234031|ref|ZP_07664768.1| ATP synthase F0, B subunit [Atopobium vaginae DSM 15829]
 gi|328944385|ref|ZP_08241847.1| ATP synthase F0 sector subunit B [Atopobium vaginae DSM 15829]
 gi|327490969|gb|EGF22746.1| ATP synthase F0 sector subunit B [Atopobium vaginae DSM 15829]
          Length = 212

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 1/146 (0%)

Query: 31  IFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHA 90
            F + +++  RF  P +  +ME R   I  D +  + AK + E       +++  A+  A
Sbjct: 60  AFLVVWFIMARFAWPSIVKMMEKRELKIKGDLDSAEEAKLKAEQDRKESAKTIGDAQIKA 119

Query: 91  KEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLV 150
            EII      AEQ  E      +++    +  A++ I   + KA  E+   V +++ ++ 
Sbjct: 120 AEIIATAKREAEQEREHILADAQRNASGLIEKARDAITTERHKAMIELSGFVVDLSVEIA 179

Query: 151 RK-LGFSVSDADVQKILDRKRDGIDA 175
            K +G S+S+A  + + +     + A
Sbjct: 180 GKIIGNSLSEAQQRDLAEHYLHEVGA 205


>gi|193215091|ref|YP_001996290.1| F0F1 ATP synthase subunit B [Chloroherpeton thalassium ATCC 35110]
 gi|226741338|sp|B3QZF0|ATPF_CHLT3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|193088568|gb|ACF13843.1| ATP synthase F0, B subunit [Chloroherpeton thalassium ATCC 35110]
          Length = 175

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 64/154 (41%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
               FW A+ F +   +  +     + S +E R   I S  ++ +SAK + E ++S  ++
Sbjct: 18  PGLIFWTAVTFLLLLLLLKKLAWGPILSALEEREKSIQSAIDRANSAKDDAEKLLSKNKD 77

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           ++  A   A  II +    AE+         +++     + A+ EI+  +++A   +   
Sbjct: 78  AMNKAEVEADRIIKEGKEYAEKMRNEIVTKAQEEAKKIAAQAKAEIEQEKQQALNALRDE 137

Query: 142 VGEVTKDLVRKLGF-SVSDADVQKILDRKRDGID 174
           V  +      K+   ++     + +++   + + 
Sbjct: 138 VATLAVKGAEKIIRMNLDAEKHKAVVEGMLEDLS 171


>gi|288939806|ref|YP_003442046.1| ATP synthase F0 subunit B [Allochromatium vinosum DSM 180]
 gi|288895178|gb|ADC61014.1| ATP synthase F0, B subunit [Allochromatium vinosum DSM 180]
          Length = 156

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 56/150 (37%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
            F   I F +F     ++I P +   +  R+  I+      +   +E         E + 
Sbjct: 7   LFAQMITFAVFVGFCMKYIWPPIVKALAERKAKIAEGLAAAERGHQEKALGEQRALELMK 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+ +A EI+ +    A   +E  +     +    L+ A+ E++    +A +E+   V  
Sbjct: 67  EAKTNAAEIVGQAQKRATDIVEEAKSDARSEGERLLAAAKAEVERETNRAREELREKVAT 126

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRDGI 173
           +      K+    +  A  + I+D     +
Sbjct: 127 LAIAAAEKILQKEIDVAAHRSIVDDFAKQL 156


>gi|303239769|ref|ZP_07326293.1| ATP synthase F0, B subunit [Acetivibrio cellulolyticus CD2]
 gi|302592706|gb|EFL62430.1| ATP synthase F0, B subunit [Acetivibrio cellulolyticus CD2]
          Length = 162

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/156 (19%), Positives = 63/156 (40%), Gaps = 1/156 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
            D    +  F W  I   + Y +  +F+   ++  ME R NLI    E    +  E   +
Sbjct: 1   MDLLFGVPDFIWAIINLLVLYLILKKFLFKPITEFMENRANLIKEQLEGSQKSNEEAADL 60

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
             +YE  L  A A A +II+     A+   +   +  + D       A+ EI+  + +  
Sbjct: 61  KLAYERKLETAHADASKIINDAKLDAQDKYDEIIKKAKADAEVLREKAEAEIERERNEMI 120

Query: 136 QEVYSIVGEVTKDLVRKLGF-SVSDADVQKILDRKR 170
           + + + +  +  +   K+   +++    +K++D   
Sbjct: 121 KAMRNEIVSLALEAASKVMEANMNTEANKKLVDEVV 156


>gi|317060279|ref|ZP_07924764.1| ATP synthase subunit B, sodium ion specific [Fusobacterium sp. D12]
 gi|313685955|gb|EFS22790.1| ATP synthase subunit B, sodium ion specific [Fusobacterium sp. D12]
          Length = 163

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 61/152 (40%), Gaps = 1/152 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    +  I+  R+  I+S+      +K E +      E +L
Sbjct: 9   NLFWQIINFFILVFVFNKYCKIPIQRILTERKKKITSELRSASLSKEEAKISARQAETAL 68

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  A EI+ K    AE+                L  A  E+  ++ +A QE++  V 
Sbjct: 69  KEARDEAYEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKSRARQELHQEVT 128

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
            +  +L  KL    + +     ++D   + + 
Sbjct: 129 SLAVELAEKLMRKNIDEQTATDLIDDFIERVG 160


>gi|311087497|gb|ADP67576.1| F0F1 ATP synthase subunit B [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 161

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/152 (19%), Positives = 62/152 (40%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F W   ++I P +   +E R+  I         A+ E+  +     +++ 
Sbjct: 7   ILGQAISFILFVWFCMKYIWPPIILAIETRQKEIKESLTNAKKAQDELYILEKKIHQNII 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A  I++         LE  R    ++    + N Q+EI+     A + ++  V +
Sbjct: 67  DAKQKASNILNSANKQKVSILEDARNQALEESKKIILNTQSEINIAITHARKNLHKEVVD 126

Query: 145 VTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           ++  +  K+    +S  D Q++LD     +  
Sbjct: 127 LSISMAEKIIKKNISKDDNQELLDELVTSLSQ 158


>gi|295131946|ref|YP_003582622.1| ATP synthase subunit B [Zunongwangia profunda SM-A87]
 gi|294979961|gb|ADF50426.1| ATP synthase subunit B [Zunongwangia profunda SM-A87]
          Length = 164

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/154 (16%), Positives = 66/154 (42%), Gaps = 2/154 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW  I+F +   +  +F    +   ++ R + I++     + A++E++++ +  E+
Sbjct: 8   IGLLFWQTIVFLVLILILAKFAWRPILGAVKEREDSINNALSSAEEARKEMQNLKADNEQ 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
               ARA    I+ +     E+ L    E  +      ++ A+  I+  +K A  E+ S 
Sbjct: 68  LRKEARAERDAILKEARELKEKVLASATEEAQTKADMIVAQAKESIEMEKKAAMAEIKSQ 127

Query: 142 VGEVTKDLVRKLGFS--VSDADVQKILDRKRDGI 173
           V  ++ ++  K+      S     ++++     +
Sbjct: 128 VANLSIEIAEKVIRKELSSKEKQHQMINEMLGDV 161


>gi|148272345|ref|YP_001221906.1| F0F1 ATP synthase subunit B [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|226741358|sp|A5CQ56|ATPF_CLAM3 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|147830275|emb|CAN01209.1| ATP synthase B chain (Subunit I) [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 188

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 36/153 (23%), Positives = 69/153 (45%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W A++F +   V  ++ LPR+ ++++ R   I+   EK + A+ E ++  +     LA
Sbjct: 25  IVWSAVVFVVLLVVIWKYALPRVYAMLDGRTEAIAGGIEKAERAQAEADAAKAELTAQLA 84

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A  I ++    A       +E    D     ++AQ +I+  +++A   + S VG 
Sbjct: 85  EARAEAGRIREQARVDATAIAAEIKEQATADAARITASAQQQIEAERQQAVVSLRSEVGS 144

Query: 145 VTKDLVRKLGFSV--SDADVQKILDRKRDGIDA 175
           +  DL   +       D     ++DR    ++A
Sbjct: 145 LAIDLASGVIGQSLTDDQRSTALVDRFLADLEA 177


>gi|75526947|sp|Q8KRV2|ATPF_ILYTA RecName: Full=ATP synthase subunit b, sodium ion specific; AltName:
           Full=ATP synthase F(0) sector subunit b; AltName:
           Full=ATPase subunit I; AltName: Full=F-type ATPase
           subunit b; Short=F-ATPase subunit b
 gi|22266795|gb|AAM94909.1|AF522463_4 subunit b [Ilyobacter tartaricus]
          Length = 163

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 27/141 (19%), Positives = 61/141 (43%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +   ++    +S +++ R+  I+++ ++ +  +          +  L
Sbjct: 14  NMFWQIINFLILMFFFKKYFQKPISKVLDARKEKIANELKQAEIDREMAAKANEETQGIL 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  A EI+ +    A+   E   +         + +A+ E++ M+K+A +E+ S V 
Sbjct: 74  KAARTEANEILLRAEKKADDRKEAILKEANSQREKTIKSAELEVEKMKKQARKELQSEVT 133

Query: 144 EVTKDLVRKLGFSVSDADVQK 164
            +  +L  K+     D+ +  
Sbjct: 134 ALAVNLAEKMINEKLDSKLGA 154


>gi|15901359|ref|NP_345963.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae TIGR4]
 gi|15903407|ref|NP_358957.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae R6]
 gi|111657414|ref|ZP_01408167.1| hypothetical protein SpneT_02001384 [Streptococcus pneumoniae
           TIGR4]
 gi|116515510|ref|YP_816801.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae D39]
 gi|148984855|ref|ZP_01818108.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|148992604|ref|ZP_01822272.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|148997428|ref|ZP_01825033.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|149003274|ref|ZP_01828170.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|149007582|ref|ZP_01831217.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|149011746|ref|ZP_01832942.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|149021779|ref|ZP_01835786.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168489672|ref|ZP_02713871.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|168492581|ref|ZP_02716724.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|168493413|ref|ZP_02717556.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|168575967|ref|ZP_02721882.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|169832491|ref|YP_001694918.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Hungary19A-6]
 gi|182684466|ref|YP_001836213.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|194396745|ref|YP_002038142.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae G54]
 gi|221232224|ref|YP_002511377.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225854956|ref|YP_002736468.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae JJA]
 gi|225857137|ref|YP_002738648.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae P1031]
 gi|225859269|ref|YP_002740779.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae 70585]
 gi|225861345|ref|YP_002742854.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649217|ref|ZP_04523469.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974]
 gi|237821826|ref|ZP_04597671.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae CCRI 1974M2]
 gi|298255868|ref|ZP_06979454.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298503247|ref|YP_003725187.1| H (+)-transporting two-sector ATPase subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|303254151|ref|ZP_07340264.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|303260734|ref|ZP_07346694.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|303263061|ref|ZP_07348993.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|303264465|ref|ZP_07350385.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|303267443|ref|ZP_07353297.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|303269782|ref|ZP_07355531.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|307068156|ref|YP_003877122.1| F0F1-type ATP synthase subunit b [Streptococcus pneumoniae AP200]
 gi|307127716|ref|YP_003879747.1| ATP synthase F0 subunit B [Streptococcus pneumoniae 670-6B]
 gi|61219603|sp|P0A2Z2|ATPF_STRPN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|61219605|sp|P0A2Z3|ATPF_STRR6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|122277701|sp|Q04HT5|ATPF_STRP2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226695882|sp|B5E675|ATPF_STRP4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696178|sp|B1ICT3|ATPF_STRPI RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696179|sp|B2IQX4|ATPF_STRPS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|15004343|gb|AAK77043.1|AF334396_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|15004348|gb|AAK77047.1|AF334397_3 H+-transporting ATP synthase subunit b [Streptococcus pneumoniae]
 gi|18253301|gb|AAL66413.1|AF368465_3 proton-translocating ATPase b subunit [Streptococcus pneumoniae]
 gi|14973002|gb|AAK75603.1| ATP synthase F0, B subunit [Streptococcus pneumoniae TIGR4]
 gi|15459012|gb|AAL00168.1| Proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           pneumoniae R6]
 gi|116076086|gb|ABJ53806.1| ATP synthase F0, B subunit [Streptococcus pneumoniae D39]
 gi|147756483|gb|EDK63524.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP11-BS70]
 gi|147758734|gb|EDK65731.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP14-BS69]
 gi|147760941|gb|EDK67911.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP18-BS74]
 gi|147764177|gb|EDK71109.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP19-BS75]
 gi|147922877|gb|EDK73993.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP3-BS71]
 gi|147928621|gb|EDK79635.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP9-BS68]
 gi|147930015|gb|EDK81002.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae SP23-BS72]
 gi|168994993|gb|ACA35605.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Hungary19A-6]
 gi|182629800|gb|ACB90748.1| ATP synthase subunit B [Streptococcus pneumoniae CGSP14]
 gi|183571984|gb|EDT92512.1| ATP synthase F0, B subunit [Streptococcus pneumoniae SP195]
 gi|183573266|gb|EDT93794.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC0288-04]
 gi|183576602|gb|EDT97130.1| ATP synthase F0, B subunit [Streptococcus pneumoniae CDC3059-06]
 gi|183578325|gb|EDT98853.1| ATP synthase F0, B subunit [Streptococcus pneumoniae MLV-016]
 gi|194356412|gb|ACF54860.1| ATP synthase F0, B chain [Streptococcus pneumoniae G54]
 gi|220674685|emb|CAR69258.1| ATP synthase B chain [Streptococcus pneumoniae ATCC 700669]
 gi|225721806|gb|ACO17660.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 70585]
 gi|225722344|gb|ACO18197.1| ATP synthase F0, B subunit [Streptococcus pneumoniae JJA]
 gi|225726166|gb|ACO22018.1| ATP synthase F0, B subunit [Streptococcus pneumoniae P1031]
 gi|225726416|gb|ACO22267.1| ATP synthase F0, B subunit [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238842|gb|ADI69973.1| H (+)-transporting two-sector ATPase, subunit B [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301794524|emb|CBW36966.1| ATP synthase B chain [Streptococcus pneumoniae INV104]
 gi|301800348|emb|CBW32977.1| ATP synthase B chain [Streptococcus pneumoniae OXC141]
 gi|301802232|emb|CBW34982.1| ATP synthase B chain [Streptococcus pneumoniae INV200]
 gi|302598877|gb|EFL65910.1| F0F1 ATP synthase subunit B [Streptococcus pneumoniae BS455]
 gi|302635824|gb|EFL66327.1| ATP synthase subunit B [Streptococcus pneumoniae SP14-BS292]
 gi|302638137|gb|EFL68612.1| ATP synthase subunit B [Streptococcus pneumoniae SP-BS293]
 gi|302640675|gb|EFL71073.1| ATP synthase subunit B [Streptococcus pneumoniae BS458]
 gi|302643034|gb|EFL73327.1| ATP synthase subunit B [Streptococcus pneumoniae BS457]
 gi|302646277|gb|EFL76504.1| ATP synthase subunit B [Streptococcus pneumoniae BS397]
 gi|306409693|gb|ADM85120.1| F0F1-type ATP synthase, subunit b [Streptococcus pneumoniae AP200]
 gi|306484778|gb|ADM91647.1| ATP synthase F0, B subunit [Streptococcus pneumoniae 670-6B]
 gi|327389695|gb|EGE88040.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA04375]
 gi|332072303|gb|EGI82786.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17570]
 gi|332074263|gb|EGI84740.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA17545]
 gi|332199556|gb|EGJ13631.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA41317]
 gi|332200951|gb|EGJ15022.1| ATP synthase F0, B subunit [Streptococcus pneumoniae GA47901]
          Length = 164

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +   F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILITGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AEQ+        + +  H    A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENAKETAEQSKANILADAKLEAGHLKEKANQEIAQNKVEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   + ++D+  D +  
Sbjct: 129 VADLTISLAGKIISQNLDSHAHKALIDQYIDQLGE 163


>gi|254831044|ref|ZP_05235699.1| F0F1 ATP synthase subunit B [Listeria monocytogenes 10403S]
          Length = 170

 Score = 74.4 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 61/157 (38%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  IM+ R   I S+ +  +  + + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFSILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+++I   ++ A   +
Sbjct: 71  QKSVLQQARVESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEREQSNLIQDYIERLG 167


>gi|289168152|ref|YP_003446421.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307705151|ref|ZP_07642026.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|322376879|ref|ZP_08051372.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
 gi|288907719|emb|CBJ22556.1| proton-translocating ATPase, F0 sector, subunit b [Streptococcus
           mitis B6]
 gi|307621290|gb|EFO00352.1| ATP synthase F0, B subunit [Streptococcus mitis SK597]
 gi|321282686|gb|EFX59693.1| ATP synthase F0, B subunit [Streptococcus sp. M334]
          Length = 164

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++ I E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILIAGSFILLLVLIKKFAWSNITGIFEERAEKIASDIDRAEEARQKAEVLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T  L  K+   ++     ++++D+  D +  
Sbjct: 129 VADLTISLAGKIISQNLDGHAHKELIDQYIDQLGE 163


>gi|146318830|ref|YP_001198542.1| F0F1-type ATP synthase subunit B [Streptococcus suis 05ZYH33]
 gi|146321039|ref|YP_001200750.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223932792|ref|ZP_03624789.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|253751916|ref|YP_003025057.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|253753739|ref|YP_003026880.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|253755383|ref|YP_003028523.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|330832981|ref|YP_004401806.1| F0F1-type ATP synthase subunit b [Streptococcus suis ST3]
 gi|226696181|sp|A4W1W1|ATPF_STRS2 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696183|sp|A4VVK3|ATPF_STRSY RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|145689636|gb|ABP90142.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 05ZYH33]
 gi|145691845|gb|ABP92350.1| F0F1-type ATP synthase, subunit b [Streptococcus suis 98HAH33]
 gi|223898501|gb|EEF64865.1| ATP synthase F0, B subunit [Streptococcus suis 89/1591]
 gi|251816205|emb|CAZ51832.1| ATP synthase B chain [Streptococcus suis SC84]
 gi|251817847|emb|CAZ55600.1| ATP synthase B chain [Streptococcus suis BM407]
 gi|251819985|emb|CAR46135.1| ATP synthase B chain [Streptococcus suis P1/7]
 gi|292558491|gb|ADE31492.1| ATP synthase F0, subunit B [Streptococcus suis GZ1]
 gi|319758277|gb|ADV70219.1| F0F1-type ATP synthase, subunit b [Streptococcus suis JS14]
 gi|329307204|gb|AEB81620.1| F0F1-type ATP synthase, subunit b [Streptococcus suis ST3]
          Length = 168

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 68/160 (42%), Gaps = 1/160 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
             +ST L  F  +   F +   +   F   +++ I E R N I++D +  +       ++
Sbjct: 7   MQSSTILGNFILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANL 66

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
           +   E+ L   R  +++II   V  A+   +   E  + ++      AQ EI+  +++A 
Sbjct: 67  VQQREDELVQGRIESQKIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQ 126

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           + +   V E+  DL  K+    +       ++DR  D + 
Sbjct: 127 ENLRVQVAELAVDLASKIILEDLDQQAHSNLIDRYLDKLG 166


>gi|289706362|ref|ZP_06502720.1| ATP synthase F0, B subunit [Micrococcus luteus SK58]
 gi|289556857|gb|EFD50190.1| ATP synthase F0, B subunit [Micrococcus luteus SK58]
          Length = 184

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 71/171 (41%), Gaps = 4/171 (2%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +    P   + +  +   + + F +  ++  +FI+P L    + R   I     K + 
Sbjct: 9   AAAEGANPLIPNPW--EILVVVVGFALLMFIVIKFIVPTLEKSYQDRVEAIEGGLAKAEK 66

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
           A+ E  +M++ YE  LA AR  A  I +     A + +   RE    +       AQ +I
Sbjct: 67  AQAEANAMMADYESQLADARTEANRIREDARTEAAEIVAEARERATAEATRISEQAQAQI 126

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDAF 176
              +++A+ ++   VG +   L  K+       DA  Q+++DR    +D  
Sbjct: 127 AAERQQAAAQLKGEVGSLATTLAGKIVGESLEDDARSQRVVDRFLADLDRH 177


>gi|306825333|ref|ZP_07458674.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432465|gb|EFM35440.1| ATP synthase F0 sector subunit B [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 165

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  ++    L+SI E R   I++D +  + A+++ E++    E+
Sbjct: 10  IGNFILIAGSFILLVVLVKKYAWSNLTSIFEERAEKIAADIDGAEQARQKAETLAQKRED 69

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R+ AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 70  ELAGSRSEAKTIIENAKETAEKSKSDILAEAKLEAGRLKEKANQEIAQNKAEALQSVKGE 129

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   ++++D+  D +  
Sbjct: 130 VADLTVSLAGKIISQNLDSHAHKELIDQYIDQLGE 164


>gi|300115596|ref|YP_003762171.1| ATP synthase F0 subunit B [Nitrosococcus watsonii C-113]
 gi|299541533|gb|ADJ29850.1| ATP synthase F0, B subunit [Nitrosococcus watsonii C-113]
          Length = 156

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 31/150 (20%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + FGI  W  +RF+   L+++ME R+  ++      +  K E E      +E+L 
Sbjct: 7   LIGQMVAFGILIWFVNRFLWGPLTNLMEERKKRVADGLAAAERGKHERELAEKRAKETLH 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A EII +    A + +E  +E  + +      +A  EI     +A +++ S V  
Sbjct: 67  EAKEKAAEIITQAQKRAGEIIEEAKEAAQAEGERLKISANAEIQQEMNRAREDLRSQVVS 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGI 173
           +      K+    + +   + ++      I
Sbjct: 127 IAVAGASKILKRELDEKANEALVKELVAQI 156


>gi|304413045|ref|ZP_07394518.1| membrane-bound ATP synthase, F0 complex, subunit b [Candidatus
           Regiella insecticola LSR1]
 gi|304283888|gb|EFL92281.1| membrane-bound ATP synthase, F0 complex, subunit b [Candidatus
           Regiella insecticola LSR1]
          Length = 158

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 32/152 (21%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
               AI F +F     +++ P L   +E R+  I+      + AK++++   ++  E L 
Sbjct: 7   IVGQAIAFFLFVIFCMKYVWPPLIEAIEKRQKEIADSIASAERAKKDLDLAQANMTEQLQ 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A+ II++      Q LE  +   E++    +  AQ EID  +K+A +E+   +  
Sbjct: 67  KAKEQAQVIIEQANKRKVQILENAKVEAEQERKKIIMQAQAEIDADRKRAYEELRKQIAG 126

Query: 145 VTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           +      ++   SV++   + ++D     ++ 
Sbjct: 127 LAIAGAERIINCSVNETINRTLVDTMVAELEQ 158


>gi|332295439|ref|YP_004437362.1| ATP synthase subunit b [Thermodesulfobium narugense DSM 14796]
 gi|332178542|gb|AEE14231.1| ATP synthase subunit b [Thermodesulfobium narugense DSM 14796]
          Length = 161

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 69/151 (45%), Gaps = 1/151 (0%)

Query: 26  FWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAI 85
           FW  + F IF+++  +F++P +++ ++ R   I+   E+    + E E ++   ++ L  
Sbjct: 10  FWTIVSFLIFFFLFAKFVVPPINNALKEREKAIAGAIEQARKEREEAEKLLQESKKELEE 69

Query: 86  ARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEV 145
            RA + +I+++  A AE+  +   +  +++    + +A  ++D  + +   E+   V  +
Sbjct: 70  TRARSSKIVEEARAYAEEVKKDIIQKAKEEAQKIVDSAAKDLDRAKAEVIAELKVEVVNL 129

Query: 146 TKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           T  L  KL    +      K +      I  
Sbjct: 130 TISLTEKLLEKELDKNAQTKFVTEYLQKIGK 160


>gi|239917339|ref|YP_002956897.1| ATP synthase, F0 subunit b [Micrococcus luteus NCTC 2665]
 gi|281414181|ref|ZP_06245923.1| ATP synthase subunit b [Micrococcus luteus NCTC 2665]
 gi|262527532|sp|P80285|ATPF_MICLC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|239838546|gb|ACS30343.1| ATP synthase, F0 subunit b [Micrococcus luteus NCTC 2665]
          Length = 184

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 71/171 (41%), Gaps = 4/171 (2%)

Query: 8   DFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDS 67
             +    P   + +  +   + + F +  ++  +FI+P L    + R   I     K + 
Sbjct: 9   AAAEGANPLIPNPW--EILVVVVGFALLMFIVIKFIVPTLEKSYQDRVEAIEGGLAKAEK 66

Query: 68  AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEI 127
           A+ E  +M++ YE  LA AR  A  I +     A + +   RE    +       AQ +I
Sbjct: 67  AQAEANAMMADYESQLADARTEANRIREDARTEAAEIVAEARERATAEATRVFEQAQAQI 126

Query: 128 DDMQKKASQEVYSIVGEVTKDLVRKLGFSV--SDADVQKILDRKRDGIDAF 176
              +++A+ ++   VG +   L  K+       DA  Q+++DR    +D  
Sbjct: 127 AAERQQAAAQLKREVGSLATTLAGKIVGESLEDDARSQRVVDRFLADLDRH 177


>gi|262341320|ref|YP_003284175.1| ATP synthase F0 subunit b [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272657|gb|ACY40565.1| ATP synthase F0 subunit b [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 162

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 26/152 (17%), Positives = 58/152 (38%), Gaps = 2/152 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +    W  IIF I      +F    +   ++ R   I    EK D  K E++++ +   +
Sbjct: 8   VGLIVWHTIIFVILMLFLSKFAWKPILHFIDQREENIRMSVEKADQVKNELKNVENQKNK 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L   R     I+ + +   E+     +E    +    L   +  I   +K A  ++ + 
Sbjct: 68  ILKETRMKRDMILKEAIQIREKIKLKAKEESLIEKKKILEETKKSIQIERKAAIHKLKNQ 127

Query: 142 VGEVTKDLVRKLGFSVSDADVQKILDRKRDGI 173
           +G+++  +  K+     D   ++  D+    +
Sbjct: 128 IGDISIQIAEKILKKELDQTNKQ--DKFIKEL 157


>gi|322411473|gb|EFY02381.1| F0F1 ATP synthase subunit B [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 164

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 24/155 (15%), Positives = 62/155 (40%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     +   +  +F    + SI++ R   IS D ++ + ++   + + +  + 
Sbjct: 9   VGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAESQA 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +L  +R+ A +II       +   +        +       A  +I+  +  A   V + 
Sbjct: 69  NLDASRSEASKIISDAKEIGQLQGDKLVAAATAETKRLKEKALTDIEQSKSDAISAVKTE 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           + ++T  L  K+ G ++  A   +++D   D +  
Sbjct: 129 MSDLTVLLAEKIMGANLDKAAQSQLIDSYLDDLGE 163


>gi|227874655|ref|ZP_03992818.1| F0F1 family ATP synthase, subunit b [Mobiluncus mulieris ATCC
           35243]
 gi|227844864|gb|EEJ55010.1| F0F1 family ATP synthase, subunit b [Mobiluncus mulieris ATCC
           35243]
          Length = 184

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 38/153 (24%), Positives = 68/153 (44%), Gaps = 2/153 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W AIIF I  +V  +  LP+ +++ + R   +    +    A  E +   S     L 
Sbjct: 27  IVWSAIIFAIILFVIVKVALPKYNTLADERAMKLQEGLDATTKAHEESQKAESRIAAELT 86

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A +I D+ VA AE  +   +   E++    +  AQ +I+  +  A Q + + VG 
Sbjct: 87  EAKAEAAKIRDQAVAQAEDIVARAQARAEQEAKRIVETAQRQIEAERVAAEQSLRAEVGG 146

Query: 145 VTKDLVRKLGFS--VSDADVQKILDRKRDGIDA 175
           +   L  K+       +A   +++DR  D +D 
Sbjct: 147 LATQLAEKIVGEQLKDEALSARVVDRFLDELDK 179


>gi|104784438|ref|YP_610936.1| F0F1 ATP synthase subunit B [Pseudomonas entomophila L48]
 gi|122401174|sp|Q1I2I3|ATPF_PSEE4 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|95113425|emb|CAK18153.1| ATP synthase F0, B subunit [Pseudomonas entomophila L48]
          Length = 156

 Score = 74.4 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKVGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++    A Q ++  RE    +     + AQ EI+         + + VG +    
Sbjct: 72  AAEIIEQSKKRAAQLVDEAREQARVEADRVKAQAQAEIEQELNSVKDALRAQVGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|320102106|ref|YP_004177697.1| ATP synthase F0 subunit B [Isosphaera pallida ATCC 43644]
 gi|319749388|gb|ADV61148.1| ATP synthase F0, B subunit [Isosphaera pallida ATCC 43644]
          Length = 208

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/147 (14%), Positives = 64/147 (43%), Gaps = 1/147 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I+F I   +  ++    +   ++ R   ++  +++ ++A+ E   + + YE  LA A  
Sbjct: 48  LIVFLILLAILWKYAWTPIVQALDAREASLNQIRQEAEAARSETLRLQTEYETKLAAAAE 107

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
             K +I++    A+           ++     + A+  I   + +A +E++    E++  
Sbjct: 108 EVKALIEEARRDAQATKAEILRAANEEAAAIKARAEQAIKLAKDEALKELWDRATELSVV 167

Query: 149 LVRKLG-FSVSDADVQKILDRKRDGID 174
           +  +L    +S  D +++ ++    ++
Sbjct: 168 VAGRLLPRELSHDDQRRLTEQAIHELE 194


>gi|315283685|ref|ZP_07871801.1| ATP synthase F0, B subunit [Listeria marthii FSL S4-120]
 gi|313612673|gb|EFR86699.1| ATP synthase F0, B subunit [Listeria marthii FSL S4-120]
          Length = 170

 Score = 74.0 bits (180), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 22/157 (14%), Positives = 61/157 (38%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
           +      F+    F I   +   +    L  IM+ R   I S+ +  +  + + E +++ 
Sbjct: 11  AFTFGDAFFTLFAFAILLVLIRIYAWKPLMGIMKEREEHIGSEIDAAEENRAQSEKLLAE 70

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  AR  ++ +I+      E+  E   +   ++       A+++I   ++ A   +
Sbjct: 71  QKSVLQQARIESQTMIENAKQLGEKEREEIVKTARRESERIKEEAKSDIAREKEDAISAL 130

Query: 139 YSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
              VG ++  +  K+    + + +   ++    + + 
Sbjct: 131 REQVGSLSVLIASKVIEKNLDEKEQSNLIQDYIERLG 167


>gi|330718992|ref|ZP_08313592.1| F0F1-type ATP synthase, subunit b [Leuconostoc fallax KCTC 3537]
          Length = 168

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 66/149 (44%), Gaps = 1/149 (0%)

Query: 28  LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87
           + I F +  WV  +     L +I++ R + ISSD +  ++A+++ E + S  +  LA AR
Sbjct: 18  VLIAFLLLMWVLSKVAYGPLMNILDQRADKISSDLDGAETARQQAEELASKRQGELANAR 77

Query: 88  AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147
             A +++    A+A++  +              S A+ E   ++  A     + V  ++ 
Sbjct: 78  NEATKVVADAKASAQKQSDVLVSQASDRAQAINSQAEVEAQKLKDDAISSAKNDVAALSV 137

Query: 148 DLVRKLG-FSVSDADVQKILDRKRDGIDA 175
            +  KL    +S  D Q ++D     ++ 
Sbjct: 138 AIASKLMQKELSLNDQQALIDAYISDLEK 166


>gi|70733503|ref|YP_263278.1| F0F1 ATP synthase subunit B [Pseudomonas fluorescens Pf-5]
 gi|123651840|sp|Q4K3A5|ATPF_PSEF5 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|68347802|gb|AAY95408.1| ATP synthase F0, B subunit [Pseudomonas fluorescens Pf-5]
          Length = 156

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +FI P + + +  R+  I+   +    A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKFIWPPVIAALHERQKKIADGLDAASRAARDLELAQDKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q ++  RE    +     + AQ EI+         + + +G +  + 
Sbjct: 72  AAEIIEQAKKRGSQIVDEAREQARVEAERVKAQAQAEIEQELNGVKDALRAQLGSLAVNG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|251780553|ref|ZP_04823473.1| ATP synthase F0, B subunit [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243084868|gb|EES50758.1| ATP synthase F0, B subunit [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 159

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 62/157 (39%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
            T  S  F   I F I   +   F   ++  I+  R++ +     K+D    +    +  
Sbjct: 2   ETNYSVIFMTIINFCILVAILKHFFWDKIKGIINERQDFVDEQLLKVDEDSEKARMYLLE 61

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  A+   K+I +     A +  +   E   ++    L  A+ +I   ++KA  E+
Sbjct: 62  NQRILQTAKEEGKKITESQKEKANKVYDEIVEDANEEAKSLLERAKTDIQREKEKAEYEI 121

Query: 139 YSIVGEVTKDL-VRKLGFSVSDADVQKILDRKRDGID 174
                ++  +L ++ L  ++ ++  ++++      + 
Sbjct: 122 KKQAVDLAIELSIKALEENIDESKHRELISDFITKVG 158


>gi|312964002|ref|ZP_07778473.1| ATP synthase F0, B subunit [Pseudomonas fluorescens WH6]
 gi|311282037|gb|EFQ60647.1| ATP synthase F0, B subunit [Pseudomonas fluorescens WH6]
          Length = 156

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 58/145 (40%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +F+ P + + +  R+  I+   +    A R++E         L  A+A 
Sbjct: 12  VAFFIFVVFCMKFVWPPVIAALHERQKKIADGLDAASRAARDLELAQEKVGHQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++      Q +E   E    +     ++A  EI+         + + +G +    
Sbjct: 72  AAEIIEQAKKRGNQIVEEAVEKARVEADRVKASAHAEIEQELNGVKDALRAQLGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|307566507|ref|ZP_07628937.1| ATP synthase F0, B subunit [Prevotella amnii CRIS 21A-A]
 gi|307344789|gb|EFN90196.1| ATP synthase F0, B subunit [Prevotella amnii CRIS 21A-A]
          Length = 169

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/140 (16%), Positives = 64/140 (45%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +   FW+ ++F I +++  ++  P +  +   R+  I     K   A  ++ ++    E 
Sbjct: 8   IGLLFWMTLVFLIVFFILKKWGFPVILKMANDRKEYIDGSLRKAQEANEKLANIQKESES 67

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR     I+ +  A  E  +    +   ++    +S+A+  I++ ++KA +++ + 
Sbjct: 68  ILQEAREKQALILKEATATREAIVSQAHDKARQEASRLISDAKIVIENEKQKALRDIRNQ 127

Query: 142 VGEVTKDLVRKLGFSVSDAD 161
           + E++ ++  K+  +   + 
Sbjct: 128 MAELSINISEKILRNKLSSS 147


>gi|332533714|ref|ZP_08409573.1| ATP synthase B chain [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036878|gb|EGI73339.1| ATP synthase B chain [Pseudoalteromonas haloplanktis ANT/505]
          Length = 156

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F +F     +++ P L+  +E R+  I       D A++++E       E L  A+A
Sbjct: 11  LIAFTVFVLFCMKYVWPPLNGAIEARQKKIEDGLAASDRAEKDLELAQKKAAEQLKDAKA 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A +IID+    A   ++ +    +++    ++   +E++  + + ++E+   V  +   
Sbjct: 71  QAADIIDQAKKRAVLIVDEETLRGQQERESIIAQGHSEVESERNRITEELRKQVATLAVI 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              ++    ++ A    I+++    +
Sbjct: 131 GAERILEREINQAAHSDIVEKLVAEL 156


>gi|148654685|ref|YP_001274890.1| F0F1 ATP synthase subunit B [Roseiflexus sp. RS-1]
 gi|226694458|sp|A5UQN7|ATPF_ROSS1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148566795|gb|ABQ88940.1| ATP synthase F0, B subunit [Roseiflexus sp. RS-1]
          Length = 163

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 19/154 (12%), Positives = 52/154 (33%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
                  I      W+   F+   + +++  R + I    +  +  K ++ +    Y+  
Sbjct: 9   GLLIAQLINVIFVVWLLTTFLYRPILNMLNQRTSRIQEGLQDAEKVKEQLANAKRDYDAE 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA AR  A  I+ +    A            +D     S+A  + +  + +   E+   +
Sbjct: 69  LAKARQEAAAILAQAQERARAQAAEIIAQAHRDAEKIKSDALAQAEQERLRMLGELKDRM 128

Query: 143 GEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176
            E+      ++       +  ++++     +  +
Sbjct: 129 AELVVLTAERVLGEELKTNHDRLIEESLAELGKY 162


>gi|221633215|ref|YP_002522440.1| ATP synthase F0 subunit B [Thermomicrobium roseum DSM 5159]
 gi|221155512|gb|ACM04639.1| ATP synthase F0, B subunit [Thermomicrobium roseum DSM 5159]
          Length = 165

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 32/153 (20%), Positives = 64/153 (41%), Gaps = 1/153 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
                 I F +F  V  RF L  ++ +++ R+  I    E  +  KRE+    +  EE L
Sbjct: 10  NLVVQLIAFLLFLAVFWRFALGPITRMIDQRQERIREGLEAAERMKRELAETQARNEEIL 69

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
           A AR  A+ I+     +AEQ +   RE  ++     +  AQ  I+  +++   E+   V 
Sbjct: 70  AEARREAQRIVASARESAEQLIARAREEAQQQAQQLIQQAQEAIEAERQRVWAELRREVA 129

Query: 144 EVTKDLVRKLGF-SVSDADVQKILDRKRDGIDA 175
           ++      ++    +       ++++    +D 
Sbjct: 130 DLAILAATRIIRQELDRDRHLALIEQALAELDG 162


>gi|254435292|ref|ZP_05048799.1| ATP synthase F0, B subunit [Nitrosococcus oceani AFC27]
 gi|207088403|gb|EDZ65675.1| ATP synthase F0, B subunit [Nitrosococcus oceani AFC27]
          Length = 146

 Score = 74.0 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 61/145 (42%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + FGI  W  +RF+   L+++ME R+  ++      +  K E E      +E+L  A+  
Sbjct: 2   VAFGILVWFVNRFLWGPLTNLMEERKKRVADGLAAAERGKHERELAEKRAKETLHEAKEK 61

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII +    A + +E  +E  + +      +A  EI     +A +++   V  +    
Sbjct: 62  AAEIITQAQKRAGEIIEEAKEAAQAEGERLKVSANAEIQQEMNRAREDLRGQVVSIAVAG 121

Query: 150 VRKLGF-SVSDADVQKILDRKRDGI 173
             K+    + +   + ++      I
Sbjct: 122 ASKILKRELDEKANEALVKELVAQI 146


>gi|41019057|gb|AAR98500.1| ATP synthase B subunit [Pasteuria penetrans]
          Length = 160

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/147 (18%), Positives = 65/147 (44%), Gaps = 1/147 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F +  ++  RF +  +S +ME R   I S  E+ ++ ++E    +    E+L  AR 
Sbjct: 13  LVAFLVLVFLVSRFAVRPVSKMMEARTERIKSTLEEAEAKRKEALLYVEQQREALKQARQ 72

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A+ ++       EQ      +   +     L +A++E+   +++A +++   V  +   
Sbjct: 73  EAQGMLATARFQKEQEAASILQEARQRAEQTLESAKSEVAREREEAVRQLRVEVSGLAVQ 132

Query: 149 LVRKLG-FSVSDADVQKILDRKRDGID 174
           L  ++    V  +  +++L+R    + 
Sbjct: 133 LASRILHKEVDRSQHEQLLERYLRQVG 159


>gi|167856125|ref|ZP_02478866.1| F0F1 ATP synthase subunit B [Haemophilus parasuis 29755]
 gi|219871745|ref|YP_002476120.1| F0F1 ATP synthase subunit B [Haemophilus parasuis SH0165]
 gi|167852766|gb|EDS24039.1| F0F1 ATP synthase subunit B [Haemophilus parasuis 29755]
 gi|219691949|gb|ACL33172.1| F0F1 ATP synthase subunit B/H(+)-transporting two-sector ATPase,
           F(1) beta subunit [Haemophilus parasuis SH0165]
          Length = 156

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 35/150 (23%), Positives = 62/150 (41%), Gaps = 1/150 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                I F +F W   +F+ P L   +E R+  I+      + AK+E        E+ LA
Sbjct: 7   LIGQLIAFALFVWFCMKFVWPPLIKAIETRQANIADALASAEKAKQEQADTKVLVEQELA 66

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            AR  A+ IID       + LE  +   E +    +     E+++ +++  +E+   V  
Sbjct: 67  KAREEAQHIIDLATKRRNEILESVQAEAEAEKAKIIEQGYAEVENERRRVQEELRQKVAA 126

Query: 145 VTKDLVRKL-GFSVSDADVQKILDRKRDGI 173
           +      K+ G SV  A    I+D+    +
Sbjct: 127 LAVAGAEKIVGRSVDAAANNDIIDKLVAEL 156


>gi|120600839|ref|YP_965413.1| F0F1 ATP synthase subunit B [Shewanella sp. W3-18-1]
 gi|146295040|ref|YP_001185464.1| F0F1 ATP synthase subunit B [Shewanella putrefaciens CN-32]
 gi|226694915|sp|A4YCI2|ATPF_SHEPC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694918|sp|A1RQB4|ATPF_SHESW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|120560932|gb|ABM26859.1| ATP synthase F0, B subunit [Shewanella sp. W3-18-1]
 gi|145566730|gb|ABP77665.1| ATP synthase F0, B subunit [Shewanella putrefaciens CN-32]
 gi|319428558|gb|ADV56632.1| ATP synthase F0, B subunit [Shewanella putrefaciens 200]
          Length = 156

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +F+ P L + +E R+  I+        A +++E   +   E L  A+ 
Sbjct: 11  AISFALFVWFCIKFVWPPLMNAIEERQKKIADGLADAGRAAKDLELAQAKATEQLKEAKV 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q +E  +   + +    ++  + EI++ + +   ++   V  +   
Sbjct: 71  TANEIIEQANKRKAQIVEEAKAEADAERAKIIAQGKAEIENERSRVKDDLRKQVAALAVL 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              ++   S+  A    I+D+    I
Sbjct: 131 GAERILERSIDQAAHSDIVDKLVAEI 156


>gi|167036421|ref|YP_001671652.1| F0F1 ATP synthase subunit B [Pseudomonas putida GB-1]
 gi|170724360|ref|YP_001752048.1| F0F1 ATP synthase subunit B [Pseudomonas putida W619]
 gi|226694442|sp|B0KRB2|ATPF_PSEPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226694443|sp|B1JFU5|ATPF_PSEPW RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|166862909|gb|ABZ01317.1| ATP synthase F0, B subunit [Pseudomonas putida GB-1]
 gi|169762363|gb|ACA75679.1| ATP synthase F0, B subunit [Pseudomonas putida W619]
          Length = 156

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++    A Q +E  R+    +     + A  EI+     A   + + VG +    
Sbjct: 72  AAEIIEQSKKRAAQLVEEARDQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|32476313|ref|NP_869307.1| protein ATP synthase B chain [Rhodopirellula baltica SH 1]
 gi|32446858|emb|CAD78764.1| probable protein ATP synthase B chain [Rhodopirellula baltica SH 1]
          Length = 261

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/152 (19%), Positives = 65/152 (42%), Gaps = 1/152 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  IIF     +  +F+ P +   ++ R   I  D E  + A  E + M+S Y+  L 
Sbjct: 108 AIWNLIIFLCVLAILSKFVWPAVLGGLQAREEKIREDLESAEKASAEAKQMLSDYQLKLD 167

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A +  + ++      AE N +   +  + +   +   A ++I++ +K A  E+     +
Sbjct: 168 EAASQVQTMLADARRDAEANGQKIVDAAKVEAAAQRERALSDIENAKKVAMAEMAGQTSK 227

Query: 145 VTKDLVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +   + R  +G  +S  D   ++ +  + + +
Sbjct: 228 LAMQVARSVVGRELSADDHADLIRQSMERLPS 259


>gi|56808119|ref|ZP_00365907.1| COG0711: F0F1-type ATP synthase, subunit b [Streptococcus pyogenes
           M49 591]
 gi|71903221|ref|YP_280024.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS6180]
 gi|94988262|ref|YP_596363.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS9429]
 gi|94992136|ref|YP_600235.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS2096]
 gi|94994057|ref|YP_602155.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10750]
 gi|123640162|sp|Q48UD7|ATPF_STRPM RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696173|sp|Q1JCL7|ATPF_STRPB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696174|sp|Q1JMJ3|ATPF_STRPC RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696176|sp|Q1J7G3|ATPF_STRPF RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|71802316|gb|AAX71669.1| ATP synthase B chain [Streptococcus pyogenes MGAS6180]
 gi|94541770|gb|ABF31819.1| ATP synthase B chain [Streptococcus pyogenes MGAS9429]
 gi|94545644|gb|ABF35691.1| ATP synthase B chain [Streptococcus pyogenes MGAS2096]
 gi|94547565|gb|ABF37611.1| ATP synthase B chain [Streptococcus pyogenes MGAS10750]
          Length = 164

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 61/155 (39%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     +   +  +F    + SI++ R   IS D ++ + ++   + + +  + 
Sbjct: 9   VGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQA 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +L  +R+ A +II       +   +        +       A  +I+  +  A   V + 
Sbjct: 69  NLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTE 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           + ++T  L  K+ G ++      +++D   D +  
Sbjct: 129 MSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE 163


>gi|19745843|ref|NP_606979.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS8232]
 gi|50913940|ref|YP_059912.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10394]
 gi|94990141|ref|YP_598241.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS10270]
 gi|139474054|ref|YP_001128770.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes str. Manfredo]
 gi|306827637|ref|ZP_07460917.1| ATP synthase F0 sector subunit B [Streptococcus pyogenes ATCC
           10782]
 gi|81372210|sp|Q5XCY4|ATPF_STRP6 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|81763190|sp|Q8P1K8|ATPF_STRP8 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696175|sp|Q1JHN9|ATPF_STRPD RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226696177|sp|A2RFC6|ATPF_STRPG RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|19747991|gb|AAL97478.1| putative proton-translocating ATPase, subunit b [Streptococcus
           pyogenes MGAS8232]
 gi|50903014|gb|AAT86729.1| ATP synthase B chain [Streptococcus pyogenes MGAS10394]
 gi|94543649|gb|ABF33697.1| ATP synthase B chain [Streptococcus pyogenes MGAS10270]
 gi|134272301|emb|CAM30555.1| ATP synthase B chain [Streptococcus pyogenes str. Manfredo]
 gi|304430200|gb|EFM33229.1| ATP synthase F0 sector subunit B [Streptococcus pyogenes ATCC
           10782]
          Length = 164

 Score = 74.0 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 61/155 (39%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     +   +  +F    + SI++ R   IS D ++ + ++   + + +  + 
Sbjct: 9   VGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLETKSQA 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +L  +R+ A +II       +   +        +       A  +I+  +  A   V + 
Sbjct: 69  NLDASRSQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTE 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           + ++T  L  K+ G ++      +++D   D +  
Sbjct: 129 MSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE 163


>gi|270292839|ref|ZP_06199050.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
 gi|270278818|gb|EFA24664.1| ATP synthase F0, B subunit [Streptococcus sp. M143]
          Length = 164

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 71/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  ++    L+S+ E R N I++D +  + A+++ E++    E+
Sbjct: 9   IGNFILIAGSFILLIVLVKKYAWSNLTSVFEERANKIAADIDGAEQARQKAETLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRNEAKTIIENAKGTAEKSKADILADAKLEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLGFSVSDA-DVQKILDRKRDGIDA 175
           V ++T  L  K+     D+   ++++D+  D +  
Sbjct: 129 VADLTISLAAKIISKNLDSHAHKELIDQYIDQLGE 163


>gi|89898931|ref|YP_521402.1| F0F1 ATP synthase subunit B [Rhodoferax ferrireducens T118]
 gi|122480311|sp|Q223D2|ATPF1_RHOFD RecName: Full=ATP synthase subunit b 1; AltName: Full=ATP synthase
           F(0) sector subunit b 1; AltName: Full=ATPase subunit I
           1; AltName: Full=F-type ATPase subunit b 1;
           Short=F-ATPase subunit b 1
 gi|89343668|gb|ABD67871.1| ATP synthase F0, B subunit [Rhodoferax ferrireducens T118]
          Length = 156

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/142 (20%), Positives = 56/142 (39%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
           S  F  AI+F I  W T +F+ P ++  ++ R   I+      D AK E+ S     E  
Sbjct: 5   STLFLQAIVFAILVWFTMKFVWPPITKALDERAQKIADGLAAADKAKSELSSANKRVEAE 64

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA++R      +       +  +E  +    ++    ++ A+ E +    KA + +   V
Sbjct: 65  LALSRTETTARLADADRRGQSIVEEAKSKATEEANKIIAAAKVEAEQQSNKAREVLREQV 124

Query: 143 GEVTKDLVRKLGFSVSDADVQK 164
             +      ++     +A V  
Sbjct: 125 AALAVKGAEQILRKEVNASVHA 146


>gi|26992092|ref|NP_747517.1| F0F1 ATP synthase subunit B [Pseudomonas putida KT2440]
 gi|81733163|sp|Q88BX0|ATPF_PSEPK RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|24987234|gb|AAN70981.1|AE016742_10 ATP synthase F0, B subunit [Pseudomonas putida KT2440]
 gi|313496407|gb|ADR57773.1| AtpF [Pseudomonas putida BIRD-1]
          Length = 156

 Score = 73.7 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++    A Q ++  RE    +     + A  EI+     A   + + VG +    
Sbjct: 72  AAEIIEQSKKRAAQLVDEAREQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|307709039|ref|ZP_07645499.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
 gi|307620375|gb|EFN99491.1| ATP synthase F0, B subunit [Streptococcus mitis SK564]
          Length = 164

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 35/155 (22%), Positives = 70/155 (45%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +A  F +   +  +F    ++SI E R   I+SD ++ + A+++ E +    E+
Sbjct: 9   IGNFILIAGSFILLLVLIKKFAWSNITSIFEERAEKIASDIDRAEEARQKAEVLAQKRED 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            LA +R  AK II+     AE++        + +       A  EI   + +A Q V   
Sbjct: 69  ELAGSRKEAKTIIENAKETAEKSKASILADAKLEAGRLKEKANQEIAQNKAEALQSVKGE 128

Query: 142 VGEVTKDLVRKLG-FSVSDADVQKILDRKRDGIDA 175
           V ++T  L  K+   ++     ++++D+  D +  
Sbjct: 129 VADLTISLAGKIISQNLDGHAHKELIDQYIDQLGE 163


>gi|302023930|ref|ZP_07249141.1| F0F1 ATP synthase subunit B [Streptococcus suis 05HAS68]
          Length = 168

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/160 (20%), Positives = 67/160 (41%), Gaps = 1/160 (0%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESM 75
             +ST L  F  +   F +   +   F   +++ I E R N I++D +  +       ++
Sbjct: 7   MQSSTILGNFILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKLTAAANL 66

Query: 76  ISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKAS 135
           +   E+ L   R  + +II   V  A+   +   E  + ++      AQ EI+  +++A 
Sbjct: 67  VQQREDELVQGRIESPQIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEAEKREAQ 126

Query: 136 QEVYSIVGEVTKDLVRKLG-FSVSDADVQKILDRKRDGID 174
           + +   V E+  DL  K+    +       ++DR  D + 
Sbjct: 127 ENLRVQVAELAVDLASKIILEDLDQQAHSNLIDRYLDKLG 166


>gi|153834317|ref|ZP_01986984.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
 gi|148869325|gb|EDL68339.1| ATP synthase F0, B subunit [Vibrio harveyi HY01]
          Length = 156

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/142 (22%), Positives = 64/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P L   +E R+  I+   +  + A ++++   ++  + L  A+ 
Sbjct: 11  AISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EIID+      Q ++  RE  + +    L+ A+ E++  + +A  E+   V  +   
Sbjct: 71  TATEIIDQANKRKSQIIDEAREEAQAERQKILAQAEAELEAERNRARDELRKQVATLAVA 130

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D QK +    
Sbjct: 131 GAEKILERSIDKDAQKDILDNI 152


>gi|257462632|ref|ZP_05627042.1| ATP synthase B chain, sodium ion specific [Fusobacterium sp. D12]
          Length = 168

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 61/152 (40%), Gaps = 1/152 (0%)

Query: 24  QFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESL 83
             FW  I F I  +V +++    +  I+  R+  I+S+      +K E +      E +L
Sbjct: 14  NLFWQIINFFILVFVFNKYCKIPIQRILTERKKKITSELRSASLSKEEAKISARQAETAL 73

Query: 84  AIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVG 143
             AR  A EI+ K    AE+                L  A  E+  ++ +A QE++  V 
Sbjct: 74  KEARDEAYEILKKAEYRAEEVRNEILADARLQKERMLREASEEVMRLKSRARQELHQEVT 133

Query: 144 EVTKDLVRKLGFS-VSDADVQKILDRKRDGID 174
            +  +L  KL    + +     ++D   + + 
Sbjct: 134 SLAVELAEKLMRKNIDEQTATDLIDDFIERVG 165


>gi|302536952|ref|ZP_07289294.1| ATP synthase F0, B subunit [Streptomyces sp. C]
 gi|302445847|gb|EFL17663.1| ATP synthase F0, B subunit [Streptomyces sp. C]
          Length = 180

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 2/149 (1%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            I F I +    + +LP ++ +++ RR  I    EK ++A+ E +S++  Y+  LA AR 
Sbjct: 26  LIAFVIVFGFLAKKLLPNINKVLDERREQIEGGIEKAEAAQTEAQSVLEQYKAQLAEARH 85

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A  +    +       E  R   ++     ++    +I   +K A+Q +   VG++  D
Sbjct: 86  EAARLRQDALEQGTALKEELRAEGQRQREEIIAAGHAQIAADRKAAAQALRQDVGKLATD 145

Query: 149 LVRKLGFSV--SDADVQKILDRKRDGIDA 175
           L  KL        A   + +DR    ++ 
Sbjct: 146 LAGKLVGESLEDAARQSRTIDRFLSELEE 174


>gi|163803601|ref|ZP_02197467.1| F0F1 ATP synthase subunit B [Vibrio sp. AND4]
 gi|159172595|gb|EDP57453.1| F0F1 ATP synthase subunit B [Vibrio sp. AND4]
          Length = 156

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 65/142 (45%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P L   +E R+  I+   +  + A ++++   ++  + L  A+ 
Sbjct: 11  AISFALFVWFCMKYVWPPLMQAIEERQKKIADGLQAAERAAKDLDLAQANASDQLKEAKR 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EIID+      Q L+  RE  + +  + L+ A+ E++  + +A  E+   V  +   
Sbjct: 71  TATEIIDQANKRKSQILDEAREEAQAERQNILAQAEAELEAERNRARDELRKQVATLAVA 130

Query: 149 LVRKLGFSVSDADVQKILDRKR 170
              K+     D D QK +    
Sbjct: 131 GAEKILERTIDKDAQKDILDNI 152


>gi|156741255|ref|YP_001431384.1| F0F1 ATP synthase subunit B [Roseiflexus castenholzii DSM 13941]
 gi|226694457|sp|A7NIR3|ATPF_ROSCS RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|156232583|gb|ABU57366.1| ATP synthase F0, B subunit [Roseiflexus castenholzii DSM 13941]
          Length = 163

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 19/154 (12%), Positives = 54/154 (35%)

Query: 23  SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEES 82
                  I      W+   F+   + +++  R N I    +  +  + ++ +    Y+  
Sbjct: 9   GLLIAQLINVVFVVWLLTTFLYRPILNMLNQRTNRIQEGLQDAERVREQLANAKRDYDAE 68

Query: 83  LAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIV 142
           LA AR  A  I+ +    A            +D     S+   + +  +++   E+   +
Sbjct: 69  LAKARQEAASILAQAQERARAQAAEIIAQAHRDAEKIKSDTLAQAEQERQRMLGELKDRM 128

Query: 143 GEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176
            E+      ++  +   A+  ++++     +  +
Sbjct: 129 AELVVLTAERVLNAELKANHDRLIEESLAELGKY 162


>gi|218290065|ref|ZP_03494232.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius LAA1]
 gi|218239899|gb|EED07087.1| ATP synthase F0, B subunit [Alicyclobacillus acidocaldarius LAA1]
          Length = 167

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/164 (18%), Positives = 67/164 (40%), Gaps = 1/164 (0%)

Query: 13  FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72
                    +  F +  I F I +++  RF    L+ ++E RR  I +   + + +  E 
Sbjct: 1   MFQVGGIFQVGTFIFSVISFLIVFFIIQRFAFKPLARMLEQRRIHIETQISEAEKSCEEA 60

Query: 73  ESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQK 132
           E +++  +  L  AR  A+ ++D+    A++      +  E++    L  ++  I   + 
Sbjct: 61  ERLLAEQQRLLEEARKEARNLLDQARIRADEQAREIVQKAEEEAARILEESRQAIVRERD 120

Query: 133 KASQEVYSIVGEVTKDLVRKLGFS-VSDADVQKILDRKRDGIDA 175
           +A   V   V E++ +L  KL    V+    + +L      +  
Sbjct: 121 EALAAVTKRVAELSVELATKLLRDHVTAELHKDLLAEAESKLGE 164


>gi|288554389|ref|YP_003426324.1| F0F1 ATP synthase subunit B [Bacillus pseudofirmus OF4]
 gi|14916964|sp|P22481|ATPF_BACPE RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|12061042|gb|AAG48359.1|AF330160_6 ATP synthase b subunit [Bacillus pseudofirmus OF4]
 gi|288545549|gb|ADC49432.1| ATP synthase b-subunit [Bacillus pseudofirmus OF4]
          Length = 163

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 63/148 (42%), Gaps = 1/148 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
            + F +  +   +F L  L  IME R  +I+      +  +++ E+ I+   ++L  AR 
Sbjct: 14  LLAFSVLLFFLSKFALKPLLGIMEKREQMINEQISSAEKNRKDSEAFIAEQRQALEQARM 73

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII      +EQ  +   +    D      +A  EI   +++A   +   V  ++  
Sbjct: 74  EANEIIQNAKKLSEQQGQDIVKAARNDAERIKESAVAEIQREKEQAVSALREQVAGLSVL 133

Query: 149 LVRK-LGFSVSDADVQKILDRKRDGIDA 175
           +  K +   +++A+ +K++      +  
Sbjct: 134 IATKVIEKELNEAEQEKLVQEYLKEVGE 161


>gi|187934398|ref|YP_001884707.1| F0F1 ATP synthase subunit B [Clostridium botulinum B str. Eklund
           17B]
 gi|188589454|ref|YP_001919894.1| F0F1 ATP synthase subunit B [Clostridium botulinum E3 str. Alaska
           E43]
 gi|226741344|sp|B2UZJ6|ATPF_CLOBA RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|226741345|sp|B2TJZ6|ATPF_CLOBB RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|187722551|gb|ACD23772.1| ATP synthase F0, B subunit [Clostridium botulinum B str. Eklund
           17B]
 gi|188499735|gb|ACD52871.1| ATP synthase F0, B subunit [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 159

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/157 (15%), Positives = 62/157 (39%), Gaps = 1/157 (0%)

Query: 19  STFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78
            T  S  F   I F I   +   F   ++  I+  R++ +     K+D    +    +  
Sbjct: 2   ETNYSVIFMTIINFCILVAILKHFFWDKIKGIINERQDFVDEQLLKVDEDSEKARMYLLE 61

Query: 79  YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV 138
            +  L  A+   K+I +     A +  +   E   ++    L  A+ +I   ++KA  E+
Sbjct: 62  NQRILQTAKEEGKKITESQKEKANKVYDEIVEDANEEAKSLLERAKTDIQREKEKAEYEI 121

Query: 139 YSIVGEVTKDL-VRKLGFSVSDADVQKILDRKRDGID 174
                ++  +L ++ L  ++ ++  ++++      + 
Sbjct: 122 KKQAVDLAIELSIKALEENIDESKHRELISNFITKVG 158


>gi|119947327|ref|YP_945007.1| ATP synthase F0, B subunit [Psychromonas ingrahamii 37]
 gi|226694445|sp|A1T0Z3|ATPF_PSYIN RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|119865931|gb|ABM05408.1| ATP synthase F0, B subunit [Psychromonas ingrahamii 37]
          Length = 156

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 64/146 (43%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           AI F +F W   +++ P L + +E R+  IS    + + A +++E   +   E L  A+ 
Sbjct: 11  AIAFAVFVWFCMKYVWPPLLAAIEDRQKKISDGLTQAERAGKDLELAQAKASEKLKEAKV 70

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EII++      Q +E  +   E +    ++  + E++  + +  +E+   V  +   
Sbjct: 71  QAAEIIEQANKRRNQIVEAAKTEAETERQKIIAQGEAEVEVDRNRVREELRLKVSALAIA 130

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              K+   S+       I+D+    +
Sbjct: 131 GAEKIIKRSIDKEANSDIIDKLVAEL 156


>gi|300024395|ref|YP_003757006.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526216|gb|ADJ24685.1| H+transporting two-sector ATPase B/B' subunit [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 163

 Score = 73.7 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 25/160 (15%), Positives = 66/160 (41%), Gaps = 5/160 (3%)

Query: 16  FDTSTFLSQFFWLAIIFGIFYWVTHRFILPR-LSSIMEVRRNLISSDQEKMDSAKREVES 74
            D +   +  FW+ + F  F  +   + +P  +  +++ R + I  + ++    + + ++
Sbjct: 2   LDPN---NPLFWVLLAFLTFIALVLYYRVPALIGKMLDDRADAIRKELDEARKLREDAQA 58

Query: 75  MISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKA 134
           +++ Y+     A   A+ IID+    AE      R+   + L  +   A+ +I   + +A
Sbjct: 59  LLADYQRKAREAENEARSIIDQAKREAEALAVDARKSLAESLERRSKIAEEKIARAETQA 118

Query: 135 SQEVYSIVGEVTKDLVRKLGFSVSDADV-QKILDRKRDGI 173
             EV +   +       +L  + +   V   ++ +    +
Sbjct: 119 LSEVRATAVDTAISAAHELLKTRASGSVGDSLITQSISDL 158


>gi|300858263|ref|YP_003783246.1| ATP synthase subunit B [Corynebacterium pseudotuberculosis FRC41]
 gi|300685717|gb|ADK28639.1| ATP synthase B chain [Corynebacterium pseudotuberculosis FRC41]
 gi|302205984|gb|ADL10326.1| F0F1 ATP synthase subunit B [Corynebacterium pseudotuberculosis
           C231]
 gi|302330537|gb|ADL20731.1| F0F1 ATP synthase subunit B [Corynebacterium pseudotuberculosis
           1002]
 gi|308276219|gb|ADO26118.1| F0F1 ATP synthase subunit B [Corynebacterium pseudotuberculosis
           I19]
          Length = 188

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/152 (18%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  ++  I   +  +F+LP+   ++  R + I    ++ ++A+ E ++ +  Y   LA
Sbjct: 30  IVWSLVVLVIVSILFKKFVLPKYREVLTEREDRIKGGIQRAEAAQAEAKAALEKYNAQLA 89

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            ARA A EI +   A  +Q     +    ++    + + + ++   +++  +E+   +G+
Sbjct: 90  EARAEAAEIREDARAKGKQIEADMKAKATEESNRIIESGEKQLAAQREQVVEELRREMGQ 149

Query: 145 VTKDLVRKLGFSVSDADVQK--ILDRKRDGID 174
            +  L  +L       DV++   +D+    +D
Sbjct: 150 NSISLAERLLGDQLSDDVKRSGTIDKFLAELD 181


>gi|114777433|ref|ZP_01452430.1| ATP synthase F0, B subunit [Mariprofundus ferrooxydans PV-1]
 gi|114552215|gb|EAU54717.1| ATP synthase F0, B subunit [Mariprofundus ferrooxydans PV-1]
          Length = 165

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 55/148 (37%), Gaps = 1/148 (0%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
              + I+F + Y +  R +LPR+ S +E R   I  + E     +   E M       L 
Sbjct: 4   IVSVLILFIMLYLLLKRQVLPRILSGLERRTRQIEQEMEGARQQREVTERMREESAARLL 63

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A    + ++D       +  E     +E  +  +    + ++   +++A QE+ +   +
Sbjct: 64  QADQETQAMLDASGQRVVEQREQLMREWELQVESQTQQFREDVARSRRQAIQEIRAQSAD 123

Query: 145 VTKDLVRKLG-FSVSDADVQKILDRKRD 171
           +      KL    +   D    +D   +
Sbjct: 124 LVVAETEKLLHQQMDADDTDTRVDGAIE 151


>gi|85374332|ref|YP_458394.1| hypothetical protein ELI_07525 [Erythrobacter litoralis HTCC2594]
 gi|84787415|gb|ABC63597.1| hypothetical protein ELI_07525 [Erythrobacter litoralis HTCC2594]
          Length = 164

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 39/161 (24%), Positives = 76/161 (47%), Gaps = 3/161 (1%)

Query: 13  FPPFD--TSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKR 70
            P       T+ SQ FWL + FG  ++V  R ++PR+ + +  R   I+ D     +A+ 
Sbjct: 1   MPQIAQLAETYSSQIFWLLVFFGFTFFVIGRGMVPRVMATVGERDKQIADDLAAAQAARD 60

Query: 71  EVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDM 130
           + ++   ++ E     RA A++++ +  A A    E +    +K L  KL+ A+  I   
Sbjct: 61  KADAEEEAWRERENANRADAQKLVAEAKADAAAKSEKKIAAAQKRLDKKLAEAEQRIAGA 120

Query: 131 QKKASQEVYSIVGEVTKDLVRKL-GFSVSDADVQKILDRKR 170
           +  A  E+ ++  E  +D+V++L G SV     ++ +    
Sbjct: 121 RSDALAEIETVAAEAAQDIVQRLAGVSVPRPTAEQAVKEAM 161


>gi|284049045|ref|YP_003399384.1| ATP synthase F0, B subunit [Acidaminococcus fermentans DSM 20731]
 gi|283953266|gb|ADB48069.1| ATP synthase F0, B subunit [Acidaminococcus fermentans DSM 20731]
          Length = 163

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/140 (22%), Positives = 63/140 (45%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
                + F I  WV  +F    L   M+ RR  I  D ++ D A++E E++   Y   L 
Sbjct: 8   LIAQVVNFIILLWVLAKFAYKPLLKAMDDRRTKIVKDMDQADHARKEAEALKQEYVNQLK 67

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+  A +I+ K  A A+Q  +      +K+    L++ +  ++  +KKA  +V   +  
Sbjct: 68  NAKKEANDIVSKANAMAQQLHDEALANAQKEREELLASGRQTVEMERKKALLDVREQIIA 127

Query: 145 VTKDLVRKLGFSVSDADVQK 164
           ++ ++  ++     D+   +
Sbjct: 128 LSTEIAGRVLQEKLDSAEDR 147


>gi|182420280|ref|ZP_02951509.1| ATP synthase F0, B subunit [Clostridium butyricum 5521]
 gi|237666696|ref|ZP_04526681.1| ATP synthase F0, B subunit [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182375875|gb|EDT73467.1| ATP synthase F0, B subunit [Clostridium butyricum 5521]
 gi|237657895|gb|EEP55450.1| ATP synthase F0, B subunit [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 159

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 60/154 (38%), Gaps = 1/154 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
            S      + FGI   +   F   ++  I+E R++ I     K D    +    +   E 
Sbjct: 5   FSTILMTWVNFGIIVLILKHFFWDKIKGIIEERQDAIDEKLTKADEDSEKARMYLLQNER 64

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  A+   K+I +K     ++  E   +  + +    +  A  EI+  ++KA  EV   
Sbjct: 65  ILKDAKEEGKKITEKQKQKGDKIYEEIVDNAKTEANALIERANVEIEREKEKAEYEVKKQ 124

Query: 142 VGEVTKDL-VRKLGFSVSDADVQKILDRKRDGID 174
              +  +L ++ L  S+ +   +K++      + 
Sbjct: 125 AVNLAVELSIKALEGSIDEDVHRKLISDFIAKVG 158


>gi|148550499|ref|YP_001270601.1| F0F1 ATP synthase subunit B [Pseudomonas putida F1]
 gi|325275316|ref|ZP_08141269.1| F0F1 ATP synthase subunit B [Pseudomonas sp. TJI-51]
 gi|226694441|sp|A5WBA7|ATPF_PSEP1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|148514557|gb|ABQ81417.1| ATP synthase F0, B subunit [Pseudomonas putida F1]
 gi|324099564|gb|EGB97457.1| F0F1 ATP synthase subunit B [Pseudomonas sp. TJI-51]
          Length = 156

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 63/145 (43%), Gaps = 1/145 (0%)

Query: 30  IIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAH 89
           + F IF     +++ P + + ++ R+  I+   +  + A R++E       + L  A+A 
Sbjct: 12  VAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEKAGQQLREAKAQ 71

Query: 90  AKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDL 149
           A EII++    A Q +E  RE    +     + A  EI+     A   + + VG +    
Sbjct: 72  AAEIIEQSKKRAAQLVEEAREQARVEADRVKAQALAEIEQELNSAKDALRAQVGALAVGG 131

Query: 150 VRKL-GFSVSDADVQKILDRKRDGI 173
             K+ G ++      +++++    I
Sbjct: 132 AEKILGATIDQNAHAELVNKLAAEI 156


>gi|255326272|ref|ZP_05367358.1| ATP synthase F0, B subunit [Rothia mucilaginosa ATCC 25296]
 gi|283458322|ref|YP_003362942.1| F0F1-type ATP synthase, subunit b [Rothia mucilaginosa DY-18]
 gi|255296726|gb|EET76057.1| ATP synthase F0, B subunit [Rothia mucilaginosa ATCC 25296]
 gi|283134357|dbj|BAI65122.1| F0F1-type ATP synthase, subunit b [Rothia mucilaginosa DY-18]
          Length = 185

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 64/155 (41%), Gaps = 2/155 (1%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           + +     I F I Y++  ++++P    I + R+  I     K + A+ E  +    Y +
Sbjct: 21  VGEIVITLIGFLILYYIVAKYVVPAFEKIYQDRKEAIEGGLAKAEKAQAEAAAARDEYTQ 80

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
            L  AR  A++I ++  A  E  +   RE    +      NA   I+  +  A+  + S 
Sbjct: 81  QLESARLEAQKIREEARAEGEAIIADARERATAEAQRISDNAAKAIEAERAAAAVSLRSE 140

Query: 142 VGEVTKDLVRKLGFSV--SDADVQKILDRKRDGID 174
           VG +   L  K+       D    +++DR    ++
Sbjct: 141 VGTLATTLAGKIVGEALNDDERSARVVDRFLADLE 175


>gi|308234730|ref|ZP_07665467.1| F0F1 ATP synthase subunit B [Gardnerella vaginalis ATCC 14018]
 gi|311113895|ref|YP_003985116.1| ATP synthase F0 sector subunit B [Gardnerella vaginalis ATCC 14019]
 gi|310945389|gb|ADP38093.1| ATP synthase F0 sector subunit B [Gardnerella vaginalis ATCC 14019]
          Length = 180

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 69/152 (45%), Gaps = 2/152 (1%)

Query: 25  FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84
             W  +I  +     ++F++P+  +I++ R   I     K  + +RE + + S  EE LA
Sbjct: 20  VIWSLVILVVLAAFFYKFVMPKFQAILDERAEKIEGGMSKAANVQREADELKSQMEEELA 79

Query: 85  IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144
            A+A A +  ++  A A + ++  R+  EKD    +S AQ  I+   K A   +   V  
Sbjct: 80  QAQADAAKTREQARAQASKIVDEARQRAEKDAAKIISEAQYSIEAQHKHAMSSLQGEVSV 139

Query: 145 VTKDLVRKLGFSVSDADV--QKILDRKRDGID 174
           +   L  K+  S  D D    KI+D   D + 
Sbjct: 140 LAAALAGKILASKLDDDTVGSKIIDHVIDEVG 171


>gi|254523449|ref|ZP_05135504.1| ATP synthase F0, B subunit [Stenotrophomonas sp. SKA14]
 gi|219721040|gb|EED39565.1| ATP synthase F0, B subunit [Stenotrophomonas sp. SKA14]
          Length = 173

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 35/146 (23%), Positives = 60/146 (41%), Gaps = 1/146 (0%)

Query: 29  AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARA 88
           A+ F    W+    I P L + +E R+  I+      D +++++        E+L  AR 
Sbjct: 28  ALAFAGLIWIIATKIWPPLMNAIEERQQKIAEGLAAADRSQKDLAQAQEKVNEALKEART 87

Query: 89  HAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKD 148
            A EIID+  A A Q ++  R     +   +   AQ EID    +A +++   V  +   
Sbjct: 88  KANEIIDQAHARANQIVDAARNEAITEATRQKELAQAEIDAAANRAREDLRKQVSALAVT 147

Query: 149 LVRKLGF-SVSDADVQKILDRKRDGI 173
              KL    +     + +LD     I
Sbjct: 148 GAEKLLKREIDANAHKALLDELASEI 173


>gi|15674804|ref|NP_268978.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes M1 GAS]
 gi|71910390|ref|YP_281940.1| F0F1 ATP synthase subunit B [Streptococcus pyogenes MGAS5005]
 gi|81533828|sp|Q9A0J1|ATPF_STRP1 RecName: Full=ATP synthase subunit b; AltName: Full=ATP synthase
           F(0) sector subunit b; AltName: Full=ATPase subunit I;
           AltName: Full=F-type ATPase subunit b; Short=F-ATPase
           subunit b
 gi|13621934|gb|AAK33699.1| putative proton-translocating ATPase, subunit b [Streptococcus
           pyogenes M1 GAS]
 gi|71853172|gb|AAZ51195.1| ATP synthase B chain [Streptococcus pyogenes MGAS5005]
          Length = 164

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 23/155 (14%), Positives = 60/155 (38%), Gaps = 1/155 (0%)

Query: 22  LSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEE 81
           +  F  +     +   +  +F    + SI++ R   IS D ++ + ++   + + +  + 
Sbjct: 9   VGNFILVTGSVIVLLLLIKKFAWGAIESILQTRSQQISRDIDQAEQSRLSAQQLEAKSQA 68

Query: 82  SLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSI 141
           +L  +R  A +II       +   +        +       A  +I+  +  A   V + 
Sbjct: 69  NLDASRLQASKIISDAKEIGQLQGDKLVAEATDEAKRLKEKALTDIEQSKSDAISAVKTE 128

Query: 142 VGEVTKDLVRKL-GFSVSDADVQKILDRKRDGIDA 175
           + ++T  L  K+ G ++      +++D   D +  
Sbjct: 129 MSDLTVLLAEKIMGANLDKTAQSQLIDSYLDDLGE 163


>gi|258406336|ref|YP_003199078.1| ATP synthase F0, B subunit [Desulfohalobium retbaense DSM 5692]
 gi|257798563|gb|ACV69500.1| ATP synthase F0, B subunit [Desulfohalobium retbaense DSM 5692]
          Length = 192

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/174 (14%), Positives = 71/174 (40%), Gaps = 2/174 (1%)

Query: 1   MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60
           MA ++ +            ++++  FW  + F IF  + ++    R+      RR+ I++
Sbjct: 17  MAVAAWASEQGGGEAAHGGSWMN-LFWRTVNFVIFVAIIYKLAGKRIREFFTGRRHRIAT 75

Query: 61  DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120
           + + +++ K + E  ++  E+S+A      ++I+ +     E   E       +      
Sbjct: 76  ELKDLETRKADTEKRLAEVEQSIADLDKKREDILAEYKQQGEALKESIVAKAHERAEQIQ 135

Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRK-LGFSVSDADVQKILDRKRDGI 173
           + A+       ++A ++V + + E       K +   ++  D +K++      +
Sbjct: 136 AQAEKTAQQELRQAVKDVRAEIAEAVASAAEKSIADKLNKEDHKKLVQDYLTKV 189


>gi|162457649|ref|YP_001620016.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce
           56']
 gi|161168231|emb|CAN99536.1| H(+)-transporting two-sector ATPase [Sorangium cellulosum 'So ce
           56']
          Length = 333

 Score = 73.7 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/160 (16%), Positives = 55/160 (34%), Gaps = 1/160 (0%)

Query: 17  DTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMI 76
           D       F    + FG+   +  RF    ++  ++ R+  I+ + +     K+E E  +
Sbjct: 157 DPKNEPPPFLASVLNFGLLALIVVRFGRKPIAEALKKRKQTITQELDNASRLKQEAELRL 216

Query: 77  SSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQ 136
             YE+ L        E+  +  A AE          E+  +    +A+   +   K A  
Sbjct: 217 EEYEDKLTRLEETLAELKAEHAAQAEVEKAHVLAEAEQRRVRMRRDAEFRAEQELKAARA 276

Query: 137 EVYS