RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781086|ref|YP_003065499.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter asiaticus str. psy62] (176 letters) >gnl|CDD|31055 COG0711, AtpF, F0F1-type ATP synthase, subunit b [Energy production and conversion]. Length = 161 Score = 69.9 bits (171), Expect = 3e-13 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 1/145 (0%) Query: 25 FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84 W I F I W+ +F+ + ++ R+ I+ D + + K E +++++ YE+ L Sbjct: 9 ILWQLIAFVILLWLLKKFVWKPILKALDERQAKIADDLAEAERLKEEAQALLAEYEQELE 68 Query: 85 IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144 AR A EII++ AEQ E + E++L A+ EI+ +++A +E+ + V E Sbjct: 69 EAREQASEIIEQAKKEAEQIAEEIKAEAEEELERIKEAAEAEIEAEKERALEELRAEVAE 128 Query: 145 VTKDLVRK-LGFSVSDADVQKILDR 168 + + K LG V +A + ++D Sbjct: 129 LAVAIAEKLLGKKVDEAAQKDLIDA 153 >gnl|CDD|109486 pfam00430, ATP-synt_B, ATP synthase B/B' CF(0). Part of the CF(0) (base unit) of the ATP synthase. The base unit is thought to translocate protons through membrane (inner membrane in mitochondria, thylakoid membrane in plants, cytoplasmic membrane in bacteria). The B subunits are thought to interact with the stalk of the CF(1) subunits. This domain should not be confused with the ab CF(1) proteins (in the head of the ATP synthase) which are found in pfam00006. Length = 132 Score = 55.0 bits (133), Expect = 1e-08 Identities = 31/129 (24%), Positives = 61/129 (47%) Query: 25 FFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLA 84 I F I + F L I++ R+ I+++ ++ + ++ ++++ E+ LA Sbjct: 2 LETNLINFLILVGLLIYFGYKPLGKILDERKEKIANNIKEAEERLKQAAALLAEAEQQLA 61 Query: 85 IARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGE 144 ARA A EII+ A++ E +KD L +A+ EI+ +++A E+ V Sbjct: 62 QARAEASEIINNAKKEAQKLKEEILAEAQKDAERLLESARAEIEQEKEQALAELRQQVAA 121 Query: 145 VTKDLVRKL 153 + + KL Sbjct: 122 LAVQIAEKL 130 >gnl|CDD|111240 pfam02326, YMF19, Plant ATP synthase F0. This family corresponds to subunit 8 (YMF19) of the F0 complex of plant and algae mitochondrial F-ATPases (EC:3.6.1.34). Length = 84 Score = 51.6 bits (124), Expect = 1e-07 Identities = 21/59 (35%), Positives = 34/59 (57%) Query: 14 PPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72 P D T+ +QFFWL + F FY FILP++S I+++R+ L+SS ++ + Sbjct: 1 PQLDKFTYFTQFFWLCLFFFTFYIFLLNFILPKISRILKLRKKLLSSLISSKLGKEQSL 59 >gnl|CDD|177224 MTH00169, ATP8, ATP synthase F0 subunit 8; Provisional. Length = 67 Score = 40.4 bits (95), Expect = 3e-04 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Query: 14 PPFDTSTFLSQFFW-LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREV 72 P D+ T+L+Q+ W L I+F +F + + +ILP++ + +R ++S + K + K E+ Sbjct: 2 PQLDSVTYLTQYIWTLIILFFLFSLLVN-YILPKIQQQLVIRTKGVNSVEGKKERPKIEI 60 >gnl|CDD|146524 pfam03938, OmpH, Outer membrane protein (OmpH-like). This family includes outer membrane proteins such as OmpH among others. Skp (OmpH) has been characterized as a molecular chaperone that interacts with unfolded proteins as they emerge in the periplasm from the Sec translocation machinery. Length = 157 Score = 33.8 bits (78), Expect = 0.027 Identities = 15/113 (13%), Positives = 46/113 (40%), Gaps = 11/113 (9%) Query: 45 PRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQN 104 P + + Q ++ ++E++ ++ A A++ + + +Q Sbjct: 31 PAGKAAQKQLEKEFKKLQAELQKKQKELQKEEQKLQKQAATLSEEARKAKQQELQQKQQE 90 Query: 105 LEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSV 157 L+ +++ AQ E+ Q++ Q +Y + + K++ ++ G+ + Sbjct: 91 LQQKQQ-----------AAQQELQQKQQELLQPIYDKIDKAIKEVAKEKGYDL 132 >gnl|CDD|113511 pfam04744, Monooxygenase_B, Monooxygenase subunit B protein. Family of membrane associated monooxygenases (EC 1.13.12.-) which utilize O(2) to oxidize their substrate. Family members include both ammonia and methane monooxygenases involved in the oxidation of their respective substrates. These enzymes are multi-subunit complexes. This family represents the B subunit of the enzyme; the A subunit is thought to contain the active site.. Length = 381 Score = 33.6 bits (77), Expect = 0.029 Identities = 10/41 (24%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 25 FFWLAI-IFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64 FW+ + I I YW LPR ++ + + +K Sbjct: 160 LFWMILGIAWIGYWFRRPMFLPRYLRVLAGGDDELVDAMDK 200 >gnl|CDD|109739 pfam00695, vMSA, Major surface antigen from hepadnavirus. Length = 364 Score = 31.1 bits (70), Expect = 0.19 Identities = 13/50 (26%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Query: 2 ASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRF-ILPRLSSI 50 AS+ S S P S +S WL +I+ + W IL + Sbjct: 309 ASARFSWLSLLVPSVQWSVGVSLTVWLLLIWMTWSWGPQLLSILTPFIPL 358 >gnl|CDD|37742 KOG2531, KOG2531, KOG2531, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism]. Length = 545 Score = 29.9 bits (67), Expect = 0.43 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 22/120 (18%) Query: 40 HRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVA 99 RF P++ I + E + +R S++SS+ SL + + D Sbjct: 170 ERFTGPQIRKIYQQE-------PEAYEKTERI--SLVSSFLASLLLGSYAPIDESD---- 216 Query: 100 AAEQNL-EFQREVFEKDLLHKLSNAQNEIDDMQKKASQEV--YSIVGEVTKDLVRKLGFS 156 + NL + +++ + K LL + D+++K + V SI G ++K V++ GF Sbjct: 217 GSGMNLLDIRKKKWSKALLDACAP------DLEEKLGKPVPPMSIAGTISKYFVKRYGFP 270 >gnl|CDD|37135 KOG1924, KOG1924, KOG1924, RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms, Cytoskeleton]. Length = 1102 Score = 29.2 bits (65), Expect = 0.59 Identities = 14/71 (19%), Positives = 29/71 (40%), Gaps = 12/71 (16%) Query: 85 IARAHAKEIIDKVVAAAEQNLEFQREVFEK-------DLLHKLSNAQNEIDDMQKKASQE 137 R + + + L+ Q +VF++ +L +L + + E+DD E Sbjct: 332 FMRDGLHKYLPDLTEINNDILDVQLKVFDEHKEDDLEELSGRLEDIRAEMDDA-----NE 386 Query: 138 VYSIVGEVTKD 148 V+ ++ KD Sbjct: 387 VFELLANTVKD 397 >gnl|CDD|177041 CHL00118, atpG, ATP synthase CF0 B' subunit; Validated. Length = 156 Score = 29.2 bits (66), Expect = 0.60 Identities = 24/125 (19%), Positives = 48/125 (38%), Gaps = 22/125 (17%) Query: 28 LAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISSYEESLAIAR 87 +A+ F + + + + L +++ R+ I + K + + YE+ L+ AR Sbjct: 28 MALQFLLLMVLLNIILYKPLLKVLDERKEYIRKNLTKASEILAKANELTKQYEQELSKAR 87 Query: 88 AHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDDMQKKASQEVYSIVGEVTK 147 A+ I + A++ +E NE+ QK S++ E TK Sbjct: 88 KEAQLEITQSQKEAKEIVE------------------NELKQAQKYID----SLLNEATK 125 Query: 148 DLVRK 152 L + Sbjct: 126 QLEAQ 130 >gnl|CDD|177105 MTH00025, ATP8, ATP synthase F0 subunit 8; Validated. Length = 70 Score = 28.9 bits (65), Expect = 0.84 Identities = 13/48 (27%), Positives = 26/48 (54%) Query: 14 PPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSD 61 P DT+T+L+Q+ W I+ + + F+LP + +R++L+ Sbjct: 2 PQLDTTTYLTQYRWTLIVLFLLLFFLVFFVLPTIKRNWLIRKSLMKKG 49 >gnl|CDD|32640 COG2811, NtpF, Archaeal/vacuolar-type H+-ATPase subunit H [Energy production and conversion]. Length = 108 Score = 28.0 bits (62), Expect = 1.4 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 4/91 (4%) Query: 51 MEVRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQ----NLE 106 M ++ ++ SA E+E E+ + AR A+EII++ AE+ LE Sbjct: 2 MMDDSEVLREIKKAEISADEEIEEAKEEAEQIIKEAREEAREIIEEAEEEAEKLAQEILE 61 Query: 107 FQREVFEKDLLHKLSNAQNEIDDMQKKASQE 137 RE E++ L+ A+ E + KA++ Sbjct: 62 EAREEAEEEAEEILAEAEKEASAILSKAAEG 92 >gnl|CDD|31739 COG1550, COG1550, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 95 Score = 27.9 bits (62), Expect = 1.6 Identities = 18/91 (19%), Positives = 37/91 (40%), Gaps = 8/91 (8%) Query: 37 WVTHRFILPRLSSIMEVR---RNLISSDQEKMDSAKREVESMISSYEESLAIA-----RA 88 + L + S+ E R R +++ + K + + E + IA RA Sbjct: 5 VLECELRLYDVRSLKEKRAVLRPIVTRLKNKFNVSVAETGYQDLWQRAEIGIATVSSDRA 64 Query: 89 HAKEIIDKVVAAAEQNLEFQREVFEKDLLHK 119 A+ ++D+ + + EF+R ++ LH Sbjct: 65 VAERVLDRALDFIDAEPEFERAETVREWLHL 95 >gnl|CDD|109186 pfam00119, ATP-synt_A, ATP synthase A chain. Length = 217 Score = 27.6 bits (62), Expect = 1.7 Identities = 9/39 (23%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Query: 15 PFDTSTFLSQFFWLAIIFGIFYWVTHRFILP-RLSSIME 52 F + L I+F + T +P R S +E Sbjct: 2 NFHLLSLFMLLLLLLILFLVSLATTKNLTVPSRFQSFLE 40 >gnl|CDD|153280 cd07596, BAR_SNX, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 218 Score = 26.9 bits (60), Expect = 2.8 Identities = 17/93 (18%), Positives = 33/93 (35%), Gaps = 12/93 (12%) Query: 71 EVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREV-----FE-------KDLLH 118 E + I EE L A+ ++ + EF + + E + L Sbjct: 8 EAKDYILKLEEQLKKLSKQAQRLVKRRRELGSALGEFGKALIKLAKCEEEVGGELGEALS 67 Query: 119 KLSNAQNEIDDMQKKASQEVYSIVGEVTKDLVR 151 KL A E+ + + + + + E K+ +R Sbjct: 68 KLGKAAEELSSLSEAQANQELVKLLEPLKEYLR 100 >gnl|CDD|133462 cd06852, GT_MraY, Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) is an enzyme responsible for the formation of the first lipid intermediate in the synthesis of bacterial cell wall peptidoglycan. It catalyzes the formation of undecaprenyl-pyrophosphoryl-N-acetylmuramoyl- pentapeptide from UDP-MurNAc-pentapeptide and undecaprenyl-phosphate. It is an integral membrane protein with possibly ten transmembrane domains. Length = 280 Score = 27.1 bits (61), Expect = 3.1 Identities = 8/30 (26%), Positives = 8/30 (26%) Query: 9 FSSRFPPFDTSTFLSQFFWLAIIFGIFYWV 38 F T L F I GI Y Sbjct: 87 LLYYFNGSGTLITLPFFKNGLIDLGILYIP 116 >gnl|CDD|34396 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only]. Length = 297 Score = 26.9 bits (59), Expect = 3.4 Identities = 13/41 (31%), Positives = 24/41 (58%) Query: 23 SQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQE 63 + F LA+ ++ +V HR+ L LS + + + +L SDQ+ Sbjct: 257 TALFKLAVANNVYNFVEHRYALLELSLLGQDQDDLAESDQQ 297 >gnl|CDD|38173 KOG2962, KOG2962, KOG2962, Prohibitin-related membrane protease subunits [General function prediction only]. Length = 322 Score = 26.6 bits (58), Expect = 3.5 Identities = 22/103 (21%), Positives = 48/103 (46%), Gaps = 16/103 (15%) Query: 53 VRRNLISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQN-----LEF 107 +RRN E M++ K ++ +I++ ++ + A + K V AE+N + Sbjct: 179 IRRNF-----ELMEAEKTKL--LIAAEKQKVVEKEAETERK--KAVIEAEKNAQVAKILM 229 Query: 108 QREVFEKDLLHKLSNAQNE--IDDMQKKASQEVYSIVGEVTKD 148 Q+++ EK+ ++S ++ + + KA E Y + E + Sbjct: 230 QQKLMEKETEKRISEIEDAAFLAREKSKADAEYYRALKEAEAN 272 >gnl|CDD|110172 pfam01150, GDA1_CD39, GDA1/CD39 (nucleoside phosphatase) family. Length = 424 Score = 26.6 bits (59), Expect = 3.6 Identities = 12/42 (28%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Query: 19 STFLSQFFWLAIIF----GIFYWVTHRFILPRLSSIMEVRRN 56 STF + II G++ W+T ++L R E R Sbjct: 118 STFPVDDQGVRIIDGAEEGLYGWITVNYLLGRFGKDPEQCRQ 159 >gnl|CDD|31648 COG1459, PulF, Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 397 Score = 26.7 bits (59), Expect = 3.9 Identities = 26/144 (18%), Positives = 57/144 (39%), Gaps = 22/144 (15%) Query: 16 FDTSTFLSQFFWL-----AIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAK- 69 S FL ++ WL II + + + R + +R L K A+ Sbjct: 207 LALSDFLREWGWLLLLIIIIIAIGYLLLLRKPAGRRRLDRLLLRLPLFGKLVRKYALARF 266 Query: 70 -REVESMISS---YEESLAIA-----RAHAKEIIDKVVAAAEQNLEF-----QREVFEKD 115 R + +++SS E+L IA A ++ +++++ + + +F Sbjct: 267 ARTLGTLLSSGVPLLEALDIAAETVSNAFLRQALEEIIQEVREGGSLSQALEKTGLFPPL 326 Query: 116 LLHKLSNAQ--NEIDDMQKKASQE 137 LL ++ + ++D+M +K + Sbjct: 327 LLQMIAVGEESGKLDEMLEKVADF 350 >gnl|CDD|38736 KOG3527, KOG3527, KOG3527, Erythrocyte membrane protein 4.1 and related proteins of the ERM family [General function prediction only]. Length = 975 Score = 26.6 bits (58), Expect = 4.2 Identities = 22/99 (22%), Positives = 37/99 (37%), Gaps = 7/99 (7%) Query: 57 LISSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDL 116 L+ S + + + E S Y A KE+ DKV E + + + Sbjct: 149 LLGSYTVQSELGDYDPEEHGSDYLSDFKFAPNQTKELEDKV---MELHKTHRGMTPAEAE 205 Query: 117 LHKLSNAQNE----IDDMQKKASQEVYSIVGEVTKDLVR 151 +H L NA+ +D K S+ V ++G L+ Sbjct: 206 IHFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCASGLLI 244 >gnl|CDD|146416 pfam03763, Remorin_C, Remorin, C-terminal region. Remorins are plant-specific plasma membrane-associated proteins. In tobacco remorin co-purifies with lipid rafts. Most remorins have a variable, proline-rich C-half and a more conserved N-half that is predicted to form coiled coils. Consistent with this, circular dichroism studies have demonstrated that much of the protein is alpha-helical. Remorins exist in plasma membrane preparations as oligomeric structures and form filaments in vitro. The proteins can bind polyanions including the extracellular matrix component oligogalacturonic acid (OGA). In vitro, remorin in plasma membrane preparations is phosphorylated (principally on threonine residues) in the presence of OGA and thus co-purifies with a protein kinases(s). The biological functions of remorins are unknown but roles as components of the membrane/cytoskeleton are possible. Length = 112 Score = 26.5 bits (59), Expect = 4.4 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 8/74 (10%) Query: 69 KREVESMISSYEESL---AIARAHAKEII-----DKVVAAAEQNLEFQREVFEKDLLHKL 120 K EVE+ ++EE+ R +E +K A AE L+ EK + Sbjct: 3 KEEVEAKADAWEEAEKAKINNRYKREEAKIQAWENKKKAKAEAELKKIERKLEKKKAEAM 62 Query: 121 SNAQNEIDDMQKKA 134 +N++ KKA Sbjct: 63 EKLKNKLAAAHKKA 76 >gnl|CDD|38067 KOG2856, KOG2856, KOG2856, Adaptor protein PACSIN [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport, Cytoskeleton]. Length = 472 Score = 26.2 bits (57), Expect = 4.7 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Query: 62 QEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAE--QNLEFQREVFEKDLLHK 119 Q++++ K+EV+ YE++LA + ++ + E Q E +R F K++L K Sbjct: 183 QDRVEKCKQEVQKTKEKYEKTLAELNKYTPVYMEDMEQVFEQCQQFEEKRLQFFKEILLK 242 Query: 120 L 120 + Sbjct: 243 V 243 >gnl|CDD|35676 KOG0455, KOG0455, KOG0455, Homoserine dehydrogenase [Amino acid transport and metabolism]. Length = 364 Score = 26.1 bits (57), Expect = 5.5 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 115 DLLHKLSNAQNEIDDMQKKASQE--VYSIVGEV 145 + LH L I++ K+AS E V VG + Sbjct: 262 EFLHGLVKLDQNIEERVKEASSEGKVLRFVGVI 294 >gnl|CDD|37313 KOG2102, KOG2102, KOG2102, Exosomal 3'-5' exoribonuclease complex, subunit Rrp44/Dis3 [Translation, ribosomal structure and biogenesis]. Length = 941 Score = 26.2 bits (57), Expect = 5.6 Identities = 18/112 (16%), Positives = 29/112 (25%), Gaps = 14/112 (12%) Query: 59 SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKV----VAAAEQNLEFQREVFEK 114 +E M A V I + SLA+ R H + E K Sbjct: 667 FLVEEFMLLANISVAEKILASFPSLALLRRHPSPPPENFKPLVSLCLELGFNLDTSSS-K 725 Query: 115 DLLHKLSNAQNEIDDMQ---------KKASQEVYSIVGEVTKDLVRKLGFSV 157 L L +++ + ++ VY G G + Sbjct: 726 SLADSLDRIRDDDKPYLNTLLRILATRSMTRAVYFCSGSSDTPQFHHYGLAS 777 >gnl|CDD|35729 KOG0509, KOG0509, KOG0509, Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]. Length = 600 Score = 26.1 bits (57), Expect = 5.9 Identities = 10/44 (22%), Positives = 13/44 (29%), Gaps = 1/44 (2%) Query: 10 SSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEV 53 PP + FLS FW F + I+ V Sbjct: 336 FLLRPPLLSGFFLSTLFWF-YYFWFSKITPYTLFDFHYCFIISV 378 >gnl|CDD|133283 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1) alpha subfamily. EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes. EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha). eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis. EF-Tu can have no such role in bacteria. In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene. This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in yeast, and to associate with Dom34. It has been speculated that yeast Hbs1 and Dom34 proteins may function as part of a complex with a role in gene expression. Length = 219 Score = 25.9 bits (58), Expect = 5.9 Identities = 11/36 (30%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Query: 125 NEIDDMQKKASQEVY-SIVGEVTKDLVRKLGFSVSD 159 N++DD+ S+E Y I E++ ++K+G++ D Sbjct: 145 NKMDDVTVNWSEERYDEIKKELSP-FLKKVGYNPKD 179 >gnl|CDD|146007 pfam03169, OPT, OPT oligopeptide transporter protein. The OPT family of oligopeptide transporters is distinct from the ABC pfam00005 and PTR pfam00854 transporter families. OPT transporters were first recognized in fungi (Candida albicans and Schizosaccharomyces pombe), but this alignment also includes orthologues from Arabidopsis thaliana. OPT transporters are thought to have 12-14 transmembrane domains and contain the following motif: SPYxEVRxxVxxxDDP. Length = 605 Score = 26.1 bits (58), Expect = 6.1 Identities = 8/26 (30%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Query: 25 FFWLAIIFGIFYWVTHRFILPRLSSI 50 F + ++YW +I P LSS Sbjct: 162 FLIGFVASFVYYWFP-FYIFPALSSF 186 >gnl|CDD|177205 MTH00148, ND3, NADH dehydrogenase subunit 3; Provisional. Length = 117 Score = 25.6 bits (57), Expect = 7.4 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 12/33 (36%) Query: 3 SSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIF 35 SS+ S FS RF F LAI+F +F Sbjct: 47 SSARSPFSLRF------------FLLAILFLVF 67 >gnl|CDD|144473 pfam00888, Cullin, Cullin family. Length = 605 Score = 25.7 bits (56), Expect = 8.2 Identities = 21/104 (20%), Positives = 37/104 (35%), Gaps = 4/104 (3%) Query: 21 FLSQFFWLAIIFGIF--YWVTHRFILPRLSSIMEVRRNLISSDQEKMDSAKREVESMISS 78 F + L IF Y+V + + +++ R + D + +I Sbjct: 80 FSTSMKILNNIFMYLNRYYVKRKEVYEIYELGLDIWRESLF--DPIKDKLIDALLRLIEK 137 Query: 79 YEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSN 122 I R+ K ++D V + +L +E FEK L S Sbjct: 138 ERLGEIIDRSLIKNVLDMFVELGDDSLSVYKEDFEKPFLEATSE 181 >gnl|CDD|133351 cd04151, Arl1, Arl1 subfamily. Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network. Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting. In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors. Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding. Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2. Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi. In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability. Length = 158 Score = 25.4 bits (56), Expect = 8.9 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 13/72 (18%) Query: 59 SSDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLE---FQREVFEKD 115 S+D++++ +AK E+ +M+ EE L ++ +V A +Q++ + E+ EK Sbjct: 76 STDRDRLGTAKEELHAMLE--EEEL------KGAVL--LVFANKQDMPGALSEAEISEKL 125 Query: 116 LLHKLSNAQNEI 127 L +L + I Sbjct: 126 GLSELKDRTWSI 137 >gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC). BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions including organelle biogenesis, membrane trafficking or remodeling, and cell division and migration. The plant protein SCARFACE (SFC), also called VAscular Network 3 (VAN3), is a plant ACAP (ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein), an Arf GTPase Activating Protein (GAP) that plays a role in the trafficking of auxin efflux regulators from the plasma membrane to the endosome. It is required for the normal vein patterning in leaves. SCF contains an N-terminal BAR domain, followed by a Pleckstrin Homology (PH) domain, an Arf GAP domain, and C-terminal ankyrin (ANK) repeats. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 202 Score = 25.5 bits (56), Expect = 9.1 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Query: 68 AKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEK---DLLHKLSNA 123 A+R + YE++ + + K+ +++AAAE++L R FE DL+++L A Sbjct: 108 ARRRFDKASLDYEQARSKFLSLTKDAKPEILAAAEEDLGTTRSAFETARFDLMNRLHAA 166 >gnl|CDD|110765 pfam01790, LGT, Prolipoprotein diacylglyceryl transferase. Length = 257 Score = 25.2 bits (56), Expect = 9.2 Identities = 7/27 (25%), Positives = 11/27 (40%) Query: 20 TFLSQFFWLAIIFGIFYWVTHRFILPR 46 T L + I+F I W+ R + Sbjct: 174 TQLYESILEGIVFFIILWLRRRKKKLK 200 >gnl|CDD|164588 MTH00012, ND3, NADH dehydrogenase subunit 3; Validated. Length = 117 Score = 25.2 bits (55), Expect = 9.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 8/43 (18%) Query: 1 MASSSSSD------FSSRFPPFDTS--TFLSQFFWLAIIFGIF 35 +A+ S++D F F P T+ F +FF LAIIF +F Sbjct: 25 LAARSTADREKTSPFECGFDPHKTARIPFSLRFFLLAIIFIVF 67 >gnl|CDD|112963 pfam04173, DoxD, TQO small subunit DoxD. Acidianus ambivalens doxD is a subunit of the terminal quinol oxidase present in the plasma membrane of Acidianus ambivalens, with calculated molecular mass of 20.4 kDa. Thiosulphate:quinone oxidoreductase (TQO) is one of the early steps in elemental sulphur oxidation. A novel TQO enzyme was purified from the thermo-acidophilic archaeon Acidianus ambivalens and shown to consist of a large subunit (DoxD) and a smaller subunit (DoxA). The DoxD- and DoxA-like two subunits are fused together in a single polypeptide in the terminal quinol oxidase from Bacteroides thetaiotaomicron. Length = 167 Score = 25.1 bits (55), Expect = 9.8 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Query: 14 PPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLI 58 PP FL F ++ IIFG+ + +L RLSS++ L Sbjct: 61 PPLLV-GFLVMFTYVEIIFGLLMIIG---LLTRLSSLVAFYMALG 101 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.132 0.359 Gapped Lambda K H 0.267 0.0573 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,991,933 Number of extensions: 98054 Number of successful extensions: 592 Number of sequences better than 10.0: 1 Number of HSP's gapped: 587 Number of HSP's successfully gapped: 86 Length of query: 176 Length of database: 6,263,737 Length adjustment: 87 Effective length of query: 89 Effective length of database: 4,383,754 Effective search space: 390154106 Effective search space used: 390154106 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (24.9 bits)