BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781086|ref|YP_003065499.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter asiaticus str. psy62] (176 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781086|ref|YP_003065499.1| F0F1 ATP synthase subunit B' [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 354 bits (909), Expect = e-100, Method: Compositional matrix adjust. Identities = 176/176 (100%), Positives = 176/176 (100%) Query: 1 MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60 MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS Sbjct: 1 MASSSSSDFSSRFPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISS 60 Query: 61 DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120 DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL Sbjct: 61 DQEKMDSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKL 120 Query: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF Sbjct: 121 SNAQNEIDDMQKKASQEVYSIVGEVTKDLVRKLGFSVSDADVQKILDRKRDGIDAF 176 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 25.4 bits (54), Expect = 0.53, Method: Compositional matrix adjust. Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 22/85 (25%) Query: 60 SDQEKMDSAKREVESMISSYEESLAIARAHAKEIIDK-------------VVAAA----E 102 SD+EK+ S + + S +EE++A H + I+D V+AAA + Sbjct: 606 SDREKLFS--NSLARVQSHFEETIA---GHPQSIVDSISNSTNNLYDKIMVLAAALSESQ 660 Query: 103 QNLEFQREVFEKDLLHKLSNAQNEI 127 ++L+ + D++HK++NA+N++ Sbjct: 661 KSLDNSLKAHATDVVHKITNAENQL 685 >gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 12 RFPPFDTSTFLSQFFWLAIIFGIFY 36 RFP +S + QF + ++ G FY Sbjct: 238 RFPALGSSNVMGQFGLIPLLIGTFY 262 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 23.5 bits (49), Expect = 2.6, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query: 73 ESMISSY---EESLAIARAHAKEIIDKVVAAAEQNLEFQREVFEKDLLHKLSNAQNEIDD 129 ES+I + E L++ ++ KE +K +A LEF + E+ L +L N IDD Sbjct: 1076 ESLIKKFFGEEIKLSVFDSNTKES-NKSLAVINSTLEFAHSIRERVLFDELIQGINHIDD 1134 >gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 23.1 bits (48), Expect = 2.7, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Query: 13 FPPFDTSTFLSQFFWLAIIFGIFYWVTHRFILPRLSSIMEVRRNLISSDQEK 64 F P TF+ Q A+I G+F + + I L+S + R N I+ EK Sbjct: 604 FYPNHDKTFIEQ----AVISGVFNCESDQEINVSLASKLANRLNFIAEKSEK 651 >gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 294 Score = 22.7 bits (47), Expect = 3.6, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 16/23 (69%) Query: 131 QKKASQEVYSIVGEVTKDLVRKL 153 QKK +SI+G++T+++ + L Sbjct: 22 QKKVVLSSFSIIGDITQNIAKDL 44 >gi|254780709|ref|YP_003065122.1| cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Score = 22.3 bits (46), Expect = 5.4, Method: Compositional matrix adjust. Identities = 13/56 (23%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Query: 66 DSAKREVESMISSYEESLAIARAHAKEIIDKVVAAAEQNLEFQREVFE-KDLLHKL 120 D + E+E ++ + +A+A+ +E++ K A +++ QR +++ +L+HK+ Sbjct: 43 DGVREELEDLLIRSDIGVAVAQKIVEELLTKRYA---KDVSVQRVLYDVSELIHKM 95 >gi|254780220|ref|YP_003064633.1| hypothetical protein CLIBASIA_00525 [Candidatus Liberibacter asiaticus str. psy62] Length = 97 Score = 21.9 bits (45), Expect = 6.9, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 89 HAKEIIDKVVAAAEQN 104 H KE I K+V EQN Sbjct: 79 HLKEAIQKIVKTIEQN 94 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.132 0.359 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,541 Number of Sequences: 1233 Number of extensions: 3747 Number of successful extensions: 21 Number of sequences better than 100.0: 20 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 20 length of query: 176 length of database: 328,796 effective HSP length: 68 effective length of query: 108 effective length of database: 244,952 effective search space: 26454816 effective search space used: 26454816 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 35 (18.1 bits)