HHsearch alignment for GI: 254781087 and conserved domain: PRK07874

>PRK07874 F0F1 ATP synthase subunit C; Validated.
Probab=99.84  E-value=5.9e-21  Score=125.36  Aligned_cols=64  Identities=23%  Similarity=0.281  Sum_probs=60.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999987478999999999999982378789879999999999999999999999999
Q gi|254781087|r   20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML   86 (91)
Q Consensus        20 ~aak~IGAGlA~ig~~G~giGiG~if~~~i~~vaRNP~~~~~l~~~~ilG~Al~Ea~glfalviA~l   86 (91)
T Consensus        16 ~~i~~igyGLaaI---GpGIGiG~i~gk~ieg~ARQPE~~g~lrt~mflG~A~~EALaLiGlV~~fl   79 (80)
T PRK07874         16 TGLGAVGYGLAAI---GPGIGVGIVVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGFL   79 (80)
T ss_pred             CCHHHHHHHHHHH---CCCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             6658877778860---641358999999999996485677659999999999999999999999983