BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] (91 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] gi|254040764|gb|ACT57560.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 178 bits (451), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 91/91 (100%), Positives = 91/91 (100%) Query: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS Sbjct: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 Query: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI Sbjct: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 >gi|315122433|ref|YP_004062922.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495835|gb|ADR52434.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Score = 92.4 bits (228), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 42/61 (68%), Positives = 51/61 (83%) Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 YYS AAKY+A+GMACLGMG VALA+ NIF++YLSGA RNP AA+ + VL+FA +AESL Sbjct: 12 YYSGAAKYIAIGMACLGMGFVALAIGNIFSSYLSGALRNPSAAADQQARVLVFAAVAESL 71 Query: 77 G 77 G Sbjct: 72 G 72 >gi|158425885|ref|YP_001527177.1| ATP synthase C chain precursor [Azorhizobium caulinodans ORS 571] gi|158332774|dbj|BAF90259.1| ATP synthase C chain precursor [Azorhizobium caulinodans ORS 571] Length = 75 Score = 78.2 bits (191), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 37/70 (52%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGMGL + V NIF +LSGA RNP AA I A +AE LG+F Sbjct: 5 AAKFIGAGLACLGMGLAGIGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGLGIFS 64 Query: 81 LLVVMLLLFV 90 L+V ++LLFV Sbjct: 65 LVVALILLFV 74 >gi|154251152|ref|YP_001411976.1| F0F1 ATP synthase subunit C [Parvibaculum lavamentivorans DS-1] gi|154155102|gb|ABS62319.1| H+transporting two-sector ATPase C subunit [Parvibaculum lavamentivorans DS-1] Length = 74 Score = 72.4 bits (176), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 35/70 (50%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGMG A+ V NIF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGIACLGMGGAAIGVGNIFGNYLAGALRNPSAADGQFARLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLFV 90 LLV ++LLFV Sbjct: 65 LLVALILLFV 74 >gi|182677735|ref|YP_001831881.1| H+transporting two-sector ATPase C subunit [Beijerinckia indica subsp. indica ATCC 9039] gi|182633618|gb|ACB94392.1| H+transporting two-sector ATPase C subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 76 Score = 68.6 bits (166), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 36/73 (49%), Positives = 47/73 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 LAAKY+ G +GMG A+ V+ IF ++LSGA RNP A+ A I A +AE LG+ Sbjct: 3 PLAAKYLGAGFTVIGMGAAAIGVAIIFASFLSGALRNPTASDAQFGRAFIGAALAEGLGI 62 Query: 79 FLLLVVMLLLFVI 91 F LV +LLLFV+ Sbjct: 63 FSFLVAILLLFVM 75 >gi|298294368|ref|YP_003696307.1| H+transporting two-sector ATPase C subunit [Starkeya novella DSM 506] gi|296930879|gb|ADH91688.1| H+transporting two-sector ATPase C subunit [Starkeya novella DSM 506] Length = 75 Score = 67.0 bits (162), Expect = 8e-10, Method: Compositional matrix adjust. Identities = 31/60 (51%), Positives = 39/60 (65%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAK++ G+ACLGMGL A+ V NIF +LSGA RNP AA I A +AE LG+ Sbjct: 3 PIAAKFLGAGLACLGMGLAAIGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGLGI 62 >gi|154245921|ref|YP_001416879.1| H+transporting two-sector ATPase C subunit [Xanthobacter autotrophicus Py2] gi|154160006|gb|ABS67222.1| H+transporting two-sector ATPase C subunit [Xanthobacter autotrophicus Py2] Length = 75 Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 30/58 (51%), Positives = 37/58 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 A K++ G+ACLGMGL A+ V NIF +LSGA RNP AA I A +AE LG+ Sbjct: 5 AGKFIGAGLACLGMGLAAVGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGLGI 62 >gi|240850060|ref|YP_002971453.1| ATP synthase subunit C [Bartonella grahamii as4aup] gi|240267183|gb|ACS50771.1| ATP synthase subunit C [Bartonella grahamii as4aup] Length = 76 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 29/60 (48%), Positives = 39/60 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 64 >gi|49473960|ref|YP_032002.1| F0F1 ATP synthase subunit C [Bartonella quintana str. Toulouse] gi|49475210|ref|YP_033251.1| F0F1 ATP synthase subunit C [Bartonella henselae str. Houston-1] gi|49238015|emb|CAF27221.1| ATP synthase subunit C [Bartonella henselae str. Houston-1] gi|49239463|emb|CAF25814.1| ATP synthase subunit C [Bartonella quintana str. Toulouse] Length = 76 Score = 62.0 bits (149), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 29/60 (48%), Positives = 39/60 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 64 >gi|163867852|ref|YP_001609056.1| F0F1 ATP synthase subunit C [Bartonella tribocorum CIP 105476] gi|161017503|emb|CAK01061.1| ATP synthase, subunit C [Bartonella tribocorum CIP 105476] Length = 76 Score = 62.0 bits (149), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 29/60 (48%), Positives = 39/60 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 64 >gi|114798825|ref|YP_760621.1| ATP synthase F0 subunit C [Hyphomonas neptunium ATCC 15444] gi|122942379|sp|Q0C0X2|ATPL_HYPNA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|114738999|gb|ABI77124.1| ATP synthase F0, C subunit [Hyphomonas neptunium ATCC 15444] Length = 78 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 32/68 (47%), Positives = 43/68 (63%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KYV G+A LGM AL V NIF ++L A RNP AA + I +AE+LG+F +L Sbjct: 10 KYVGAGLATLGMIGSALGVGNIFASFLDAAMRNPSAAPQQTGNLFIGMALAEALGIFSVL 69 Query: 83 VVMLLLFV 90 + +L+LFV Sbjct: 70 IAILILFV 77 >gi|260574857|ref|ZP_05842859.1| H+transporting two-sector ATPase C subunit [Rhodobacter sp. SW2] gi|259022862|gb|EEW26156.1| H+transporting two-sector ATPase C subunit [Rhodobacter sp. SW2] Length = 78 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 40/68 (58%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC GMG A+ V N+ +LSGA RNP AA + I AE+ G+F LV Sbjct: 11 YIGAGLACTGMGGAAIGVGNVAGNFLSGALRNPSAAPGQTAMLFIGIAFAEAFGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|188582610|ref|YP_001926055.1| ATP synthase F0 subunit C [Methylobacterium populi BJ001] gi|179346108|gb|ACB81520.1| ATP synthase F0, C subunit [Methylobacterium populi BJ001] Length = 75 Score = 61.2 bits (147), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 26/60 (43%), Positives = 41/60 (68%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAKY+ G+ACLGM ++ + N+F + SGA RNP AA + +T +L+ + E+LG+F Sbjct: 4 VAAKYIGAGLACLGMAGASIGLGNLFGQFYSGALRNPSAADSQRTNLLLGFALTEALGIF 63 >gi|116250700|ref|YP_766538.1| F0F1 ATP synthase subunit C [Rhizobium leguminosarum bv. viciae 3841] gi|241203302|ref|YP_002974398.1| F0F1 ATP synthase subunit C [Rhizobium leguminosarum bv. trifolii WSM1325] gi|115255348|emb|CAK06423.1| ATP synthase subunit c [Rhizobium leguminosarum bv. viciae 3841] gi|240857192|gb|ACS54859.1| H+transporting two-sector ATPase C subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 75 Score = 60.5 bits (145), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 63 >gi|329888299|ref|ZP_08266897.1| ATP synthase C chain [Brevundimonas diminuta ATCC 11568] gi|328846855|gb|EGF96417.1| ATP synthase C chain [Brevundimonas diminuta ATCC 11568] Length = 74 Score = 60.5 bits (145), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM ALAV NIF +L+GA RNP AA++ + + A +AE+LG+ Sbjct: 5 AAKYIGAGLATLGMIGSALAVGNIFGNFLAGALRNPAAAASQVGNLFVGAALAEALGILA 64 Query: 81 LLVVMLLLFV 90 ++ +L+ F+ Sbjct: 65 FVLGILMFFL 74 >gi|163744749|ref|ZP_02152109.1| F0F1 ATP synthase subunit C [Oceanibulbus indolifex HEL-45] gi|161381567|gb|EDQ05976.1| F0F1 ATP synthase subunit C [Oceanibulbus indolifex HEL-45] Length = 74 Score = 60.5 bits (145), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A LG G+ AL V N+ +LSGA RNP AA++ + I AE+LG+F LV Sbjct: 7 HIGAGIAGLGTGIAALGVGNVAANFLSGALRNPSAAASQTATLFIGIAFAEALGIFSFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 ALLLMFAV 74 >gi|227821027|ref|YP_002824997.1| F0F1 ATP synthase subunit C [Sinorhizobium fredii NGR234] gi|227340026|gb|ACP24244.1| ATP synthase, subunit C [Sinorhizobium fredii NGR234] Length = 75 Score = 60.5 bits (145), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G+ACLGM AL + NIF +YLSGA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADGQFGRLVFGFAVTEALGIF 63 >gi|254293425|ref|YP_003059448.1| H+transporting two-sector ATPase C subunit [Hirschia baltica ATCC 49814] gi|254041956|gb|ACT58751.1| H+transporting two-sector ATPase C subunit [Hirschia baltica ATCC 49814] Length = 74 Score = 60.5 bits (145), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 30/69 (43%), Positives = 41/69 (59%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KYV G+AC M AL V NIF++YL A RNP AA ++ + E+LG+F L Sbjct: 6 KYVGAGLACFAMFGAALGVGNIFSSYLDAAMRNPSAAQGQFGNLIFGFAVTEALGIFGFL 65 Query: 83 VVMLLLFVI 91 + +LLLF + Sbjct: 66 IAILLLFAV 74 >gi|99082433|ref|YP_614587.1| F0F1 ATP synthase subunit C [Ruegeria sp. TM1040] gi|259417991|ref|ZP_05741910.1| conserved domain protein [Silicibacter sp. TrichCH4B] gi|123252123|sp|Q1GDE1|ATPL_SILST RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|99038713|gb|ABF65325.1| H+-transporting two-sector ATPase C subunit [Ruegeria sp. TM1040] gi|259346897|gb|EEW58711.1| conserved domain protein [Silicibacter sp. TrichCH4B] Length = 74 Score = 60.5 bits (145), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 28/68 (41%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+A +G G+ AL V N+ +L+GA RNP AA++ + I AE+LG+F LV Sbjct: 7 YIGAGLAGMGTGIAALGVGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALGIFSFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 ALLLMFAV 74 >gi|332188694|ref|ZP_08390408.1| ATP synthase subunit C family protein [Sphingomonas sp. S17] gi|332011258|gb|EGI53349.1| ATP synthase subunit C family protein [Sphingomonas sp. S17] Length = 75 Score = 60.1 bits (144), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 29/70 (41%), Positives = 44/70 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +GMG+ +L V N+F +L GA RNP AA + + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGMGIASLGVGNVFAKFLEGALRNPGAADSQQGRLFIGFAGAELLGLLA 64 Query: 81 LLVVMLLLFV 90 + +++L+FV Sbjct: 65 FVTMIILVFV 74 >gi|254419283|ref|ZP_05033007.1| ATP synthase subunit C, putative [Brevundimonas sp. BAL3] gi|196185460|gb|EDX80436.1| ATP synthase subunit C, putative [Brevundimonas sp. BAL3] Length = 74 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 30/69 (43%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM AL V NIF +L+GA RNP AA+ + + A +AE+LG+ Sbjct: 5 AAKYIGAGLATLGMIGSALGVGNIFGQFLAGALRNPSAAAGQVGNLFVGAALAEALGILA 64 Query: 81 LLVVMLLLF 89 ++ +L++F Sbjct: 65 FVLGILMIF 73 >gi|163852589|ref|YP_001640632.1| H+transporting two-sector ATPase C subunit [Methylobacterium extorquens PA1] gi|218531430|ref|YP_002422246.1| H+transporting two-sector ATPase C subunit [Methylobacterium chloromethanicum CM4] gi|240139924|ref|YP_002964401.1| F0 sector of membrane-bound ATP synthase, subunit c [Methylobacterium extorquens AM1] gi|254562348|ref|YP_003069443.1| ATP synthase F0 sector subunit c [Methylobacterium extorquens DM4] gi|163664194|gb|ABY31561.1| H+transporting two-sector ATPase C subunit [Methylobacterium extorquens PA1] gi|218523733|gb|ACK84318.1| H+transporting two-sector ATPase C subunit [Methylobacterium chloromethanicum CM4] gi|240009898|gb|ACS41124.1| F0 sector of membrane-bound ATP synthase, subunit c [Methylobacterium extorquens AM1] gi|254269626|emb|CAX25597.1| ATP synthase F0 sector subunit c [Methylobacterium extorquens DM4] Length = 75 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 41/60 (68%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAKY+ G+ACLGM ++ + N+F + +GA RNP AA + +T +L+ + E+LG+F Sbjct: 4 VAAKYIGAGLACLGMAGASIGLGNLFGQFYAGALRNPSAADSQRTNLLLGFALTEALGIF 63 >gi|260460368|ref|ZP_05808620.1| H+transporting two-sector ATPase C subunit [Mesorhizobium opportunistum WSM2075] gi|259034013|gb|EEW35272.1| H+transporting two-sector ATPase C subunit [Mesorhizobium opportunistum WSM2075] Length = 74 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF +YLSGA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLF 89 LL+ +L LF Sbjct: 65 LLIALLALF 73 >gi|83855053|ref|ZP_00948583.1| ATP synthase subunit C [Sulfitobacter sp. NAS-14.1] gi|83941576|ref|ZP_00954038.1| ATP synthase subunit C [Sulfitobacter sp. EE-36] gi|83842896|gb|EAP82063.1| ATP synthase subunit C [Sulfitobacter sp. NAS-14.1] gi|83847396|gb|EAP85271.1| ATP synthase subunit C [Sulfitobacter sp. EE-36] Length = 78 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/70 (38%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+ GMG A+ V N+ YL+GA RNP AA+ + I AE+LG+F Sbjct: 9 GQFIGAGLTAFGMGGAAIGVGNVAGNYLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|319408193|emb|CBI81846.1| ATP synthase, subunit C [Bartonella schoenbuchensis R1] Length = 76 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 4 ALAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 62 >gi|319899219|ref|YP_004159312.1| ATP synthase, subunit C [Bartonella clarridgeiae 73] gi|319403183|emb|CBI76742.1| ATP synthase, subunit C [Bartonella clarridgeiae 73] gi|319404577|emb|CBI78183.1| ATP synthase, subunit C [Bartonella rochalimae ATCC BAA-1498] gi|319406084|emb|CBI79714.1| ATP synthase, subunit C [Bartonella sp. AR 15-3] gi|319407568|emb|CBI81218.1| ATP synthase, subunit C [Bartonella sp. 1-1C] Length = 76 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/58 (48%), Positives = 37/58 (63%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 62 >gi|15888059|ref|NP_353740.1| F0F1 ATP synthase subunit C [Agrobacterium tumefaciens str. C58] gi|325292101|ref|YP_004277965.1| ATP synthase subunit C [Agrobacterium sp. H13-3] gi|15155683|gb|AAK86525.1| ATP synthase epsilon chain [Agrobacterium tumefaciens str. C58] gi|325059954|gb|ADY63645.1| ATP synthase subunit C [Agrobacterium sp. H13-3] Length = 75 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAKY+ G+ACLGM +LA+ IF YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKYIGAGLACLGMAGTSLALGRIFGDYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 63 >gi|300024393|ref|YP_003757004.1| ATP synthase F0 C subunit [Hyphomicrobium denitrificans ATCC 51888] gi|299526214|gb|ADJ24683.1| ATP synthase F0, C subunit [Hyphomicrobium denitrificans ATCC 51888] Length = 74 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 30/69 (43%), Positives = 43/69 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+AC + + + NIF YLSGA RNP AA T +LI +AE+ GLF Sbjct: 5 AAKMIGAGLACSALIGAGVGIGNIFGNYLSGAMRNPSAAPGQFTNLLIGFALAEATGLFG 64 Query: 81 LLVVMLLLF 89 LL+ +++L+ Sbjct: 65 LLIALIILY 73 >gi|118590786|ref|ZP_01548187.1| F0F1 ATP synthase subunit C [Stappia aggregata IAM 12614] gi|118436762|gb|EAV43402.1| F0F1 ATP synthase subunit C [Stappia aggregata IAM 12614] Length = 74 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 33/69 (47%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGNYLAGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLF 89 LLV ++LLF Sbjct: 65 LLVALILLF 73 >gi|86356511|ref|YP_468403.1| F0F1 ATP synthase subunit C [Rhizobium etli CFN 42] gi|190890576|ref|YP_001977118.1| ATP synthase, subunit C [Rhizobium etli CIAT 652] gi|209548119|ref|YP_002280036.1| F0F1 ATP synthase subunit C [Rhizobium leguminosarum bv. trifolii WSM2304] gi|222147702|ref|YP_002548659.1| F0F1 ATP synthase subunit C [Agrobacterium vitis S4] gi|86280613|gb|ABC89676.1| ATP synthase protein, subunit C [Rhizobium etli CFN 42] gi|190695855|gb|ACE89940.1| ATP synthase protein, subunit C [Rhizobium etli CIAT 652] gi|209533875|gb|ACI53810.1| H+transporting two-sector ATPase C subunit [Rhizobium leguminosarum bv. trifolii WSM2304] gi|221734690|gb|ACM35653.1| ATP synthase C chain [Agrobacterium vitis S4] gi|327190879|gb|EGE57938.1| F0F1 ATP synthase subunit C [Rhizobium etli CNPAF512] Length = 75 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/59 (45%), Positives = 38/59 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 63 >gi|15964589|ref|NP_384942.1| F0F1 ATP synthase subunit C [Sinorhizobium meliloti 1021] gi|150395673|ref|YP_001326140.1| F0F1 ATP synthase subunit C [Sinorhizobium medicae WSM419] gi|307309335|ref|ZP_07588998.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti BL225C] gi|307320071|ref|ZP_07599492.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti AK83] gi|15073767|emb|CAC45408.1| Probable ATP synthase subunit C transmembrane protein [Sinorhizobium meliloti 1021] gi|150027188|gb|ABR59305.1| H+transporting two-sector ATPase C subunit [Sinorhizobium medicae WSM419] gi|306894286|gb|EFN25051.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti AK83] gi|306900204|gb|EFN30822.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti BL225C] Length = 75 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+ACLGM AL + NIF +YLSGA RNP AA ++ + E+LG Sbjct: 5 AAKYIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADGQFGRLVFGFAVTEALG 61 >gi|296283434|ref|ZP_06861432.1| F0F1-type ATP synthase subunit c [Citromicrobium bathyomarinum JL354] Length = 75 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 30/70 (42%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G GL AL V N+F ++L GA RNP AA + + I AE LGL Sbjct: 5 AAKLLGAGLAAIGCGLAALGVGNVFASFLDGALRNPGAADGQQGRLFIGFAGAELLGLLA 64 Query: 81 LLVVMLLLFV 90 ++ ++L FV Sbjct: 65 FVIAIILTFV 74 >gi|170744958|ref|YP_001773613.1| H+transporting two-sector ATPase C subunit [Methylobacterium sp. 4-46] gi|220927389|ref|YP_002502691.1| H+transporting two-sector ATPase subunit C [Methylobacterium nodulans ORS 2060] gi|168199232|gb|ACA21179.1| H+transporting two-sector ATPase C subunit [Methylobacterium sp. 4-46] gi|219951996|gb|ACL62388.1| H+transporting two-sector ATPase C subunit [Methylobacterium nodulans ORS 2060] Length = 75 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/61 (40%), Positives = 40/61 (65%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+ACLGM A+ + N+F + +GA RNP AA + + +L+ + E+LG+ Sbjct: 3 PVAAKYIGAGLACLGMAGAAVGLGNLFGQFFAGALRNPSAADSQRANLLLGFALTEALGI 62 Query: 79 F 79 F Sbjct: 63 F 63 >gi|218512640|ref|ZP_03509480.1| F0F1 ATP synthase subunit C [Rhizobium etli 8C-3] Length = 138 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/59 (45%), Positives = 38/59 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 68 AAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 126 >gi|121602464|ref|YP_988696.1| F0F1 ATP synthase subunit C [Bartonella bacilliformis KC583] gi|120614641|gb|ABM45242.1| ATP synthase F0, C subunit [Bartonella bacilliformis KC583] Length = 76 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 4 ALAAKYLGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 62 >gi|218662074|ref|ZP_03518004.1| F0F1 ATP synthase subunit C [Rhizobium etli IE4771] gi|218670342|ref|ZP_03520013.1| F0F1 ATP synthase subunit C [Rhizobium etli GR56] Length = 75 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 27/59 (45%), Positives = 37/59 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G+AC GM AL + NIF YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKFIGAGLACFGMAGTALGLGNIFGNYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 63 >gi|163738204|ref|ZP_02145620.1| H+-transporting two-sector ATPase, C subunit [Phaeobacter gallaeciensis BS107] gi|163743798|ref|ZP_02151171.1| F0F1 ATP synthase subunit C [Phaeobacter gallaeciensis 2.10] gi|254477158|ref|ZP_05090544.1| ATP synthase subunit C, putative [Ruegeria sp. R11] gi|161382947|gb|EDQ07343.1| F0F1 ATP synthase subunit C [Phaeobacter gallaeciensis 2.10] gi|161388820|gb|EDQ13173.1| H+-transporting two-sector ATPase, C subunit [Phaeobacter gallaeciensis BS107] gi|214031401|gb|EEB72236.1| ATP synthase subunit C, putative [Ruegeria sp. R11] Length = 74 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 27/68 (39%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A +G G+ AL V N+ +L+GA RNP AA++ + I AE+LG+F LV Sbjct: 7 HIGAGLAGMGTGIAALGVGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALGIFSFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 ALLLMFAV 74 >gi|328544977|ref|YP_004305086.1| H+transporting two-sector ATPase C subunit [polymorphum gilvum SL003B-26A1] gi|326414719|gb|ADZ71782.1| H+transporting two-sector ATPase C subunit [Polymorphum gilvum SL003B-26A1] Length = 74 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 28/57 (49%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+ACLGMG A+A+ IF YLSGA RNP AA ++ + E+LG Sbjct: 5 AAKYIGAGIACLGMGGAAIALGTIFGNYLSGALRNPSAADGQFGRLVFGFAVTEALG 61 >gi|319784764|ref|YP_004144240.1| H+transporting two-sector ATPase C subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317170652|gb|ADV14190.1| H+transporting two-sector ATPase C subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 74 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 32/69 (46%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF +YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGSYLAGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLF 89 LL+ +L LF Sbjct: 65 LLIALLALF 73 >gi|84515976|ref|ZP_01003337.1| ATP synthase subunit C [Loktanella vestfoldensis SKA53] gi|84510418|gb|EAQ06874.1| ATP synthase subunit C [Loktanella vestfoldensis SKA53] Length = 74 Score = 57.8 bits (138), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 27/68 (39%), Positives = 41/68 (60%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A +G G A+ V N+ YL+GA RNP AA+ + I AE+LG+F LV Sbjct: 7 HIGAGLAAIGSGFAAIGVGNVAGNYLAGALRNPSAAAGQTATLFIGLAFAEALGIFAFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 SLLLMFAV 74 >gi|330813671|ref|YP_004357910.1| ATP synthase C chain [Candidatus Pelagibacter sp. IMCC9063] gi|327486766|gb|AEA81171.1| ATP synthase C chain [Candidatus Pelagibacter sp. IMCC9063] Length = 75 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 29/69 (42%), Positives = 43/69 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+AC+ + L + NIF +YLS A RNP AA +L+ +AE+ GLF Sbjct: 5 AAKMIGAGIACIALAGAGLGIGNIFGSYLSAAMRNPSAAQKQFPNLLLGFALAEATGLFG 64 Query: 81 LLVVMLLLF 89 L+V +++LF Sbjct: 65 LVVALIILF 73 >gi|239831259|ref|ZP_04679588.1| ATP synthase C chain [Ochrobactrum intermedium LMG 3301] gi|239823526|gb|EEQ95094.1| ATP synthase C chain [Ochrobactrum intermedium LMG 3301] Length = 75 Score = 57.0 bits (136), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 35/57 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+AC GM AL + NIF YLSGA RNP AA + ++ + E+LG Sbjct: 5 AAKYIGAGLACFGMAGTALGLGNIFGNYLSGALRNPSAADSQFGRLVFGFAVTEALG 61 >gi|17987828|ref|NP_540462.1| F0F1 ATP synthase subunit C [Brucella melitensis bv. 1 str. 16M] gi|23501287|ref|NP_697414.1| F0F1 ATP synthase subunit C [Brucella suis 1330] gi|62289373|ref|YP_221166.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 1 str. 9-941] gi|82699298|ref|YP_413872.1| F0F1 ATP synthase subunit C [Brucella melitensis biovar Abortus 2308] gi|148559676|ref|YP_001258410.1| F0F1 ATP synthase subunit C [Brucella ovis ATCC 25840] gi|153007846|ref|YP_001369061.1| F0F1 ATP synthase subunit C [Ochrobactrum anthropi ATCC 49188] gi|161618359|ref|YP_001592246.1| F0F1 ATP synthase subunit C [Brucella canis ATCC 23365] gi|163842667|ref|YP_001627071.1| F0F1 ATP synthase subunit C [Brucella suis ATCC 23445] gi|189023626|ref|YP_001934394.1| F0F1 ATP synthase subunit C [Brucella abortus S19] gi|225626898|ref|ZP_03784937.1| ATP synthase C chain [Brucella ceti str. Cudo] gi|225851923|ref|YP_002732156.1| F0F1 ATP synthase subunit C [Brucella melitensis ATCC 23457] gi|237814860|ref|ZP_04593858.1| ATP synthase C chain [Brucella abortus str. 2308 A] gi|254688688|ref|ZP_05151942.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 6 str. 870] gi|254693171|ref|ZP_05154999.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 3 str. Tulya] gi|254696815|ref|ZP_05158643.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 2 str. 86/8/59] gi|254701195|ref|ZP_05163023.1| F0F1 ATP synthase subunit C [Brucella suis bv. 5 str. 513] gi|254703740|ref|ZP_05165568.1| F0F1 ATP synthase subunit C [Brucella suis bv. 3 str. 686] gi|254707880|ref|ZP_05169708.1| F0F1 ATP synthase subunit C [Brucella pinnipedialis M163/99/10] gi|254709536|ref|ZP_05171347.1| F0F1 ATP synthase subunit C [Brucella pinnipedialis B2/94] gi|254713047|ref|ZP_05174858.1| F0F1 ATP synthase subunit C [Brucella ceti M644/93/1] gi|254716600|ref|ZP_05178411.1| F0F1 ATP synthase subunit C [Brucella ceti M13/05/1] gi|254718567|ref|ZP_05180378.1| F0F1 ATP synthase subunit C [Brucella sp. 83/13] gi|254729722|ref|ZP_05188300.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 4 str. 292] gi|256031030|ref|ZP_05444644.1| F0F1 ATP synthase subunit C [Brucella pinnipedialis M292/94/1] gi|256044105|ref|ZP_05447016.1| F0F1 ATP synthase subunit C [Brucella melitensis bv. 1 str. Rev.1] gi|256060522|ref|ZP_05450691.1| F0F1 ATP synthase subunit C [Brucella neotomae 5K33] gi|256112903|ref|ZP_05453819.1| F0F1 ATP synthase subunit C [Brucella melitensis bv. 3 str. Ether] gi|256159088|ref|ZP_05456914.1| F0F1 ATP synthase subunit C [Brucella ceti M490/95/1] gi|256254433|ref|ZP_05459969.1| F0F1 ATP synthase subunit C [Brucella ceti B1/94] gi|256256935|ref|ZP_05462471.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 9 str. C68] gi|256264565|ref|ZP_05467097.1| ATP synthase subunit C [Brucella melitensis bv. 2 str. 63/9] gi|256368839|ref|YP_003106345.1| ATP synthase subunit C [Brucella microti CCM 4915] gi|260168162|ref|ZP_05754973.1| F0F1 ATP synthase subunit C [Brucella sp. F5/99] gi|260545874|ref|ZP_05821615.1| H+transporting two-sector ATPase C subunit [Brucella abortus NCTC 8038] gi|260563464|ref|ZP_05833950.1| ATP synthase subunit C [Brucella melitensis bv. 1 str. 16M] gi|260567005|ref|ZP_05837475.1| ATP synthase subunit C [Brucella suis bv. 4 str. 40] gi|260754164|ref|ZP_05866512.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 6 str. 870] gi|260757384|ref|ZP_05869732.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 4 str. 292] gi|260761208|ref|ZP_05873551.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 2 str. 86/8/59] gi|260883189|ref|ZP_05894803.1| H+transporting two-sector ATPase C subunit [Brucella abortus bv. 9 str. C68] gi|261213411|ref|ZP_05927692.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 3 str. Tulya] gi|261218399|ref|ZP_05932680.1| H+transporting two-sector ATPase C subunit [Brucella ceti M13/05/1] gi|261221601|ref|ZP_05935882.1| H+transporting two-sector ATPase C subunit [Brucella ceti B1/94] gi|261315371|ref|ZP_05954568.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M163/99/10] gi|261317062|ref|ZP_05956259.1| H+ transporting two-sector ATPase C subunit [Brucella pinnipedialis B2/94] gi|261320752|ref|ZP_05959949.1| H+transporting two-sector ATPase C subunit [Brucella ceti M644/93/1] gi|261324516|ref|ZP_05963713.1| H+transporting two-sector ATPase C subunit [Brucella neotomae 5K33] gi|261751732|ref|ZP_05995441.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 5 str. 513] gi|261754385|ref|ZP_05998094.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 3 str. 686] gi|261757620|ref|ZP_06001329.1| ATP synthase subunit C [Brucella sp. F5/99] gi|265983542|ref|ZP_06096277.1| H+transporting two-sector ATPase C subunit [Brucella sp. 83/13] gi|265988100|ref|ZP_06100657.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M292/94/1] gi|265990517|ref|ZP_06103074.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 1 str. Rev.1] gi|265994345|ref|ZP_06106902.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 3 str. Ether] gi|265997565|ref|ZP_06110122.1| H+transporting two-sector ATPase C subunit [Brucella ceti M490/95/1] gi|294851766|ref|ZP_06792439.1| F0F1 ATP synthase subunit C [Brucella sp. NVSL 07-0026] gi|297247786|ref|ZP_06931504.1| F-type H+-transporting ATPase subunit C [Brucella abortus bv. 5 str. B3196] gi|306837304|ref|ZP_07470187.1| F0F1 ATP synthase subunit C [Brucella sp. NF 2653] gi|306842326|ref|ZP_07474985.1| F0F1 ATP synthase subunit C [Brucella sp. BO2] gi|306845017|ref|ZP_07477598.1| F0F1 ATP synthase subunit C [Brucella sp. BO1] gi|2984781|gb|AAC08029.1| ATP synthase subunit C [Brucella melitensis] gi|17983556|gb|AAL52726.1| ATP synthase c chain [Brucella melitensis bv. 1 str. 16M] gi|23347175|gb|AAN29329.1| ATP synthase F0, C subunit [Brucella suis 1330] gi|62195505|gb|AAX73805.1| AtpE, ATP synthase F0, C subunit [Brucella abortus bv. 1 str. 9-941] gi|82615399|emb|CAJ10368.1| Eubacterial/plasma membrane H+-transporting two-sector ATPase, C subunit:H+-transporting two-sector ATPase, C subunit [Brucella melitensis biovar Abortus 2308] gi|148370933|gb|ABQ60912.1| ATP synthase F0, C subunit [Brucella ovis ATCC 25840] gi|151559734|gb|ABS13232.1| H+transporting two-sector ATPase C subunit [Ochrobactrum anthropi ATCC 49188] gi|161335170|gb|ABX61475.1| ATP synthase C chain [Brucella canis ATCC 23365] gi|163673390|gb|ABY37501.1| ATP synthase C chain [Brucella suis ATCC 23445] gi|189019198|gb|ACD71920.1| ATP synthase subunit C [Brucella abortus S19] gi|225618555|gb|EEH15598.1| ATP synthase C chain [Brucella ceti str. Cudo] gi|225640288|gb|ACO00202.1| ATP synthase C chain [Brucella melitensis ATCC 23457] gi|237789697|gb|EEP63907.1| ATP synthase C chain [Brucella abortus str. 2308 A] gi|255998997|gb|ACU47396.1| ATP synthase subunit C [Brucella microti CCM 4915] gi|260097281|gb|EEW81156.1| H+transporting two-sector ATPase C subunit [Brucella abortus NCTC 8038] gi|260153480|gb|EEW88572.1| ATP synthase subunit C [Brucella melitensis bv. 1 str. 16M] gi|260156523|gb|EEW91603.1| ATP synthase subunit C [Brucella suis bv. 4 str. 40] gi|260667702|gb|EEX54642.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 4 str. 292] gi|260671640|gb|EEX58461.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 2 str. 86/8/59] gi|260674272|gb|EEX61093.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 6 str. 870] gi|260872717|gb|EEX79786.1| H+transporting two-sector ATPase C subunit [Brucella abortus bv. 9 str. C68] gi|260915018|gb|EEX81879.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 3 str. Tulya] gi|260920185|gb|EEX86838.1| H+transporting two-sector ATPase C subunit [Brucella ceti B1/94] gi|260923488|gb|EEX90056.1| H+transporting two-sector ATPase C subunit [Brucella ceti M13/05/1] gi|261293442|gb|EEX96938.1| H+transporting two-sector ATPase C subunit [Brucella ceti M644/93/1] gi|261296285|gb|EEX99781.1| H+ transporting two-sector ATPase C subunit [Brucella pinnipedialis B2/94] gi|261300496|gb|EEY03993.1| H+transporting two-sector ATPase C subunit [Brucella neotomae 5K33] gi|261304397|gb|EEY07894.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M163/99/10] gi|261737604|gb|EEY25600.1| ATP synthase subunit C [Brucella sp. F5/99] gi|261741485|gb|EEY29411.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 5 str. 513] gi|261744138|gb|EEY32064.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 3 str. 686] gi|262552033|gb|EEZ08023.1| H+transporting two-sector ATPase C subunit [Brucella ceti M490/95/1] gi|262765458|gb|EEZ11247.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 3 str. Ether] gi|263001301|gb|EEZ13876.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 1 str. Rev.1] gi|263094930|gb|EEZ18638.1| ATP synthase subunit C [Brucella melitensis bv. 2 str. 63/9] gi|264660297|gb|EEZ30558.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M292/94/1] gi|264662134|gb|EEZ32395.1| H+transporting two-sector ATPase C subunit [Brucella sp. 83/13] gi|294820355|gb|EFG37354.1| F0F1 ATP synthase subunit C [Brucella sp. NVSL 07-0026] gi|297174955|gb|EFH34302.1| F-type H+-transporting ATPase subunit C [Brucella abortus bv. 5 str. B3196] gi|306274649|gb|EFM56438.1| F0F1 ATP synthase subunit C [Brucella sp. BO1] gi|306287542|gb|EFM59001.1| F0F1 ATP synthase subunit C [Brucella sp. BO2] gi|306407617|gb|EFM63813.1| F0F1 ATP synthase subunit C [Brucella sp. NF 2653] gi|326408422|gb|ADZ65487.1| ATP synthase subunit C [Brucella melitensis M28] gi|326538136|gb|ADZ86351.1| ATP synthase C chain [Brucella melitensis M5-90] Length = 75 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 35/57 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+AC GM AL + NIF YLSGA RNP AA + ++ + E+LG Sbjct: 5 AAKYIGAGLACFGMAGTALGLGNIFGQYLSGALRNPSAADSQFGRLVFGFAVTEALG 61 >gi|254501631|ref|ZP_05113782.1| ATP synthase subunit C, putative [Labrenzia alexandrii DFL-11] gi|307941611|ref|ZP_07656966.1| conserved domain protein [Roseibium sp. TrichSKD4] gi|222437702|gb|EEE44381.1| ATP synthase subunit C, putative [Labrenzia alexandrii DFL-11] gi|307775219|gb|EFO34425.1| conserved domain protein [Roseibium sp. TrichSKD4] Length = 75 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+ACLGMG A+A+ IF YL+GA RNP AA ++ + E+LG Sbjct: 5 AAKYIGAGIACLGMGGAAIALGTIFGNYLNGALRNPTAADGQFGRLVFGFAVTEALG 61 >gi|67458421|ref|YP_246045.1| F0F1 ATP synthase subunit C [Rickettsia felis URRWXCal2] gi|75537107|sp|Q4UNH9|ATPL_RICFE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|67003954|gb|AAY60880.1| ATP synthase C chain [Rickettsia felis URRWXCal2] Length = 74 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 44/67 (65%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ +G+ +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF + Sbjct: 7 KFIGIGLMAIGMYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|239948441|ref|ZP_04700194.1| ATP synthase C chain [Rickettsia endosymbiont of Ixodes scapularis] gi|239922717|gb|EER22741.1| ATP synthase C chain [Rickettsia endosymbiont of Ixodes scapularis] Length = 72 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 44/67 (65%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ +G+ +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF + Sbjct: 5 KFIGIGLMAIGMYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLFSFV 64 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 65 IAMLLIF 71 >gi|170747147|ref|YP_001753407.1| ATP synthase F0, C subunit [Methylobacterium radiotolerans JCM 2831] gi|170653669|gb|ACB22724.1| ATP synthase F0, C subunit [Methylobacterium radiotolerans JCM 2831] Length = 75 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 24/59 (40%), Positives = 37/59 (62%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +AAKY+ G+ACLGM + + N+F +L+GA RNP AA + +L+ + E+LG Sbjct: 3 PVAAKYIGAGLACLGMAGAGIGLGNLFGQFLAGALRNPSAADGQRATLLLGFALTEALG 61 >gi|222085043|ref|YP_002543572.1| ATP synthase protein [Agrobacterium radiobacter K84] gi|221722491|gb|ACM25647.1| ATP synthase protein [Agrobacterium radiobacter K84] Length = 75 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAK++ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 5 AAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 61 >gi|83945332|ref|ZP_00957680.1| ATP synthase subunit C [Oceanicaulis alexandrii HTCC2633] gi|83851166|gb|EAP89023.1| ATP synthase subunit C [Oceanicaulis alexandrii HTCC2633] Length = 75 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 33/71 (46%), Positives = 47/71 (66%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A GM AL V NIF+++L+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGLATFGMLGAALGVGNIFSSFLAGALRNPSAAQGQFGNLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLFVI 91 LL+ +LLLFV+ Sbjct: 65 LLIALLLLFVV 75 >gi|51473317|ref|YP_067074.1| F0F1 ATP synthase subunit C [Rickettsia typhi str. Wilmington] gi|81692323|sp|Q68XQ0|ATPL_RICTY RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|51459629|gb|AAU03592.1| ATP synthase [Rickettsia typhi str. Wilmington] Length = 74 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 43/67 (64%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ +G +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF + Sbjct: 7 KFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAMGLFAFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|15603901|ref|NP_220416.1| F0F1 ATP synthase subunit C [Rickettsia prowazekii str. Madrid E] gi|6225075|sp|Q9ZEC2|ATPL_RICPR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|3860592|emb|CAA14493.1| ATP SYNTHASE C CHAIN (atpE) [Rickettsia prowazekii] gi|292571617|gb|ADE29532.1| ATP synthase C chain [Rickettsia prowazekii Rp22] Length = 74 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 43/67 (64%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ +G +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF + Sbjct: 7 KFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAMGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|197104051|ref|YP_002129428.1| AtpE, ATP synthase F0, C subunit [Phenylobacterium zucineum HLK1] gi|196477471|gb|ACG76999.1| AtpE, ATP synthase F0, C subunit [Phenylobacterium zucineum HLK1] Length = 74 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/69 (39%), Positives = 43/69 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM + V +F+ +L GA RNP AA T +++ A + E+LG+ Sbjct: 5 AAKYIGAGLATLGMIGAGIGVGTLFSGFLQGATRNPSAAGGQFTNLILGAALTEALGILA 64 Query: 81 LLVVMLLLF 89 ++ +L+LF Sbjct: 65 FVLGLLILF 73 >gi|157803208|ref|YP_001491757.1| F0F1 ATP synthase subunit C [Rickettsia canadensis str. McKiel] gi|254810029|sp|A8EX89|ATPL_RICCK RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|157784471|gb|ABV72972.1| F0F1 ATP synthase subunit C [Rickettsia canadensis str. McKiel] Length = 74 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 30/67 (44%), Positives = 44/67 (65%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ VG+ +GM AL VSNIF++ L+ RNP AA + LI A +AE++GLF + Sbjct: 7 KFIGVGLMAIGMYGAALGVSNIFSSLLNAIARNPAAAENLQRMALIGAGLAEAIGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|89069740|ref|ZP_01157076.1| ATP synthase subunit C [Oceanicola granulosus HTCC2516] gi|89044686|gb|EAR50797.1| ATP synthase subunit C [Oceanicola granulosus HTCC2516] Length = 78 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/70 (35%), Positives = 43/70 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA++ + I AE+LG+F Sbjct: 9 GQFIGAGLAGIGSGAAAIGVGHVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|84684304|ref|ZP_01012206.1| FoF1 ATP synthase, subunit C [Maritimibacter alkaliphilus HTCC2654] gi|84668057|gb|EAQ14525.1| FoF1 ATP synthase, subunit C [Rhodobacterales bacterium HTCC2654] Length = 78 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/70 (35%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA + I AE+LG+F Sbjct: 9 GQFIGAGLAGIGSGAAAIGVGHVAGNFLAGALRNPSAAGGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|157825172|ref|YP_001492892.1| F0F1 ATP synthase subunit C [Rickettsia akari str. Hartford] gi|254810027|sp|A8GLV9|ATPL_RICAH RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|157799130|gb|ABV74384.1| F0F1 ATP synthase subunit C [Rickettsia akari str. Hartford] Length = 74 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 44/67 (65%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ +G+ +G+ AL VSNIF++ LS RNP AA + LI A +AE++GLF + Sbjct: 7 KFIGIGLMAIGIYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|85706761|ref|ZP_01037853.1| ATP synthase subunit C [Roseovarius sp. 217] gi|85668819|gb|EAQ23688.1| ATP synthase subunit C [Roseovarius sp. 217] Length = 78 Score = 54.7 bits (130), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA+ + I AE+LG+F Sbjct: 9 GQFIGAGLAGIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 L+ +LL+F + Sbjct: 69 LIALLLMFAV 78 >gi|310814621|ref|YP_003962585.1| ATP synthase subunit C [Ketogulonicigenium vulgare Y25] gi|308753356|gb|ADO41285.1| ATP synthase subunit C [Ketogulonicigenium vulgare Y25] Length = 76 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 34/58 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +Y+ G+AC+GM A+ V N+ YL+GA RNP AA + I AE+LG+F Sbjct: 7 GQYIGAGLACIGMAGAAIGVGNVAGNYLAGALRNPSAAGGQTAMLFIGMAFAEALGIF 64 >gi|119385603|ref|YP_916658.1| F0F1 ATP synthase subunit C [Paracoccus denitrificans PD1222] gi|119376198|gb|ABL70962.1| ATP synthase F0 subcomplex C subunit [Paracoccus denitrificans PD1222] Length = 77 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 36/58 (62%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +Y+ G+AC+GM A+ V N+ YL+GA RNP AA++ + I AE+LG+F Sbjct: 8 GQYLGAGLACVGMAGAAMGVGNVAGNYLAGALRNPSAAASQTATLFIGMAFAEALGIF 65 >gi|161723852|ref|NP_359663.2| F0F1 ATP synthase subunit C [Rickettsia conorii str. Malish 7] gi|238650339|ref|YP_002916191.1| F0F1 ATP synthase subunit C [Rickettsia peacockii str. Rustic] gi|20454820|sp|Q92JP1|ATPL_RICCN RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|259585527|sp|C4K0P2|ATPL_RICPU RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|238624437|gb|ACR47143.1| F0F1 ATP synthase subunit C [Rickettsia peacockii str. Rustic] Length = 74 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 42/67 (62%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ G+ +GM AL VSNIF++ LS RNP A + LI A +AE++GLF + Sbjct: 7 KFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|165932584|ref|YP_001649373.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. Iowa] gi|15619060|gb|AAL02564.1| ATP synthase C chain [Rickettsia conorii str. Malish 7] gi|165907671|gb|ABY71967.1| ATP synthase C chain [Rickettsia rickettsii str. Iowa] Length = 78 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 42/67 (62%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ G+ +GM AL VSNIF++ LS RNP A + LI A +AE++GLF + Sbjct: 11 KFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFV 70 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 71 IAMLLIF 77 >gi|157827896|ref|YP_001494138.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. 'Sheila Smith'] gi|157800377|gb|ABV75630.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. 'Sheila Smith'] Length = 72 Score = 53.9 bits (128), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 42/67 (62%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ G+ +GM AL VSNIF++ LS RNP A + LI A +AE++GLF + Sbjct: 5 KFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFV 64 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 65 IAMLLIF 71 >gi|329850280|ref|ZP_08265125.1| ATP synthase F0, C subunit [Asticcacaulis biprosthecum C19] gi|328840595|gb|EGF90166.1| ATP synthase F0, C subunit [Asticcacaulis biprosthecum C19] Length = 85 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 25/72 (34%), Positives = 42/72 (58%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +++ KY+ G+A LGM + + +F Y GA RNP AA +T + I + E+LG Sbjct: 9 FAVGLKYIGAGLATLGMIGAGIGLGILFGNYYVGALRNPSAAKTQQTNLFIGMALTEALG 68 Query: 78 LFLLLVVMLLLF 89 +F ++ +L+LF Sbjct: 69 IFAFVIALLILF 80 >gi|157964087|ref|YP_001498911.1| F0F1 ATP synthase subunit C [Rickettsia massiliae MTU5] gi|157843863|gb|ABV84364.1| ATP synthase C chain [Rickettsia massiliae MTU5] Length = 78 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 41/67 (61%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ G +GM AL VSNIF++ LS RNP A + LI A +AE++GLF + Sbjct: 11 KFIGTGFMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLFSFV 70 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 71 IAMLLIF 77 >gi|167648333|ref|YP_001685996.1| H+transporting two-sector ATPase subunit C [Caulobacter sp. K31] gi|167350763|gb|ABZ73498.1| H+transporting two-sector ATPase C subunit [Caulobacter sp. K31] Length = 74 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/67 (38%), Positives = 43/67 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A LGM + V NIF ++L+GA RNP AA++ + + A +AE+LG+ Sbjct: 5 AAKLIGAGLATLGMIGAGIGVGNIFGSFLTGALRNPSAAASQIGNLFVGAALAEALGILA 64 Query: 81 LLVVMLL 87 ++ +L+ Sbjct: 65 FVLGILI 71 >gi|16124622|ref|NP_419186.1| F0F1 ATP synthase subunit C [Caulobacter crescentus CB15] gi|221233311|ref|YP_002515747.1| F0F1 ATP synthase subunit C [Caulobacter crescentus NA1000] gi|295687787|ref|YP_003591480.1| H+transporting two-sector ATPase C subunit [Caulobacter segnis ATCC 21756] gi|13421522|gb|AAK22354.1| ATP synthase F0, C subunit [Caulobacter crescentus CB15] gi|220962483|gb|ACL93839.1| ATP synthase C chain [Caulobacter crescentus NA1000] gi|295429690|gb|ADG08862.1| H+transporting two-sector ATPase C subunit [Caulobacter segnis ATCC 21756] Length = 74 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 41/69 (59%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM + + +F Y GA RNP AA+ + + + + E+LG+F Sbjct: 5 AAKYIGAGLAMLGMIGAGVGLGVMFGNYFQGALRNPTAAAQERPMLFLGMALTEALGIFA 64 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 65 LVIAFLILF 73 >gi|91206106|ref|YP_538461.1| F0F1 ATP synthase subunit C [Rickettsia bellii RML369-C] gi|157826461|ref|YP_001495525.1| F0F1 ATP synthase subunit C [Rickettsia bellii OSU 85-389] gi|123084547|sp|Q1RGZ2|ATPL_RICBR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810028|sp|A8GUJ2|ATPL_RICB8 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|91069650|gb|ABE05372.1| ATP synthase C chain [Rickettsia bellii RML369-C] gi|157801765|gb|ABV78488.1| F0F1 ATP synthase subunit C [Rickettsia bellii OSU 85-389] Length = 74 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 29/67 (43%), Positives = 42/67 (62%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ VG +GM AL VSNIF++ L+ RNP A + LI A +AE++GLF + Sbjct: 7 KFIGVGCMAIGMLGAALGVSNIFSSLLNSIARNPSATEQLQRMALIGAGLAEAMGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|34581013|ref|ZP_00142493.1| ATP synthase C chain [Rickettsia sibirica 246] gi|229586252|ref|YP_002844753.1| F0F1 ATP synthase subunit C [Rickettsia africae ESF-5] gi|259585526|sp|C3PM50|ATPL_RICAE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|28262398|gb|EAA25902.1| ATP synthase C chain [Rickettsia sibirica 246] gi|228021302|gb|ACP53010.1| ATP synthase C chain [Rickettsia africae ESF-5] Length = 74 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 28/67 (41%), Positives = 41/67 (61%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ G+ +GM AL VSNIF++ LS RNP A + LI A + E++GLF + Sbjct: 7 KFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLTEAMGLFSFV 66 Query: 83 VVMLLLF 89 + MLL+F Sbjct: 67 IAMLLIF 73 >gi|148557378|ref|YP_001264960.1| H+-transporting two-sector ATPase C [Sphingomonas wittichii RW1] gi|148502568|gb|ABQ70822.1| H+-transporting two-sector ATPase, C subunit [Sphingomonas wittichii RW1] Length = 75 Score = 52.0 bits (123), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+G+ AL V N+F ++L A RNP AA + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGVGMAALGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFV 90 +V M+LLFV Sbjct: 65 FVVAMILLFV 74 >gi|163761008|ref|ZP_02168086.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] gi|162281789|gb|EDQ32082.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] Length = 75 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAKY+ G+ACLGMG + + NIF +YLSGA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEALGIF 63 >gi|114570752|ref|YP_757432.1| H+-transporting two-sector ATPase subunit C [Maricaulis maris MCS10] gi|114341214|gb|ABI66494.1| ATP synthase F0 subcomplex C subunit [Maricaulis maris MCS10] Length = 74 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 25/56 (44%), Positives = 33/56 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 KY+ G+ACLGM A+ V NIF +L GA RNP AA A ++ + E+LG Sbjct: 5 GKYIGAGLACLGMLGAAVGVGNIFAAFLQGAMRNPSAAQAQFGTLIFGFAVTEALG 60 >gi|302383813|ref|YP_003819636.1| H+transporting two-sector ATPase C subunit [Brevundimonas subvibrioides ATCC 15264] gi|302194441|gb|ADL02013.1| H+transporting two-sector ATPase C subunit [Brevundimonas subvibrioides ATCC 15264] Length = 74 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 11/73 (15%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 MEA +F KY +G+A LGM A+ V NIF +L+GA RNP AA+ Sbjct: 1 MEAESF-----------KYFGIGLATLGMLGSAIGVGNIFGNFLAGALRNPSAAAGQVGN 49 Query: 66 VLIFAVIAESLGL 78 + + A + E+LG+ Sbjct: 50 LFVGAALVEALGI 62 >gi|304391256|ref|ZP_07373200.1| ATP synthase subunit 9 [Ahrensia sp. R2A130] gi|303296612|gb|EFL90968.1| ATP synthase subunit 9 [Ahrensia sp. R2A130] Length = 78 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 34/56 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 KY+ G+AC+GM A+ + +IF +LSGA RNP AA +++ + E+LG Sbjct: 9 GKYIGAGLACIGMAGAAIGLGSIFGNFLSGALRNPSAADGQFGRLILGFAVTEALG 64 >gi|83951210|ref|ZP_00959943.1| FoF1 ATP synthase, subunit C [Roseovarius nubinhibens ISM] gi|254487394|ref|ZP_05100599.1| ATP synthase subunit C, putative [Roseobacter sp. GAI101] gi|83839109|gb|EAP78405.1| FoF1 ATP synthase, subunit C [Roseovarius nubinhibens ISM] gi|214044263|gb|EEB84901.1| ATP synthase subunit C, putative [Roseobacter sp. GAI101] Length = 78 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC+GMG A+ V N+ YL+GA RNP AA+ + I AE+LG+F LV Sbjct: 11 YIGAGLACMGMGGAAVGVGNVAGNYLAGALRNPSAAAGQTATLFIGIAFAEALGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|255261393|ref|ZP_05340735.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255103728|gb|EET46402.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 78 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 30/68 (44%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC+GMG A+ V N+ +LSGA RNP AA+ + I AE+LG+F LV Sbjct: 11 YIGAGLACMGMGGAAVGVGNVAGNFLSGALRNPSAAAGQTATLFIGIAFAEALGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|58584716|ref|YP_198289.1| F0F1 ATP synthase subunit C [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|75507970|sp|Q5GSH7|ATPL_WOLTR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|58419032|gb|AAW71047.1| F0F1-type ATP synthase, subunit c [Wolbachia endosymbiont strain TRS of Brugia malayi] Length = 75 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 29/70 (41%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K++A+G++ LG+ L V+NIF+T LSG RNP + K V + A + E GL Sbjct: 5 ALKFIAIGLSVLGILGAGLGVANIFSTMLSGLARNPESEGKMKIYVYVGAGMVEFTGLLA 64 Query: 81 LLVVMLLLFV 90 ++ MLL+FV Sbjct: 65 FVLAMLLMFV 74 >gi|42520302|ref|NP_966217.1| F0F1 ATP synthase subunit C [Wolbachia endosymbiont of Drosophila melanogaster] gi|58698347|ref|ZP_00373262.1| ATP synthase F0, C subunit-related protein [Wolbachia endosymbiont of Drosophila ananassae] gi|99034173|ref|ZP_01314258.1| hypothetical protein Wendoof_01000947 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] gi|190571030|ref|YP_001975388.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|213019551|ref|ZP_03335357.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|225630134|ref|YP_002726925.1| ATP synthase F0, C subunit [Wolbachia sp. wRi] gi|81652673|sp|Q73HW2|ATPL_WOLPM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810074|sp|B3CLG2|ATPL_WOLPP RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810075|sp|C0R5U2|ATPL_WOLWR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|42410040|gb|AAS14151.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Drosophila melanogaster] gi|58535137|gb|EAL59221.1| ATP synthase F0, C subunit-related protein [Wolbachia endosymbiont of Drosophila ananassae] gi|190357302|emb|CAQ54730.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|212994973|gb|EEB55615.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|225592115|gb|ACN95134.1| ATP synthase F0, C subunit [Wolbachia sp. wRi] Length = 75 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 27/70 (38%), Positives = 43/70 (61%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +A K++A+G+A GM L ++NIF+ L+G RNP + K+ V I A + E +GL Sbjct: 4 VALKFIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGKMKSYVYIGAAMVEIMGLL 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 AFVLAMLLIF 73 >gi|217979918|ref|YP_002364065.1| H+transporting two-sector ATPase C subunit [Methylocella silvestris BL2] gi|217505294|gb|ACK52703.1| H+transporting two-sector ATPase C subunit [Methylocella silvestris BL2] Length = 75 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 35/71 (49%), Positives = 46/71 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +GMG A+ V IF +LSGA RNP A+ A I A +AE LG+F Sbjct: 5 AAKFIGAGLAAIGMGAAAIGVGLIFGNFLSGALRNPTASDAQFGRAFIGAALAEGLGIFA 64 Query: 81 LLVVMLLLFVI 91 LV +LLLFV+ Sbjct: 65 FLVAILLLFVL 75 >gi|88608692|ref|YP_506284.1| F0F1 ATP synthase subunit C [Neorickettsia sennetsu str. Miyayama] gi|254796764|ref|YP_003081600.1| hypothetical protein NRI_0378 [Neorickettsia risticii str. Illinois] gi|123736361|sp|Q2GE12|ATPL_NEOSM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|88600861|gb|ABD46329.1| ATP synthase F0, C chain [Neorickettsia sennetsu str. Miyayama] gi|254589960|gb|ACT69322.1| conserved domain protein [Neorickettsia risticii str. Illinois] Length = 75 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 26/68 (38%), Positives = 43/68 (63%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K++ +G++ +GM A+ VSNIF+ L+G RNP + K V A + E++GLF + Sbjct: 7 KFLGIGLSVVGMLGAAIGVSNIFSMMLNGIARNPESEEKLKKYVYAGAALTEAMGLFSFV 66 Query: 83 VVMLLLFV 90 + +LL+FV Sbjct: 67 LALLLIFV 74 >gi|62736231|ref|YP_227559.1| ATP synthase subunit 9 [Candida metapsilosis] gi|62177743|gb|AAX73034.1| ATP synthase subunit 9 [Candida metapsilosis] gi|170779376|gb|ACB37040.1| ATP synthase subunit 9 [Candida metapsilosis] Length = 76 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 45/73 (61%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ G+A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 TLAAKYIGAGIATLGLGGAAIGIAIVFAALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYAV 76 >gi|114769965|ref|ZP_01447575.1| F0F1 ATP synthase subunit C [alpha proteobacterium HTCC2255] gi|114549670|gb|EAU52552.1| F0F1 ATP synthase subunit C [alpha proteobacterium HTCC2255] Length = 78 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 42/68 (61%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC GMG A+ V ++ +LSGA RNP AA+ + I AE+LG+F LV Sbjct: 11 YIGAGLACTGMGGAAVGVGHVVGNFLSGALRNPSAATGQTATMFIGIAFAEALGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|310915116|emb|CBM41825.1| ATP synthase subunit 9 [Millerozyma farinosa] Length = 76 Score = 48.1 bits (113), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 27/73 (36%), Positives = 43/73 (58%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 LAAKY+ MA LG+G A+ ++ +F ++G RNP + + ++ +AE+ GL Sbjct: 4 ELAAKYIGASMATLGLGGAAIGIALVFVALINGTSRNPSLRATLFPQAMLGFALAEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F LLV LLL+ + Sbjct: 64 FCLLVSFLLLYAV 76 >gi|294676299|ref|YP_003576914.1| ATP synthase F0 subunit C [Rhodobacter capsulatus SB 1003] gi|75340080|sp|O05331|ATPL_RHOCA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|1934976|emb|CAA72982.1| FoF1 ATP synthase, subunit C [Rhodobacter capsulatus] gi|294475119|gb|ADE84507.1| ATP synthase F0, C subunit [Rhodobacter capsulatus SB 1003] Length = 78 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 28/68 (41%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC GMG A+ V ++ ++SGA RNP AA++ + I AE+LG+F LV Sbjct: 11 YIGAGLACTGMGGAAVGVGHVVGNFISGALRNPSAAASQTATMFIGIAFAEALGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|126724948|ref|ZP_01740791.1| F0F1 ATP synthase subunit C [Rhodobacterales bacterium HTCC2150] gi|126706112|gb|EBA05202.1| F0F1 ATP synthase subunit C [Rhodobacterales bacterium HTCC2150] Length = 78 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 28/68 (41%), Positives = 42/68 (61%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC GMG A+ V + ++SGA RNP AA++ + I AE+LG+F LV Sbjct: 11 YIGAGLACTGMGGAAVGVGTVVGNFISGALRNPSAAASQTATMFIGIAFAEALGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|87199338|ref|YP_496595.1| H+-transporting two-sector ATPase, C subunit [Novosphingobium aromaticivorans DSM 12444] gi|87135019|gb|ABD25761.1| ATP synthase F0 subcomplex C subunit [Novosphingobium aromaticivorans DSM 12444] Length = 75 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 31/53 (58%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +L V N+F +L GA RNP AA + + I AE LGL +V M+L+FV Sbjct: 22 SLGVGNVFAKFLEGALRNPGAADGQQGRLFIGFAAAELLGLLSFVVAMILIFV 74 >gi|254471735|ref|ZP_05085136.1| ATP synthase subunit C, putative [Pseudovibrio sp. JE062] gi|211958937|gb|EEA94136.1| ATP synthase subunit C, putative [Pseudovibrio sp. JE062] Length = 75 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 28/59 (47%), Positives = 39/59 (66%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAKY+ G+ACLGMG AL + NIF +L+GA RNP AA +++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAALGLGNIFGNFLAGALRNPSAADGQFGRLILGFAVTEALGIF 63 >gi|13476164|ref|NP_107734.1| F0F1 ATP synthase subunit C [Mesorhizobium loti MAFF303099] gi|14026924|dbj|BAB53520.1| Fo ATP synthase subunit C [Mesorhizobium loti MAFF303099] Length = 74 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 27/59 (45%), Positives = 38/59 (64%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 CLGMG + + NIF +YLSGA RNP AA ++ + E+LG+F LL+ +LL+F Sbjct: 15 CLGMGGAGIGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEALGIFSLLIALLLVF 73 >gi|309322026|ref|YP_003935014.1| ATP synthase F0 subunit c [Candida alai] gi|308746503|gb|ADO51038.1| ATP synthase F0 subunit c [Candida alai] Length = 76 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 26/73 (35%), Positives = 45/73 (61%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S ++ ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPALRSVLFSQSILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F LLV LLL+ + Sbjct: 64 FCLLVSFLLLYAV 76 >gi|312114301|ref|YP_004011897.1| ATP synthase F0 C subunit [Rhodomicrobium vannielii ATCC 17100] gi|311219430|gb|ADP70798.1| ATP synthase F0, C subunit [Rhodomicrobium vannielii ATCC 17100] Length = 75 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 28/70 (40%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+AC + + + +IF +L GA RNP AA +L+ +AE+ GLF Sbjct: 5 AAKLIGAGLACSALIGAGIGIGSIFGNFLQGALRNPSAAPGQFPNLLLGFALAEATGLFG 64 Query: 81 LLVVMLLLFV 90 L+V ++LLFV Sbjct: 65 LVVALILLFV 74 >gi|288903394|ref|YP_003434116.1| ATP synthase subunit 9 [Candida maltosa] gi|162401907|gb|ABX09999.1| ATP synthase subunit 9 [Candida maltosa] Length = 76 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F LL+ LLL+ + Sbjct: 64 FCLLISFLLLYAV 76 >gi|110678645|ref|YP_681652.1| F0F1 ATP synthase subunit C [Roseobacter denitrificans OCh 114] gi|163733903|ref|ZP_02141345.1| F0F1 ATP synthase subunit C [Roseobacter litoralis Och 149] gi|123362143|sp|Q16AM7|ATPL_ROSDO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|109454761|gb|ABG30966.1| ATP synthase F0, C subunit-related protein [Roseobacter denitrificans OCh 114] gi|161393014|gb|EDQ17341.1| F0F1 ATP synthase subunit C [Roseobacter litoralis Och 149] Length = 74 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ YL+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNYLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|110633054|ref|YP_673262.1| F0F1 ATP synthase subunit C [Mesorhizobium sp. BNC1] gi|110284038|gb|ABG62097.1| ATP synthase F0 subcomplex C subunit [Chelativorans sp. BNC1] Length = 75 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 37/59 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G+ACLGMG + + +IF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGIACLGMGGAGIGLGHIFGNYLAGALRNPSAADGQFGRLIFGFAVTEALGIF 63 >gi|148284441|ref|YP_001248531.1| F0F1 ATP synthase subunit C [Orientia tsutsugamushi str. Boryong] gi|189183294|ref|YP_001937079.1| F0F1 ATP synthase subunit C [Orientia tsutsugamushi str. Ikeda] gi|254810019|sp|A5CDC6|ATPL_ORITB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810020|sp|B3CQT8|ATPL_ORITI RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|146739880|emb|CAM79838.1| ATP synthase subunit C [Orientia tsutsugamushi str. Boryong] gi|189180065|dbj|BAG39845.1| ATP synthase C chain [Orientia tsutsugamushi str. Ikeda] Length = 74 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 39/68 (57%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+A+ GM AL V++IF ++ RNP A + LI A +AE++GLF + Sbjct: 7 KYIAIAFMAFGMAGAALGVASIFNALMNSIARNPSAIEDLQKAALIGAGLAEAMGLFSFI 66 Query: 83 VVMLLLFV 90 + +LL+F Sbjct: 67 LAILLMFT 74 >gi|162951856|ref|YP_001621426.1| ATPase subunit 9 [Debaryomyces hansenii] gi|215275205|sp|A9RAH4|ATP9_DEBHA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|98283737|gb|ABF58075.1| ATPase subunit 9 [Debaryomyces hansenii] Length = 76 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ MA LG+G A+ ++ +F ++G RNP + + ++ +AE+ GL Sbjct: 4 ALAAKYIGASMATLGLGGAAIGIALVFVALINGTSRNPSLRATLFPQAILGFALAEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMMSFLLLYAV 76 >gi|114705289|ref|ZP_01438197.1| F0F1 ATP synthase subunit C [Fulvimarina pelagi HTCC2506] gi|114540074|gb|EAU43194.1| F0F1 ATP synthase subunit C [Fulvimarina pelagi HTCC2506] Length = 75 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 36/59 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G+ACLGMG + + IF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGLACLGMGGAGIGLGTIFGQYLAGALRNPSAADGQFGRLIFGFAVTEALGIF 63 >gi|84500353|ref|ZP_00998602.1| ATP synthase F0, C subunit [Oceanicola batsensis HTCC2597] gi|84391306|gb|EAQ03638.1| ATP synthase F0, C subunit [Oceanicola batsensis HTCC2597] Length = 74 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 30/51 (58%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +LSGA RNP AA + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLSGALRNPSAAGGQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|38640867|ref|NP_943642.1| ATP synthase subunit 9 [Candida parapsilosis] gi|62736215|ref|YP_227574.1| ATP synthase subunit 9 [Candida orthopsilosis] gi|312233387|ref|YP_004021599.1| Atp9p [Candida jiufengensis] gi|396470|emb|CAA52434.1| ATP synthase subunit 9 [Candida parapsilosis] gi|62177727|gb|AAX73019.1| ATP synthase subunit 9 [Candida orthopsilosis] gi|170785414|gb|ACB37771.1| ATP synthase subunit 9 [Candida orthopsilosis] gi|183229569|gb|ACC60283.1| Atp9p [Candida parapsilosis] gi|224474104|gb|ACN49295.1| Atp9p [Candida orthopsilosis] gi|268373374|gb|ACZ03946.1| Atp9p [Candida jiufengensis] Length = 76 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYAV 76 >gi|12585569|ref|NP_075034.1| ATPase subunit 9 [Candida albicans SC5314] gi|301353203|ref|YP_003795201.1| Atp9p [Candida subhashii] gi|74623667|sp|Q9B8D5|ATP9_CANAL RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|12539620|gb|AAG59591.1|AF285261_4 ATPase subunit 9 [Candida albicans SC5314] gi|262410220|gb|ACY66213.1| Atp9p [Candida subhashii] Length = 76 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYAV 76 >gi|288900912|ref|YP_003433760.1| Atp9p [Candida viswanathii] gi|288903512|ref|YP_003434267.1| ATP synthase subunit 9 [Candida sojae] gi|288903519|ref|YP_003434274.1| ATP synthase subunit 9 [Candida sojae] gi|162401874|gb|ABO27133.1| ATP synthase subunit 9 [Candida sojae] gi|162401881|gb|ABO27140.1| ATP synthase subunit 9 [Candida sojae] gi|162401899|gb|ABP03920.1| Atp9p [Candida viswanathii] Length = 76 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 43/71 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A +G+G A+ ++ +F ++G RNP S + ++ +AE+ GL Sbjct: 4 ALAAKYIGASIATIGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALAEACGL 63 Query: 79 FLLLVVMLLLF 89 F L+V LLL+ Sbjct: 64 FSLMVSFLLLY 74 >gi|149915443|ref|ZP_01903970.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. AzwK-3b] gi|149810732|gb|EDM70573.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. AzwK-3b] Length = 74 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +LSGA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLSGALRNPSAAAGQTATLFIGIAFAEALGIFSFLVALLLMFAV 74 >gi|254509491|ref|ZP_05121558.1| ATP synthase F0, C subunit [Rhodobacteraceae bacterium KLH11] gi|221533202|gb|EEE36190.1| ATP synthase F0, C subunit [Rhodobacteraceae bacterium KLH11] Length = 74 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +LSGA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLSGALRNPSAAASQTATLFIGIAFAEALGIFAFLVSLLLMFAV 74 >gi|195975763|ref|YP_002122392.1| ATP synthase subunit 9 [Candida neerlandica] gi|162423303|gb|ABX89442.1| ATP synthase subunit 9 [Candida neerlandica] Length = 76 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 43/71 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A +G+G A+ ++ +F ++G RNP S + ++ +AE+ GL Sbjct: 4 ALAAKYIGASIATIGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALAEACGL 63 Query: 79 FLLLVVMLLLF 89 F L++ LLL+ Sbjct: 64 FSLMISFLLLY 74 >gi|315498138|ref|YP_004086942.1| ATP synthase f0, c subunit [Asticcacaulis excentricus CB 48] gi|315416150|gb|ADU12791.1| ATP synthase F0, C subunit [Asticcacaulis excentricus CB 48] Length = 74 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 21/68 (30%), Positives = 39/68 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K++ G+A LGM + + +F + GA RNP AA + +T + I + E+LG+ Sbjct: 5 AYKFLGAGLAMLGMIGAGIGLGLLFGNFFQGALRNPSAAKSQQTNLFIGMALTEALGILA 64 Query: 81 LLVVMLLL 88 ++ +++L Sbjct: 65 FVIAIMIL 72 >gi|56698067|ref|YP_168438.1| F0F1 ATP synthase subunit C [Ruegeria pomeroyi DSS-3] gi|81349058|sp|Q5LNH0|ATPL_SILPO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|56679804|gb|AAV96470.1| ATP synthase F0, C subunit [Ruegeria pomeroyi DSS-3] Length = 74 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|114763713|ref|ZP_01443107.1| ATP synthase subunit C [Pelagibaca bermudensis HTCC2601] gi|260429547|ref|ZP_05783524.1| conserved domain protein [Citreicella sp. SE45] gi|114543714|gb|EAU46727.1| ATP synthase subunit C [Roseovarius sp. HTCC2601] gi|260420170|gb|EEX13423.1| conserved domain protein [Citreicella sp. SE45] Length = 74 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALGIFSFLVALLLMFAV 74 >gi|57239564|ref|YP_180700.1| F0F1 ATP synthase subunit C [Ehrlichia ruminantium str. Welgevonden] gi|58579552|ref|YP_197764.1| F0F1 ATP synthase subunit C [Ehrlichia ruminantium str. Welgevonden] gi|58617606|ref|YP_196805.1| F0F1 ATP synthase subunit C [Ehrlichia ruminantium str. Gardel] gi|15811140|gb|AAL08820.1|AF308665_3 hypothetical ATP synthase C chain [Ehrlichia ruminantium] gi|57161643|emb|CAH58572.1| ATP synthase C subunit [Ehrlichia ruminantium str. Welgevonden] gi|58417218|emb|CAI28331.1| ATP synthase C chain [Ehrlichia ruminantium str. Gardel] gi|58418178|emb|CAI27382.1| ATP synthase C chain [Ehrlichia ruminantium str. Welgevonden] Length = 73 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 33/55 (60%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 K++AVG++ GM AL V+NIF+T L+G RNP K V A + E++G Sbjct: 5 KFIAVGLSVFGMVASALGVANIFSTMLNGLARNPETEDKLKKYVYTGAALVEAMG 59 >gi|259019204|ref|YP_003204921.1| ATP synthase subunit 9 [Millerozyma farinosa] gi|257143765|emb|CAY39291.1| ATP synthase, subunit 9 [Millerozyma farinosa] Length = 76 Score = 43.9 bits (102), Expect = 0.006, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 42/72 (58%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ MA LG+G A+ ++ +F ++G RNP + + ++ AE+ GLF Sbjct: 5 LAAKYMGAAMATLGLGGAAMGIALVFVALMNGTTRNPSIRATIFPQAMLGFATAEACGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LL++ + Sbjct: 65 CLMMSFLLIYAV 76 >gi|68171932|ref|ZP_00545248.1| H+-transporting two-sector ATPase, C subunit [Ehrlichia chaffeensis str. Sapulpa] gi|73667486|ref|YP_303502.1| F0F1 ATP synthase subunit C [Ehrlichia canis str. Jake] gi|88658098|ref|YP_507872.1| F0F1 ATP synthase subunit C [Ehrlichia chaffeensis str. Arkansas] gi|67998642|gb|EAM85379.1| H+-transporting two-sector ATPase, C subunit [Ehrlichia chaffeensis str. Sapulpa] gi|72394627|gb|AAZ68904.1| H+-transporting two-sector ATPase, C subunit [Ehrlichia canis str. Jake] gi|88599555|gb|ABD45024.1| ATP synthase F0, C chain [Ehrlichia chaffeensis str. Arkansas] Length = 73 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 33/55 (60%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 K++AVG++ GM AL V+NIF+T L+G RNP K V A + E++G Sbjct: 5 KFIAVGLSVFGMVASALGVANIFSTMLNGLARNPETEDKLKKYVYTGAALVEAMG 59 >gi|254461936|ref|ZP_05075352.1| ATP synthase F0, C subunit [Rhodobacterales bacterium HTCC2083] gi|260432716|ref|ZP_05786687.1| ATP synthase F0, C subunit [Silicibacter lacuscaerulensis ITI-1157] gi|206678525|gb|EDZ43012.1| ATP synthase F0, C subunit [Rhodobacteraceae bacterium HTCC2083] gi|260416544|gb|EEX09803.1| ATP synthase F0, C subunit [Silicibacter lacuscaerulensis ITI-1157] Length = 74 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVSLLLMFAV 74 >gi|149201374|ref|ZP_01878349.1| F0F1 ATP synthase subunit C [Roseovarius sp. TM1035] gi|149145707|gb|EDM33733.1| F0F1 ATP synthase subunit C [Roseovarius sp. TM1035] Length = 78 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 29/68 (42%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+AC+GMG A+ V N+ +L+GA RNP AA+ + I AE+LG+F LV Sbjct: 11 YIGAGLACMGMGGAAMGVGNVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSFLV 70 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 71 ALLLMFAV 78 >gi|296446971|ref|ZP_06888906.1| H+transporting two-sector ATPase C subunit [Methylosinus trichosporium OB3b] gi|296255538|gb|EFH02630.1| H+transporting two-sector ATPase C subunit [Methylosinus trichosporium OB3b] Length = 75 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 29/44 (65%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 IF +++GA RNP AA+ T +I A +AE LG+F L+ +LL Sbjct: 29 IFGNFVNGALRNPSAAAGQFTNAIIGAALAEGLGIFAFLIAILL 72 >gi|126732373|ref|ZP_01748173.1| F0F1 ATP synthase subunit C [Sagittula stellata E-37] gi|126707242|gb|EBA06308.1| F0F1 ATP synthase subunit C [Sagittula stellata E-37] Length = 73 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 23 VGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVSLLLMFAV 73 >gi|77464618|ref|YP_354122.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides 2.4.1] gi|146276247|ref|YP_001166406.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides ATCC 17025] gi|221640530|ref|YP_002526792.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides KD131] gi|332559511|ref|ZP_08413833.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides WS8N] gi|123590919|sp|Q3IZ13|ATPL_RHOS4 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487663|sp|A4WNY7|ATPL_RHOS5 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|77389036|gb|ABA80221.1| FoF1 ATP synthase, subunit C [Rhodobacter sphaeroides 2.4.1] gi|145554488|gb|ABP69101.1| H+-transporting two-sector ATPase, C subunit [Rhodobacter sphaeroides ATCC 17025] gi|221161311|gb|ACM02291.1| H+-transporting two-sector ATPase, C subunit [Rhodobacter sphaeroides KD131] gi|332277223|gb|EGJ22538.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides WS8N] Length = 78 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K++ G+A +G+G + V ++ +L+GA RNP AA + + AE+LG+F Sbjct: 9 GKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 L+ +LL+F + Sbjct: 69 LIALLLMFAV 78 >gi|71082825|ref|YP_265544.1| F0F1 ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1062] gi|91762752|ref|ZP_01264717.1| ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1002] gi|254455257|ref|ZP_05068686.1| ATP synthase subunit C, putative [Candidatus Pelagibacter sp. HTCC7211] gi|123761708|sp|Q4FPE8|ATPL_PELUB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|71061938|gb|AAZ20941.1| H+-transporting two-sector ATPase (subunit C) [Candidatus Pelagibacter ubique HTCC1062] gi|91718554|gb|EAS85204.1| ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1002] gi|207082259|gb|EDZ59685.1| ATP synthase subunit C, putative [Candidatus Pelagibacter sp. HTCC7211] Length = 75 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 22/46 (47%), Positives = 30/46 (65%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 IF YLSGA RNP AA +L+ +AE+ GLF L+V +++LF Sbjct: 28 IFGNYLSGAMRNPSAAQKQFPNLLLGFALAEATGLFGLVVALIILF 73 >gi|126463458|ref|YP_001044572.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides ATCC 17029] gi|224487616|sp|A3PN84|ATPL1_RHOS1 RecName: Full=ATP synthase subunit c 1; AltName: Full=ATP synthase F(0) sector subunit c 1; AltName: Full=F-type ATPase subunit c 1; Short=F-ATPase subunit c 1; AltName: Full=Lipid-binding protein 1 gi|126105122|gb|ABN77800.1| H+-transporting two-sector ATPase, C subunit [Rhodobacter sphaeroides ATCC 17029] Length = 71 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K++ G+A +G+G + V ++ +L+GA RNP AA + + AE+LG+F Sbjct: 2 GKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFSF 61 Query: 82 LVVMLLLFVI 91 L+ +LL+F + Sbjct: 62 LIALLLMFAV 71 >gi|49147010|ref|YP_025861.1| ATP synthase A chain subunit 9 [Moniliophthora perniciosa] gi|330339454|ref|YP_004376361.1| ATP synthase A chain subunit 9 [Moniliophthora roreri] gi|34538655|gb|AAQ74263.1| ATP synthase A chain subunit 9 [Moniliophthora perniciosa] gi|308912821|gb|ADO51568.1| ATP synthase A chain subunit 9 [Moniliophthora roreri] Length = 73 Score = 42.7 bits (99), Expect = 0.014, Method: Compositional matrix adjust. Identities = 25/70 (35%), Positives = 40/70 (57%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAKY+ G+AC G+ + + IF++ +S RNP T ++ +AE+ GLF Sbjct: 3 VAAKYIGAGLACSGLIGAGVGIGVIFSSLISSTARNPQIRGQLFTYAILGFALAEATGLF 62 Query: 80 LLLVVMLLLF 89 L+V LLL+ Sbjct: 63 ALMVAFLLLY 72 >gi|323136715|ref|ZP_08071796.1| H+transporting two-sector ATPase C subunit [Methylocystis sp. ATCC 49242] gi|322398032|gb|EFY00553.1| H+transporting two-sector ATPase C subunit [Methylocystis sp. ATCC 49242] Length = 74 Score = 42.7 bits (99), Expect = 0.015, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 29/44 (65%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 IF +++GA RNP AA+ T +I A +AE LG+F ++ +LL Sbjct: 27 IFGNFVNGALRNPSAAAGQFTNAIIGAALAEGLGIFAFVIALLL 70 >gi|304320004|ref|YP_003853647.1| hypothetical protein PB2503_02137 [Parvularcula bermudensis HTCC2503] gi|303298907|gb|ADM08506.1| hypothetical protein PB2503_02137 [Parvularcula bermudensis HTCC2503] Length = 74 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 26/69 (37%), Positives = 41/69 (59%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A L + V L + +F ++ GAFRNP A + T+ I + E+ GLF Sbjct: 5 AAKFIGAGLAVLPLLGVGLGLGILFGNFMQGAFRNPSATAGLNTQFYIAFALTEATGLFA 64 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 65 LVIAFLILF 73 >gi|126734939|ref|ZP_01750685.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. CCS2] gi|126715494|gb|EBA12359.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. CCS2] Length = 74 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 30/51 (58%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V + YL+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGTVAGNYLAGALRNPSAAAGQTATLFIGLAFAEALGIFAFLVSLLLMFAV 74 >gi|89053259|ref|YP_508710.1| F0F1 ATP synthase subunit C [Jannaschia sp. CCS1] gi|123401377|sp|Q28UC7|ATPL_JANSC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|88862808|gb|ABD53685.1| ATP synthase F0 subcomplex C subunit [Jannaschia sp. CCS1] Length = 78 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 28 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFAFLVALLLMFAV 78 >gi|326387164|ref|ZP_08208774.1| H+-transporting two-sector ATPase, C subunit [Novosphingobium nitrogenifigens DSM 19370] gi|326208345|gb|EGD59152.1| H+-transporting two-sector ATPase, C subunit [Novosphingobium nitrogenifigens DSM 19370] Length = 74 Score = 42.4 bits (98), Expect = 0.021, Method: Compositional matrix adjust. Identities = 20/52 (38%), Positives = 29/52 (55%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 ++ V N+F +L GA RNP AA + + I AE LGL ++ LL+F Sbjct: 22 SIGVGNVFAKFLEGALRNPGAADGQQGRLFIGFAGAELLGLLSFVIAALLIF 73 >gi|159045569|ref|YP_001534363.1| F0F1 ATP synthase subunit C [Dinoroseobacter shibae DFL 12] gi|157913329|gb|ABV94762.1| ATP synthase F0 [Dinoroseobacter shibae DFL 12] Length = 74 Score = 42.0 bits (97), Expect = 0.027, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|86137235|ref|ZP_01055813.1| ATP synthase subunit C [Roseobacter sp. MED193] gi|126738039|ref|ZP_01753760.1| F0F1 ATP synthase subunit C [Roseobacter sp. SK209-2-6] gi|85826559|gb|EAQ46756.1| ATP synthase subunit C [Roseobacter sp. MED193] gi|126720536|gb|EBA17241.1| F0F1 ATP synthase subunit C [Roseobacter sp. SK209-2-6] Length = 78 Score = 42.0 bits (97), Expect = 0.027, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 28 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSFLVALLLMFAV 78 >gi|254464174|ref|ZP_05077585.1| ATP synthase subunit C, putative [Rhodobacterales bacterium Y4I] gi|206685082|gb|EDZ45564.1| ATP synthase subunit C, putative [Rhodobacterales bacterium Y4I] Length = 78 Score = 42.0 bits (97), Expect = 0.027, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 28 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSFLVALLLMFAV 78 >gi|209883849|ref|YP_002287706.1| hypothetical protein OCAR_4699 [Oligotropha carboxidovorans OM5] gi|299134067|ref|ZP_07027260.1| H+transporting two-sector ATPase C subunit [Afipia sp. 1NLS2] gi|209872045|gb|ACI91841.1| conserved domain protein [Oligotropha carboxidovorans OM5] gi|298590814|gb|EFI51016.1| H+transporting two-sector ATPase C subunit [Afipia sp. 1NLS2] Length = 75 Score = 42.0 bits (97), Expect = 0.029, Method: Compositional matrix adjust. Identities = 23/61 (37%), Positives = 37/61 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+A +GMG + V IF+ +L+GA RNP A+ ++ + E+LG+ Sbjct: 3 PIAAKYIGAGLATIGMGGAGVGVGMIFSQFLNGALRNPSASQGQFANLIFGFAVTEALGI 62 Query: 79 F 79 F Sbjct: 63 F 63 >gi|218461929|ref|ZP_03502020.1| F0F1 ATP synthase subunit C [Rhizobium etli Kim 5] Length = 58 Score = 42.0 bits (97), Expect = 0.031, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 26/43 (60%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AL + NIF YLSGA RNP AA + ++ + E+LG+F Sbjct: 4 TALGLGNIFGNYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 46 >gi|262276823|ref|ZP_06054616.1| conserved domain protein [alpha proteobacterium HIMB114] gi|262223926|gb|EEY74385.1| conserved domain protein [alpha proteobacterium HIMB114] Length = 75 Score = 42.0 bits (97), Expect = 0.031, Method: Compositional matrix adjust. Identities = 21/51 (41%), Positives = 31/51 (60%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 + + IF YLS A RNP AA +L+ +AE+ GLF L+V +++LF Sbjct: 23 VGIGTIFGNYLSAAIRNPSAAQKQFPNLLLGFALAEATGLFGLVVALIILF 73 >gi|74004280|ref|XP_545452.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Canis familiaris] Length = 393 Score = 41.6 bits (96), Expect = 0.033, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 323 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 382 Query: 81 LLVVMLLLFVI 91 L+V L+ F + Sbjct: 383 LIVAFLIFFAM 393 >gi|254439212|ref|ZP_05052706.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 307] gi|254454270|ref|ZP_05067707.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 238] gi|198254658|gb|EDY78972.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 307] gi|198268676|gb|EDY92946.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 238] Length = 74 Score = 41.6 bits (96), Expect = 0.035, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSFLVALLLMFAV 74 >gi|187373146|ref|YP_001876489.1| ATP9 [Tilletia walkeri] gi|144926001|gb|ABP03935.1| ATP9 [Tilletia walkeri] Length = 74 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 24/69 (34%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LG+ + V +F + G+ RNP A T ++ ++E+ GLF Sbjct: 4 AAKYIGSGIATLGLTGAGIGVGIVFAALIQGSSRNPSLRGALFTYRILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMSFLLLY 72 >gi|32441699|ref|NP_861469.1| ATPase subunit 9 [Saccharomyces servazzii] gi|4588729|gb|AAD26195.1|AF114957_1 ATP synthase subunit 9 [Saccharomyces servazzii] gi|32140115|emb|CAD23424.1| ATPase subunit 9 [Saccharomyces servazzii] Length = 76 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 24/76 (31%), Positives = 46/76 (60%), Gaps = 8/76 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ G+A +G+ + ++ +F+ ++G RNP + K ++ FA+ ++E+ Sbjct: 5 LAAKYIGAGIATIGLLGAGIGIAIVFSALINGVSRNP----SLKDQLFSFAILGMALSEA 60 Query: 76 LGLFLLLVVMLLLFVI 91 GLF L++ +LLF + Sbjct: 61 TGLFCLMISFILLFAV 76 >gi|157816268|ref|YP_001492839.1| ATP synthase F0 subunit 9 [Tilletia indica] gi|115361461|gb|ABI95827.1| ATP synthase F0 subunit 9 [Tilletia indica] Length = 73 Score = 41.6 bits (96), Expect = 0.039, Method: Compositional matrix adjust. Identities = 24/69 (34%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LG+ + V +F + G+ RNP A T ++ ++E+ GLF Sbjct: 4 AAKYIGSGIATLGLTGAGIGVGIVFAALIQGSSRNPSLRGALFTYRILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMSFLLLY 72 >gi|13577|emb|CAA28961.1| unnamed protein product [Saccharomyces cerevisiae] Length = 76 Score = 41.2 bits (95), Expect = 0.046, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGL 78 LAAKY+ G++ +G+ V + ++ +F ++G RNP + +L FA ++E+ GL Sbjct: 5 LAAKYIGAGISTIGLLGVGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFA-LSEATGL 63 Query: 79 FLLLVVMLLLF 89 F L+V LLLF Sbjct: 64 FCLMVSFLLLF 74 >gi|288957580|ref|YP_003447921.1| ATPase F0 complex subunit C [Azospirillum sp. B510] gi|288909888|dbj|BAI71377.1| ATPase F0 complex subunit C [Azospirillum sp. B510] Length = 74 Score = 41.2 bits (95), Expect = 0.049, Method: Compositional matrix adjust. Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 AAK++ G+A + + V L + NIF+T + RNP +L FA + E++ LF Sbjct: 5 AAKFIGAGLAVIALAGVGLGIGNIFSTLIGSIARNPAVQPKVFPIGILGFA-LTEAVALF 63 Query: 80 LLLVVMLLLF 89 LL+ L+LF Sbjct: 64 ALLIAFLILF 73 >gi|83594575|ref|YP_428327.1| H+-transporting two-sector ATPase, subunit C [Rhodospirillum rubrum ATCC 11170] gi|114673|sp|P15014|ATPL_RHORU RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123725849|sp|Q2RPA5|ATPL_RHORT RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|46372|emb|CAA31247.1| ATPase F-0-subunit c (AA 1 - 75) [Rhodospirillum rubrum] gi|152600|gb|AAA26456.1| ATP synthase F-0 sector, c subunit [Rhodospirillum rubrum] gi|83577489|gb|ABC24040.1| H+-transporting two-sector ATPase, C subunit [Rhodospirillum rubrum ATCC 11170] Length = 75 Score = 41.2 bits (95), Expect = 0.050, Method: Compositional matrix adjust. Identities = 24/69 (34%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +GM + V NI+ ++ RNP A S + I + E++ LF Sbjct: 5 AAKMIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPAAKSTVELYGWIGFAVTEAIALFA 64 Query: 81 LLVVMLLLF 89 L+V ++LLF Sbjct: 65 LVVALILLF 73 >gi|4588725|gb|AAD26194.1|AF114954_1 ATP synthase subunit 9 [Kazachstania exigua] Length = 76 Score = 41.2 bits (95), Expect = 0.052, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 40/70 (57%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+A +G+ + ++ IF ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLF 64 Query: 80 LLLVVMLLLF 89 L+V +LLF Sbjct: 65 CLMVSFMLLF 74 >gi|144898766|emb|CAM75630.1| ATP synthase C chain [Magnetospirillum gryphiswaldense MSR-1] Length = 74 Score = 40.8 bits (94), Expect = 0.059, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 41/69 (59%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +GM + V NI+++ ++ RNP A + + I + E++ LF Sbjct: 5 AAKFIGAGLAAIGMIGSGIGVGNIWSSLIATVGRNPAAKANVELYGWIGFAVTEAIALFA 64 Query: 81 LLVVMLLLF 89 L+V +++LF Sbjct: 65 LVVALMVLF 73 >gi|209966766|ref|YP_002299681.1| ATP synthase F0, C subunit [Rhodospirillum centenum SW] gi|209960232|gb|ACJ00869.1| ATP synthase F0, C subunit [Rhodospirillum centenum SW] Length = 74 Score = 40.4 bits (93), Expect = 0.076, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASA-HKTEVLIFAVIAESLGLF 79 AA+Y+ G+A + V + ++NIF+ ++ RNP A + +L FA + E++ LF Sbjct: 5 AARYIGAGLAMFALAGVGIGIANIFSNLIASVARNPAARNQVFPIGILGFA-LTEAVALF 63 Query: 80 LLLVVMLLLF 89 LL+ L+LF Sbjct: 64 ALLIAFLILF 73 >gi|324309747|gb|ADY18528.1| ATPase subunit 9 [Phaeodactylum tricornutum] Length = 75 Score = 40.0 bits (92), Expect = 0.10, Method: Compositional matrix adjust. Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASA-HKTEVLIFAVIAESLGLF 79 AAKY+ G+A +G+ + + +F + G RNP K +L FA + E++ LF Sbjct: 5 AAKYIGAGLATIGLAGAGVGIGTVFGALVLGISRNPSLKDELFKMAILGFA-LTEAIALF 63 Query: 80 LLLVVMLLLF 89 L++V LLLF Sbjct: 64 ALMIVFLLLF 73 >gi|224162737|ref|XP_002338481.1| predicted protein [Populus trichocarpa] gi|222872404|gb|EEF09535.1| predicted protein [Populus trichocarpa] Length = 73 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 23/69 (33%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + IF++ ++ RNP S + ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGIIFSSLIASTARNPQIKSQLFSYAILGFALAEATGLFS 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMIAFLLLY 72 >gi|171681236|ref|XP_001905562.1| hypothetical protein [Podospora anserina S mat+] gi|170940576|emb|CAP65804.1| unnamed protein product [Podospora anserina S mat+] Length = 147 Score = 39.7 bits (91), Expect = 0.12, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 A K G+A +G+ + + +F ++G RNP A ++++ +A++ AE+ Sbjct: 77 AGKMQGAGLATIGLSGAGVGIGTVFAALINGTARNP----ALRSQLFSYAILGFAFAEAT 132 Query: 77 GLFLLLVVMLLLF 89 GLF L+V LLLF Sbjct: 133 GLFALMVAFLLLF 145 >gi|23016148|ref|ZP_00055907.1| COG0636: F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Magnetospirillum magnetotacticum MS-1] gi|83313093|ref|YP_423357.1| ATP synthase C chain [Magnetospirillum magneticum AMB-1] gi|123754046|sp|Q2W027|ATPL_MAGMM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|82947934|dbj|BAE52798.1| ATP synthase C chain [Magnetospirillum magneticum AMB-1] Length = 74 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +GM + V NI+ ++ RNP A + + I + E++ LF Sbjct: 5 AAKFIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGWIGFAVTEAIALFA 64 Query: 81 LLVVMLLLF 89 L+V +++LF Sbjct: 65 LVVALMVLF 73 >gi|12718935|ref|NP_075437.1| ATP synthetase subunit 9 [Yarrowia lipolytica] gi|51701316|sp|Q37695|ATP9_YARLI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|473692|gb|AAA78262.1| ATP synthase 9 [Yarrowia lipolytica] gi|12666830|emb|CAC28104.1| ATP9 protein [Yarrowia lipolytica] Length = 76 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 21/72 (29%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA KY+ G+A +G+ + ++ +F ++G RNP T ++ ++E+ GLF Sbjct: 5 LAGKYIGAGLASIGLVGAGIGIAIVFAALINGVSRNPALKGQLFTYSILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 ALMIAFLLLYAV 76 >gi|164421159|ref|YP_001648643.1| ATP synthase F0 subunit 9 [Hippospongia lachne] gi|164421189|ref|YP_001648686.1| ATP synthase F0 subunit 9 [Vaceletia sp. GW948] gi|281428831|ref|YP_003355008.1| ATP synthase F0 subunit 9 [Ircinia strobilina] gi|158939001|gb|ABW83923.1| ATP synthase F0 subunit 9 [Hippospongia lachne] gi|158939047|gb|ABW83966.1| ATP synthase F0 subunit 9 [Vaceletia sp. GW948] gi|251765331|gb|ACT15483.1| ATP synthase F0 subunit 9 [Ircinia strobilina] Length = 77 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 22/71 (30%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+Y+ G A +G+ + +F + + G RNP T ++ I+E++GLF Sbjct: 7 AARYIGAGAATIGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 66 Query: 81 LLVVMLLLFVI 91 L++ LLLF + Sbjct: 67 LMMAFLLLFAL 77 >gi|291286404|ref|YP_003503220.1| ATP synthase F0, C subunit [Denitrovibrio acetiphilus DSM 12809] gi|290883564|gb|ADD67264.1| ATP synthase F0, C subunit [Denitrovibrio acetiphilus DSM 12809] Length = 106 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 7/73 (9%) Query: 23 KYV----AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 KY+ A+G+A LG G+ N + G RNP A+ T ++I + ESL + Sbjct: 37 KYIGAGLAIGVAALGTGI---GQGNAIKGAVEGISRNPSASGKISTTMIIGLALIESLAI 93 Query: 79 FLLLVVMLLLFVI 91 + L+V ++LLFV+ Sbjct: 94 YALVVALILLFVV 106 >gi|115304398|ref|YP_762703.1| ATP synthase subunit 9 [Ustilago maydis] gi|121934265|sp|Q0H8W9|ATP9_USTMA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|72256228|gb|AAZ67018.1| ATP synthase subunit 9 [Ustilago maydis] gi|315465334|emb|CBQ72569.1| ATP synthase subunit 9 [Sporisorium reilianum] Length = 73 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 24/69 (34%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LG+ + V +F + G RNP T ++ ++E+ GLF Sbjct: 4 AAKYIGSGVAALGLIGAGIGVGIVFAALIQGVSRNPSLRGQLFTYAILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L+V LLL+ Sbjct: 64 LMVSFLLLY 72 >gi|6226533|ref|NP_009319.1| Oli1p [Saccharomyces cerevisiae S288c] gi|224588080|ref|YP_002640608.1| F0-ATP synthase subunit 9 [Saccharomyces pastorianus Weihenstephan 34/70] gi|48428794|sp|P61828|ATP9_SACDO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|48428795|sp|P61829|ATP9_YEAST RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein; AltName: Full=Oligomycin resistance protein 1 gi|7436173|pir||S44067 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - yeast (Saccharomyces sp.) mitochondrion gi|300193124|pdb|2WPD|J Chain J, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193125|pdb|2WPD|K Chain K, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193126|pdb|2WPD|L Chain L, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193127|pdb|2WPD|M Chain M, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193128|pdb|2WPD|N Chain N, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193129|pdb|2WPD|O Chain O, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193130|pdb|2WPD|P Chain P, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193131|pdb|2WPD|Q Chain Q, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193132|pdb|2WPD|R Chain R, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193133|pdb|2WPD|S Chain S, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|307568107|pdb|2XOK|K Chain K, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568108|pdb|2XOK|L Chain L, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568109|pdb|2XOK|M Chain M, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568110|pdb|2XOK|N Chain N, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568111|pdb|2XOK|O Chain O, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568112|pdb|2XOK|P Chain P, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568113|pdb|2XOK|Q Chain Q, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568114|pdb|2XOK|R Chain R, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568115|pdb|2XOK|S Chain S, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568116|pdb|2XOK|T Chain T, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|4588695|gb|AAD26181.1|AF114937_1 ATP synthase subunit 9 [Saccharomyces sp. IFO 1815] gi|4588700|gb|AAD26183.1|AF114940_1 ATP synthase subunit 9 [Saccharomyces sp. URFJ 50791] gi|6797711|gb|AAD26178.3|AF114930_1 ATP synthase subunit 9 [Saccharomyces bayanus] gi|6797713|gb|AAD26176.3|AF114924_1 ATP synthase subunit 9 [Saccharomyces pastorianus] gi|6797715|gb|AAD26174.3|AF114920_1 ATP synthase subunit 9 [Saccharomyces paradoxus] gi|6797717|gb|AAD26172.3|AF114916_1 ATP synthase subunit 9 [Saccharomyces pastorianus] gi|6797719|gb|AAD26170.3|AF114913_1 ATP synthase subunit 9 [Saccharomyces sp. IFO 1802] gi|6797722|gb|AAD26167.3|AF114908_1 ATP synthase subunit 9 [Saccharomyces paradoxus] gi|6797725|gb|AAD26164.3|AF114902_1 ATP synthase subunit 9 [Saccharomyces pastorianus] gi|13573|emb|CAA27605.1| unnamed protein product [Saccharomyces cerevisiae] gi|58151|emb|CAA30315.1| unnamed protein product [synthetic construct] gi|396250|emb|CAA80904.1| adenosine triphosphatase subunit 9 [Saccharomyces douglasii] gi|559291|gb|AAA67535.1| oli1 [Saccharomyces cerevisiae] gi|3550442|emb|CAA76566.1| mitochondrial ATPase subunit 9 [Saccharomyces sp. CID1] gi|3550446|emb|CAA76567.1| mitochondrial ATPase subunit 9 [Saccharomyces bayanus] gi|3550450|emb|CAA76568.1| mitochondrial ATPase subunit 9 [Saccharomyces sp. S6U] gi|4160380|emb|CAA09838.1| ATP9 [Saccharomyces cerevisiae] gi|152030931|gb|ABS28694.1| ATP synthase F0 subunit 9 [Saccharomyces cerevisiae YJM789] gi|193584770|gb|ACF19673.1| F0-ATP synthase subunit 9 [Saccharomyces pastorianus Weihenstephan 34/70] gi|207340124|gb|ACI24007.1| F0-ATP synthase subunit 9 [Saccharomyces bayanus] gi|256273157|gb|EEU08108.1| Oli1p [Saccharomyces cerevisiae JAY291] gi|283500325|gb|ADB25059.1| ATP synthase subunit 9 [Saccharomyces arboricola] gi|224735|prf||1112163A ATPase 9 mutant Length = 76 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGL 78 LAAKY+ G++ +G+ + ++ +F ++G RNP + +L FA ++E+ GL Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFA-LSEATGL 63 Query: 79 FLLLVVMLLLF 89 F L+V LLLF Sbjct: 64 FCLMVSFLLLF 74 >gi|24080112|ref|NP_705911.1| ATP synthase F0 subunit 9 [Cryptococcus neoformans var. grubii] gi|23630291|gb|AAN37581.1| ATP synthase subunit 9 [Cryptococcus neoformans var. grubii] gi|48526541|gb|AAT45469.1| ATP synthase subunit 9 [Cryptococcus neoformans var. neoformans] gi|48526545|gb|AAT45472.1| ATP synthase subunit 9 [Cryptococcus neoformans var. grubii] Length = 72 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 40/69 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +G+ + + +IF++ ++ RNP T ++ +AE+ GLF Sbjct: 3 AAKFIGAGLAAIGLSGAGVGIGSIFSSLIASVARNPALRGQLFTYAILGFALAEATGLFA 62 Query: 81 LLVVMLLLF 89 L++ L+L+ Sbjct: 63 LMISFLVLY 71 >gi|45239027|ref|NP_987084.1| AMI007Wp [Ashbya gossypii ATCC 10895] gi|50400377|sp|Q75G38|ATP9_ASHGO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|44978833|gb|AAS50174.1| AMI007Wp [Ashbya gossypii ATCC 10895] Length = 76 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ G++ +G+ + ++ +F + G RNP + K + FA+ I+E+ Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNP----SMKDTLFQFAILGFAISEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 61 TGLFCLMISFLLLY 74 >gi|196018978|ref|XP_002118905.1| hypothetical protein TRIADDRAFT_34930 [Trichoplax adhaerens] gi|190577795|gb|EDV18611.1| hypothetical protein TRIADDRAFT_34930 [Trichoplax adhaerens] Length = 75 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 KY+ VG++ + M A+ + NIF+ L+G RNP A I A +AE++GL Sbjct: 7 KYIGVGLSSIAMFGAAVGIGNIFSALLNGIARNPSAEEKLMKGAFIGAGLAEAMGL 62 >gi|15147257|ref|NP_150330.1| ATP synthase F0 subunit 9 [Rhizophydium sp. 136] gi|15100099|gb|AAK84260.1|AF404306_2 ATP synthase F0 subunit 9 [Rhizophydium sp. 136] Length = 79 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLFL 80 K + G+A G+ A V +F Y+SG RNP A +L FA++ E+LGLF Sbjct: 10 GKLIGGGLATFGLAGAATGVGIVFAAYISGVSRNPSLKAELFNITILGFALV-EALGLFS 68 Query: 81 LLVVMLLLF 89 L+ +++LF Sbjct: 69 LMKSLMILF 77 >gi|146343458|ref|YP_001208506.1| F0F1 ATP synthase subunit C [Bradyrhizobium sp. ORS278] gi|148252428|ref|YP_001237013.1| F0F1 ATP synthase subunit C [Bradyrhizobium sp. BTAi1] gi|146196264|emb|CAL80291.1| ATP synthase subunit C, membrane-bound, F0 sector; DCCD-binding [Bradyrhizobium sp. ORS278] gi|146404601|gb|ABQ33107.1| ATP synthase subunit C, membrane-bound, F0 sector [Bradyrhizobium sp. BTAi1] Length = 75 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 25/61 (40%), Positives = 35/61 (57%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+AC+GMG + IF YLS A RNP AA ++ + E+LG+ Sbjct: 3 PVAAKYIGAGIACIGMGGAGAGIGIIFGNYLSAALRNPSAAQGQFGNLIFGFAVTEALGI 62 Query: 79 F 79 F Sbjct: 63 F 63 >gi|190692013|gb|ACE87781.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein [synthetic construct] Length = 142 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF I Sbjct: 128 GLFCLMVAFLILFAI 142 >gi|329113594|ref|ZP_08242374.1| ATP synthase subunit c [Acetobacter pomorum DM001] gi|326697116|gb|EGE48777.1| ATP synthase subunit c [Acetobacter pomorum DM001] Length = 77 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 4/72 (5%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH--KTEVLIFAVIAESLGL 78 AA+ + G+A + + V + + NIF+T +S RNP A+ H +L FA + E++ L Sbjct: 8 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNP-ASRPHVFGLGMLGFA-LTEAIAL 65 Query: 79 FLLLVVMLLLFV 90 F LL+ L+LFV Sbjct: 66 FALLIAFLILFV 77 >gi|11466046|ref|NP_039507.1| ATPase 9 [Schizosaccharomyces pombe] gi|23505435|ref|NP_700364.1| ATP synthase F0 subunit 9 [Schizosaccharomyces octosporus] gi|3915611|sp|P21537|ATP9_SCHPO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|2654252|emb|CAA38292.1| ATPase 9 [Schizosaccharomyces pombe] gi|23397384|gb|AAN31939.1| ATP synthase F0 subunit 9 [Schizosaccharomyces octosporus] Length = 74 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A +G+ + + IF+ +SG RNP + ++ + E+ GLF Sbjct: 4 AAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATGLFC 63 Query: 81 LLVVMLLLF 89 L++ L+++ Sbjct: 64 LMLAFLIIY 72 >gi|269958453|ref|YP_003328240.1| ATP synthase subunit C [Anaplasma centrale str. Israel] gi|269848282|gb|ACZ48926.1| ATP synthase subunit C [Anaplasma centrale str. Israel] Length = 74 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 32/55 (58%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 ++VAVG++ LGM AL V+ +F+ L+G RNP K V A + E++G Sbjct: 5 RFVAVGLSVLGMVASALGVAAVFSAMLNGIARNPETEDKLKKYVYTGAALVEAMG 59 >gi|52782701|sp|P92811|ATP9_KLULA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|1857253|gb|AAB48406.1| Fo ATP synthase subunit 9 [Kluyveromyces lactis] Length = 76 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 23/76 (30%), Positives = 44/76 (57%), Gaps = 8/76 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ G++ +G+ + ++ +F+ + G RNP + K + FA+ ++E+ Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNP----SLKDTLFPFAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLFVI 91 GLF L++ LLL+ + Sbjct: 61 TGLFCLMISFLLLYAV 76 >gi|157814421|ref|YP_052723.2| ATP synthase F0 subunit 9 [Candida zemplinina] gi|157824560|gb|AAR10344.2| ATP synthase F0 subunit 9 [Candida zemplinina] Length = 76 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 22/72 (30%), Positives = 41/72 (56%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA KY+ GMA +G+ + ++ +F ++G RNP S+ T ++ + E+ GLF Sbjct: 5 LAGKYMGAGMATIGLLGAGMGMAIVFAALMNGTARNPSLRSSLFTYAMLGFGLVEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LL+ + Sbjct: 65 CLMMSFMLLYAV 76 >gi|258543514|ref|YP_003188947.1| ATP synthase F0 subunit chi [Acetobacter pasteurianus IFO 3283-01] gi|256634592|dbj|BAI00568.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-01] gi|256637648|dbj|BAI03617.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-03] gi|256640702|dbj|BAI06664.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-07] gi|256643757|dbj|BAI09712.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-22] gi|256646812|dbj|BAI12760.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-26] gi|256649865|dbj|BAI15806.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-32] gi|256652855|dbj|BAI18789.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655909|dbj|BAI21836.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-12] Length = 74 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 4/72 (5%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH--KTEVLIFAVIAESLGL 78 AA+ + G+A + + V + + NIF+T +S RNP A+ H +L FA + E++ L Sbjct: 5 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNP-ASRPHVFGLGMLGFA-LTEAIAL 62 Query: 79 FLLLVVMLLLFV 90 F LL+ L+LFV Sbjct: 63 FALLIAFLILFV 74 >gi|163794976|ref|ZP_02188945.1| ATP synthase C chain [alpha proteobacterium BAL199] gi|159179795|gb|EDP64322.1| ATP synthase C chain [alpha proteobacterium BAL199] Length = 74 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA----ESL 76 +AK + G+A + + V + + NIF+T +S RNP A + EV ++ E++ Sbjct: 5 SAKMIGAGIAVIALMGVGVGIGNIFSTLISSIARNPAA----RNEVFGIGILGFALTEAV 60 Query: 77 GLFLLLVVMLLLF 89 LF LL+ L+LF Sbjct: 61 ALFALLIAFLILF 73 >gi|209734668|gb|ACI68203.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGTATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 126 GLFCLMVAFLILFAV 140 >gi|166406825|gb|ABY87376.1| mitochondrial ATP synthase subunit 9 precursor-like protein [Haliotis diversicolor] Length = 157 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAKY+ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 87 AAKYIGAGAATVGVAGSGAGIGSVFGSLVIGYARNP----SLKQQLFSYAILGFALSEAM 142 Query: 77 GLFLLLVVMLLLFVI 91 GLF L++ LLLF + Sbjct: 143 GLFCLMMAFLLLFAL 157 >gi|13615|emb|CAA24079.1| unnamed protein product [Saccharomyces cerevisiae] gi|343758|gb|AAA32146.1| H(+)-transporting ATP synthase [Saccharomyces cerevisiae] gi|343939|gb|AAA32169.1| ATPase proteolipid [Saccharomyces cerevisiae] Length = 76 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 38/70 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F ++G RNP + ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAIFGFALSEATGLF 64 Query: 80 LLLVVMLLLF 89 L+V LLLF Sbjct: 65 CLMVSFLLLF 74 >gi|312219415|emb|CBX99359.1| similar to ATP synthase F0 subunit 9 [Leptosphaeria maculans] Length = 74 Score = 38.1 bits (87), Expect = 0.43, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 AAK GMA +G+ + + +F + G RNP + VL FA AE+ GLF Sbjct: 4 AAKIQGAGMATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFA-FAEATGLF 62 Query: 80 LLLVVMLLLFV 90 L++ LLL+V Sbjct: 63 ALMMSFLLLYV 73 >gi|77736329|ref|NP_001029864.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|109940311|sp|Q3ZC75|AT5G3_BOVIN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|73586705|gb|AAI02869.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Bos taurus] gi|296490649|gb|DAA32762.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] Length = 141 Score = 38.1 bits (87), Expect = 0.44, Method: Compositional matrix adjust. Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 8/81 (9%) Query: 13 AANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI 72 A N AAK++ G A +G+ + +F + + G RNP + K ++ +A++ Sbjct: 63 AVNRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAIL 118 Query: 73 ----AESLGLFLLLVVMLLLF 89 +E++GLF L+V L+LF Sbjct: 119 GFALSEAMGLFCLMVAFLILF 139 >gi|50261312|ref|YP_052921.1| ATP synthase F0 subunit 9 [Saprolegnia ferax] gi|48237625|gb|AAT40674.1| ATP synthase F0 subunit 9 [Saprolegnia ferax] Length = 75 Score = 38.1 bits (87), Expect = 0.46, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 AAK++ G+A +G+ + + N+F + + G RNP + +L FA + E++ LF Sbjct: 5 AAKFLGAGLATIGLAGAGVGIGNVFGSLILGISRNPSLQQELMRAAILGFA-LTEAIALF 63 Query: 80 LLLVVMLLLF 89 L++ L+LF Sbjct: 64 SLMIAFLILF 73 >gi|22003998|dbj|BAC06448.1| mitochondrial ATP synthase c-subunit (P3) precursor [Cyprinus carpio] Length = 140 Score = 37.7 bits (86), Expect = 0.46, Method: Compositional matrix adjust. Identities = 23/75 (30%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V LLLF + Sbjct: 126 GLFCLMVAFLLLFAM 140 >gi|170592337|ref|XP_001900925.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Brugia malayi] gi|158591620|gb|EDP30225.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Brugia malayi] Length = 113 Score = 37.7 bits (86), Expect = 0.47, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAKYV G A +G+ + N+F + + G RNP A K ++ +A+ ++E++ Sbjct: 43 AAKYVGAGAATVGVAGSGAGIGNVFGSLVIGYARNPSA----KNQLFSYAILGFALSEAM 98 Query: 77 GLFLLLVVMLLLF 89 GLF L + +LF Sbjct: 99 GLFCLCMGFCILF 111 >gi|239811651|gb|ACS27138.1| ATP synthase F0 subunit 9 [Heterosigma akashiwo] gi|239811691|gb|ACS27177.1| ATP synthase F0 subunit 9 [Heterosigma akashiwo] gi|288871947|dbj|BAI70633.1| ATP synthase F0 subunit 9 [Heterosigma akashiwo] Length = 75 Score = 37.7 bits (86), Expect = 0.50, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA----ESL 76 AAK+V G+A +G+ + + +F+ + G RNP + K ++ FA++ E+ Sbjct: 5 AAKFVGAGLATIGLAGAGVGIGTVFSALVLGTSRNP----SIKDDLFRFAILGFALTEAT 60 Query: 77 GLFLLLVVMLLLF 89 LF L+V L+LF Sbjct: 61 ALFALMVAFLILF 73 >gi|242016971|ref|XP_002428968.1| ATP synthase lipid-binding protein, putative [Pediculus humanus corporis] gi|212513797|gb|EEB16230.1| ATP synthase lipid-binding protein, putative [Pediculus humanus corporis] Length = 146 Score = 37.7 bits (86), Expect = 0.51, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAKY+ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 76 AAKYIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 131 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 132 GLFCLMMSFLLLF 144 >gi|162146974|ref|YP_001601435.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5] gi|209544038|ref|YP_002276267.1| H+transporting two-sector ATPase subunit C [Gluconacetobacter diazotrophicus PAl 5] gi|224487650|sp|A9HDM8|ATPL_GLUDA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|161785551|emb|CAP55122.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5] gi|209531715|gb|ACI51652.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter diazotrophicus PAl 5] Length = 74 Score = 37.7 bits (86), Expect = 0.51, Method: Compositional matrix adjust. Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 4/72 (5%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH--KTEVLIFAVIAESLGL 78 AA+ + G+A + + V + + NIF+T +S RNP AA H +L FA + E++ L Sbjct: 5 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNP-AARPHVFGLGMLGFA-LTEAVAL 62 Query: 79 FLLLVVMLLLFV 90 + LL+ L+LFV Sbjct: 63 YALLIAFLILFV 74 >gi|326934069|ref|XP_003213118.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Meleagris gallopavo] Length = 115 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 45 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 100 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 101 GLFCLMVAFLILFAM 115 >gi|74005789|ref|XP_853361.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Canis familiaris] Length = 115 Score = 37.7 bits (86), Expect = 0.56, Method: Compositional matrix adjust. Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 8/79 (10%) Query: 15 NGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI-- 72 +G AAK++ G A +G+ + +F + + G RNP + K ++ +A++ Sbjct: 39 SGDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGF 94 Query: 73 --AESLGLFLLLVVMLLLF 89 +E++GLF L+V L+LF Sbjct: 95 ALSEAMGLFCLMVAFLILF 113 >gi|198427649|ref|XP_002122403.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) [Ciona intestinalis] Length = 125 Score = 37.7 bits (86), Expect = 0.60, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 55 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFTYAILGFALSEAM 110 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 111 GLFCLMVAFLILFAL 125 >gi|256427271|ref|YP_003127036.1| Atp9p [Brettanomyces custersianus] gi|255761582|gb|ACU32819.1| Atp9p [Brettanomyces custersianus] Length = 76 Score = 37.4 bits (85), Expect = 0.60, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAE 74 +LA KY+ G+A +G+ + ++ +F ++G RNP K + +A+ ++E Sbjct: 4 ALAGKYIGAGIATIGLLGAGIGIAIVFAALINGTSRNP----GIKDTIFPYAILGFALSE 59 Query: 75 SLGLFLLLVVMLLLF 89 + GLF L++ LLL+ Sbjct: 60 ATGLFCLMISFLLLY 74 >gi|324105207|gb|ADY18366.1| mitochondrial ATP synthase subunit 9 precursor-like protein [Glycera tridactyla] Length = 90 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAKY+ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 20 AAKYIGAGAATVGVAGSGAGIGSVFGSLVIGYARNP----SLKQQLFSYAILGFALSEAM 75 Query: 77 GLFLLLVVMLLLF 89 GLF L++ L+LF Sbjct: 76 GLFCLMMAFLILF 88 >gi|209738122|gb|ACI69930.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 8/84 (9%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 +AA+ AAK++ G A +G+ + +F + + G RNP + K ++ +A+ Sbjct: 60 SAASRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAI 115 Query: 72 I----AESLGLFLLLVVMLLLFVI 91 + +E++GLF L+V L+LF + Sbjct: 116 LGFALSEAMGLFCLMVAFLILFAM 139 >gi|225703786|gb|ACO07739.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 140 Score = 37.4 bits (85), Expect = 0.63, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 126 GLFCLMVAFLILFTM 140 >gi|149730746|ref|XP_001499985.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) [Equus caballus] Length = 141 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 127 GLFCLMVAFLILFAM 141 >gi|197098748|ref|NP_001124618.1| ATP synthase lipid-binding protein, mitochondrial precursor [Pongo abelii] gi|68565143|sp|Q5RFL2|AT5G3_PONAB RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|55725157|emb|CAH89445.1| hypothetical protein [Pongo abelii] Length = 142 Score = 37.4 bits (85), Expect = 0.64, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 128 GLFCLMVAFLILFAM 142 >gi|57790531|ref|YP_184726.1| putative ATP synthase, subunit 9 [Kluyveromyces thermotolerans] gi|57161737|emb|CAG25604.1| putative ATP synthase, subunit 9 [Lachancea thermotolerans] Length = 76 Score = 37.4 bits (85), Expect = 0.65, Method: Compositional matrix adjust. Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ G++ +G+ + ++ +F ++G RNP + K + FA+ ++E+ Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNP----SLKDTLFPFAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 61 TGLFCLMISFLLLY 74 >gi|4502301|ref|NP_001680.1| ATP synthase lipid-binding protein, mitochondrial isoform A precursor [Homo sapiens] gi|16758592|ref|NP_446208.1| ATP synthase lipid-binding protein, mitochondrial precursor [Rattus norvegicus] gi|50659074|ref|NP_001002258.1| ATP synthase lipid-binding protein, mitochondrial isoform A precursor [Homo sapiens] gi|332209390|ref|XP_003253795.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Nomascus leucogenys] gi|332209392|ref|XP_003253796.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Nomascus leucogenys] gi|332209394|ref|XP_003253797.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] gi|332814788|ref|XP_525965.3| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 3 [Pan troglodytes] gi|332814790|ref|XP_003309369.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 1 [Pan troglodytes] gi|332814792|ref|XP_003309370.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 2 [Pan troglodytes] gi|1352048|sp|P48201|AT5G3_HUMAN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|51315713|sp|Q71S46|AT5G3_RAT RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|12620380|gb|AAG60677.1|AF315374_1 ATP synthase lipid-binding protein P3 precursor [Rattus norvegicus] gi|511450|gb|AAA78807.1| mitochondrial ATP synthase subunit 9 precursor [Homo sapiens] gi|62630225|gb|AAX88970.1| unknown [Homo sapiens] gi|76827802|gb|AAI06882.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Homo sapiens] gi|119631510|gb|EAX11105.1| hCG16568, isoform CRA_a [Homo sapiens] gi|119631511|gb|EAX11106.1| hCG16568, isoform CRA_a [Homo sapiens] gi|119631512|gb|EAX11107.1| hCG16568, isoform CRA_a [Homo sapiens] gi|189065214|dbj|BAG34937.1| unnamed protein product [Homo sapiens] gi|254071377|gb|ACT64448.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein [synthetic construct] Length = 142 Score = 37.4 bits (85), Expect = 0.65, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 128 GLFCLMVAFLILFAM 142 >gi|47115139|emb|CAG28411.1| ATP5G3 [Homo sapiens] Length = 142 Score = 37.4 bits (85), Expect = 0.66, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 128 GLFCLMVAFLILFAM 142 >gi|321469540|gb|EFX80520.1| hypothetical protein DAPPUDRAFT_304028 [Daphnia pulex] Length = 130 Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +IF + + G RNP + K ++ +A++ +E++ Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGSIFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 115 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 116 GLFCLMMAFLLLF 128 >gi|311213907|ref|NP_001185663.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Macaca mulatta] gi|109081176|ref|XP_001086288.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] gi|301769737|ref|XP_002920285.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Ailuropoda melanoleuca] gi|301769739|ref|XP_002920286.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Ailuropoda melanoleuca] gi|301769741|ref|XP_002920287.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Ailuropoda melanoleuca] gi|90078110|dbj|BAE88735.1| unnamed protein product [Macaca fascicularis] Length = 141 Score = 37.4 bits (85), Expect = 0.69, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|74004876|ref|XP_535971.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 3 [Canis familiaris] Length = 141 Score = 37.4 bits (85), Expect = 0.69, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 127 GLFCLMVAFLILFAM 141 >gi|296204470|ref|XP_002749356.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Callithrix jacchus] gi|296204472|ref|XP_002749357.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Callithrix jacchus] gi|296204474|ref|XP_002749358.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Callithrix jacchus] Length = 141 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|291391779|ref|XP_002712346.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 [Oryctolagus cuniculus] Length = 141 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|47271372|ref|NP_571836.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] gi|28279669|gb|AAH45894.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] Length = 140 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 126 GLFCLMVAFLILFAM 140 >gi|281348310|gb|EFB23894.1| hypothetical protein PANDA_009005 [Ailuropoda melanoleuca] Length = 102 Score = 37.4 bits (85), Expect = 0.73, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 32 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 87 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 88 GLFCLMVAFLILF 100 >gi|222475510|ref|YP_002563927.1| ATP synthase C chain (atpE) [Anaplasma marginale str. Florida] gi|56388377|gb|AAV86964.1| ATP synthase C chain [Anaplasma marginale str. St. Maries] gi|222419648|gb|ACM49671.1| ATP synthase C chain (atpE) [Anaplasma marginale str. Florida] Length = 80 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 ++VAVG++ LGM A V+ +F+ L+G RNP K V A + E++G Sbjct: 11 RFVAVGLSVLGMVASAFGVAAVFSAMLNGIARNPETEDKLKKYVYTGAALVEAMG 65 >gi|12597402|gb|AAG60044.1|AF311603_1 ATP synthase lipid binding protein p3 precursor [Danio rerio] Length = 118 Score = 37.4 bits (85), Expect = 0.75, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 48 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 103 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 104 GLFCLMVAFLILF 116 >gi|126326335|ref|XP_001368353.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 141 Score = 37.4 bits (85), Expect = 0.76, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 127 GLFCLMVAFLILFAL 141 >gi|229367984|gb|ACQ58972.1| ATP synthase lipid-binding protein, mitochondrial precursor [Anoplopoma fimbria] Length = 141 Score = 37.4 bits (85), Expect = 0.77, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|50750411|ref|XP_421992.1| PREDICTED: similar to mitochondrial ATP synthase subunit 9 [Gallus gallus] Length = 136 Score = 37.4 bits (85), Expect = 0.77, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 122 GLFCLMVAFLILFAM 136 >gi|308324351|gb|ADO29310.1| mitochondrial ATP synthase lipid-binding protein [Ictalurus punctatus] Length = 140 Score = 37.0 bits (84), Expect = 0.79, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 126 GLFCLMVAFLILFAM 140 >gi|225704066|gb|ACO07879.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] gi|225704792|gb|ACO08242.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 140 Score = 37.0 bits (84), Expect = 0.79, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 126 GLFCLMVAFLILFAM 140 >gi|310756730|gb|ADP20506.1| mitochondrial ATP synthase lipid-binding protein isoform A precursor [Heterocephalus glaber] Length = 141 Score = 37.0 bits (84), Expect = 0.80, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|209731794|gb|ACI66766.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209734262|gb|ACI68000.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 37.0 bits (84), Expect = 0.80, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 126 GLFCLMVAFLILFAM 140 >gi|179255|gb|AAA51806.1| ATPase subunit 9 [Homo sapiens] Length = 100 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 30 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 85 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 86 GLFCLMVAFLILF 98 >gi|27923925|ref|NP_778180.1| ATP synthase lipid-binding protein, mitochondrial precursor [Mus musculus] gi|3023368|sp|P56384|AT5G3_MOUSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|26346845|dbj|BAC37071.1| unnamed protein product [Mus musculus] gi|26352852|dbj|BAC40056.1| unnamed protein product [Mus musculus] gi|71121748|gb|AAH99786.1| Unknown (protein for MGC:124584) [Rattus norvegicus] gi|109730713|gb|AAI16219.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] gi|123857846|emb|CAM15305.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] gi|148695207|gb|EDL27154.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3, isoform CRA_a [Mus musculus] gi|148695208|gb|EDL27155.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3, isoform CRA_a [Mus musculus] gi|149022270|gb|EDL79164.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) isoform 3, isoform CRA_a [Rattus norvegicus] Length = 141 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|225706460|gb|ACO09076.1| ATP synthase lipid-binding protein, mitochondrial precursor [Osmerus mordax] Length = 139 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 125 GLFCLMVAFLILF 137 >gi|281344387|gb|EFB19971.1| hypothetical protein PANDA_005022 [Ailuropoda melanoleuca] Length = 97 Score = 37.0 bits (84), Expect = 0.84, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 27 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 82 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 83 GLFCLMVAFLILF 95 >gi|110598589|ref|ZP_01386857.1| ATP synthase F0, C subunit [Chlorobium ferrooxidans DSM 13031] gi|110339823|gb|EAT58330.1| ATP synthase F0, C subunit [Chlorobium ferrooxidans DSM 13031] Length = 75 Score = 37.0 bits (84), Expect = 0.84, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G GL + NI + G R P AAS +T ++I A + E +GLF ++ Sbjct: 13 IGAGLAVIGAGL---GIGNIAASATEGTARQPEAASDIRTTMIIAAALIEGVGLFGEVIC 69 Query: 85 MLL 87 +LL Sbjct: 70 VLL 72 >gi|224055127|ref|XP_002199194.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 2 [Taeniopygia guttata] gi|224055131|ref|XP_002199191.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 1 [Taeniopygia guttata] Length = 141 Score = 37.0 bits (84), Expect = 0.85, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|58578580|ref|YP_203326.1| ATP synthase F0 subunit 9 [Smittium culisetae] gi|57339024|gb|AAW49493.1| ATP synthase F0 subunit 9 [Smittium culisetae] Length = 73 Score = 37.0 bits (84), Expect = 0.85, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKT-EVLIFAVIAESLGLF 79 +AK +A G+A L + ++ + N+F++ L+ RNP T +L FA++ E++GLF Sbjct: 4 SAKLIAAGLAVLSLAGTSIGIGNVFSSLLNSYSRNPSLRGQLFTYSILGFALV-EAMGLF 62 Query: 80 LLLVVMLLLF 89 L++ L L+ Sbjct: 63 ALMMSFLFLY 72 >gi|296235834|ref|XP_002763067.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 141 Score = 37.0 bits (84), Expect = 0.87, Method: Compositional matrix adjust. Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAK++ VG A +G+ + +F + + G RNP + K ++ +A+ ++E++ Sbjct: 71 AAKFIGVGAATVGVAGFGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLFVI 91 GL L+V L+LFV+ Sbjct: 127 GLSCLMVAFLILFVM 141 >gi|309288|gb|AAA16434.1| H+ ATP synthase [Mus musculus] gi|148670618|gb|EDL02565.1| mCG134178 [Mus musculus] Length = 136 Score = 37.0 bits (84), Expect = 0.88, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVTFLILF 134 >gi|223646126|gb|ACN09821.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223671973|gb|ACN12168.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 137 Score = 37.0 bits (84), Expect = 0.88, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 122 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 123 GLFCLMVAFLILF 135 >gi|118102906|ref|XP_001233576.1| PREDICTED: similar to P1 subunit isoform 1 [Gallus gallus] gi|118102908|ref|XP_001233587.1| PREDICTED: similar to P1 subunit isoform 2 [Gallus gallus] Length = 136 Score = 37.0 bits (84), Expect = 0.88, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 122 GLFCLMVAFLILFAM 136 >gi|88607588|ref|YP_505725.1| F0F1 ATP synthase subunit C [Anaplasma phagocytophilum HZ] gi|88598651|gb|ABD44121.1| ATP synthase F0, C chain [Anaplasma phagocytophilum HZ] Length = 74 Score = 37.0 bits (84), Expect = 0.88, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 32/55 (58%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +++AVG++ LGM AL V+ +F+ L+G RNP K V A + E++G Sbjct: 5 RFLAVGLSVLGMVASALGVAAVFSAMLNGIARNPETEEKLKKYVYTGAALVEAMG 59 >gi|325954828|ref|YP_004238488.1| ATP synthase subunit c [Weeksella virosa DSM 16922] gi|323437446|gb|ADX67910.1| ATP synthase subunit c [Weeksella virosa DSM 16922] Length = 69 Score = 37.0 bits (84), Expect = 0.89, Method: Compositional matrix adjust. Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A LG+GL + I + + G R P AAS +T ++I A + E GLF ++V Sbjct: 8 IGAGLAVLGVGL---GIGKIGGSAMEGIARQPEAASKIQTAMIIAAALIEGAGLFGIVVA 64 Query: 85 ML 86 +L Sbjct: 65 LL 66 >gi|311272672|ref|XP_003133540.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Sus scrofa] Length = 269 Score = 37.0 bits (84), Expect = 0.90, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 199 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 254 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 255 GLFCLMVAFLILFAM 269 >gi|157929876|gb|ABW04126.1| ATP synthase H+ transporting F0 complex subunit c [Epinephelus coioides] Length = 139 Score = 37.0 bits (84), Expect = 0.90, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 125 GLFCLMVAFLILFAM 139 >gi|148230635|ref|NP_001080083.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Xenopus laevis] gi|27371265|gb|AAH41245.1| Cg1746-prov protein [Xenopus laevis] Length = 142 Score = 37.0 bits (84), Expect = 0.90, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 128 GLFCLMVAFLILFAM 142 >gi|118102910|ref|XP_001233603.1| PREDICTED: similar to P1 subunit isoform 3 [Gallus gallus] gi|118102912|ref|XP_418114.2| PREDICTED: similar to P1 subunit isoform 4 [Gallus gallus] Length = 136 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 122 GLFCLMVAFLILFAM 136 >gi|94482844|gb|ABF22459.1| mitochondrial ATP synthase F0 complex subunit c isoform 3 [Takifugu rubripes] Length = 139 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 25/93 (26%), Positives = 48/93 (51%), Gaps = 8/93 (8%) Query: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 + + M A +A + AAK++ G A +G+ + +F + + G RNP Sbjct: 49 LSQVTMRAFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP---- 104 Query: 61 AHKTEVLIFAVI----AESLGLFLLLVVMLLLF 89 + K ++ +A++ +E++GLF L+V L+LF Sbjct: 105 SLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 137 >gi|213511574|ref|NP_001135171.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-1 [Salmo salar] gi|197632363|gb|ACH70905.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-1 [Salmo salar] gi|209732020|gb|ACI66879.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209735800|gb|ACI68769.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|303659177|gb|ADM15948.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 127 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 57 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 112 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 113 GLFCLMVAFLILFAM 127 >gi|209736002|gb|ACI68870.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 95 Score = 37.0 bits (84), Expect = 0.92, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 26 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 81 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 82 GLFCLMVAFLILF 94 >gi|213511946|ref|NP_001133182.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-2 [Salmo salar] gi|209733544|gb|ACI67641.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 37.0 bits (84), Expect = 0.92, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 125 GLFCLMVAFLILFAM 139 >gi|149639699|ref|XP_001514999.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] Length = 161 Score = 37.0 bits (84), Expect = 0.92, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 91 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 146 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 147 GLFCLMVAFLILFAM 161 >gi|115767413|ref|XP_788804.2| PREDICTED: similar to mitochondrial ATP synthase c-subunit (P3) precursor, partial [Strongylocentrotus purpuratus] gi|115967699|ref|XP_001194359.1| PREDICTED: similar to mitochondrial ATP synthase c-subunit (P3) precursor, partial [Strongylocentrotus purpuratus] Length = 117 Score = 37.0 bits (84), Expect = 0.94, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 47 AAKFIGAGAATVGLAGSGAGIGTVFGSLIIGYARNP----SLKQQLFTYAILGFALSEAM 102 Query: 77 GLFLLLVVMLLLFVI 91 GLF L++ L+LF + Sbjct: 103 GLFCLMMAFLILFAL 117 >gi|37589803|gb|AAH59619.1| Zgc:73293 [Danio rerio] Length = 138 Score = 37.0 bits (84), Expect = 0.94, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 124 GLFCLMVAFLILF 136 >gi|32454284|gb|AAP82941.1| putative ATP synthase c-subunit [Paralichthys olivaceus] Length = 120 Score = 37.0 bits (84), Expect = 0.94, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 50 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAV 105 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 106 GLFCLMVAFLILF 118 >gi|297493590|gb|ADI40517.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C2 [Cynopterus sphinx] Length = 110 Score = 37.0 bits (84), Expect = 0.94, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 41 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 96 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 97 GLFCLMVAFLILF 109 >gi|161544981|ref|YP_154219.2| F0F1 ATP synthase subunit C [Anaplasma marginale str. St. Maries] gi|254995315|ref|ZP_05277505.1| F0F1 ATP synthase subunit C [Anaplasma marginale str. Mississippi] gi|255003497|ref|ZP_05278461.1| F0F1 ATP synthase subunit C [Anaplasma marginale str. Puerto Rico] gi|255004619|ref|ZP_05279420.1| F0F1 ATP synthase subunit C [Anaplasma marginale str. Virginia] Length = 74 Score = 37.0 bits (84), Expect = 0.94, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 ++VAVG++ LGM A V+ +F+ L+G RNP K V A + E++G Sbjct: 5 RFVAVGLSVLGMVASAFGVAAVFSAMLNGIARNPETEDKLKKYVYTGAALVEAMG 59 >gi|332259428|ref|XP_003278791.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Nomascus leucogenys] gi|332259430|ref|XP_003278792.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Nomascus leucogenys] gi|332259432|ref|XP_003278793.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] gi|332259434|ref|XP_003278794.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 4 [Nomascus leucogenys] gi|332259436|ref|XP_003278795.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 5 [Nomascus leucogenys] Length = 136 Score = 37.0 bits (84), Expect = 0.95, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|209732790|gb|ACI67264.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 37.0 bits (84), Expect = 0.95, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSPIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 125 GLFCLMVAFLILFAM 139 >gi|50878271|ref|NP_998193.1| ATP synthase lipid-binding protein, mitochondrial [Danio rerio] gi|47937900|gb|AAH71368.1| Zgc:73293 [Danio rerio] Length = 138 Score = 37.0 bits (84), Expect = 0.95, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 124 GLFCLMVAFLILF 136 >gi|197632365|gb|ACH70906.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-2 [Salmo salar] gi|209732094|gb|ACI66916.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209737424|gb|ACI69581.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209737884|gb|ACI69811.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223646556|gb|ACN10036.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223672403|gb|ACN12383.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 37.0 bits (84), Expect = 0.97, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 125 GLFCLMVAFLILFAM 139 >gi|52430378|gb|AAU50550.1| ATPase synthase protein 9 [Fundulus heteroclitus] Length = 110 Score = 37.0 bits (84), Expect = 0.97, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 40 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 95 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 96 GLFCLMVAFLILF 108 >gi|4885081|ref|NP_005166.1| ATP synthase lipid-binding protein, mitochondrial precursor [Homo sapiens] gi|50659069|ref|NP_001002027.1| ATP synthase lipid-binding protein, mitochondrial precursor [Homo sapiens] gi|55646787|ref|XP_511941.1| PREDICTED: hypothetical protein LOC455195 isoform 4 [Pan troglodytes] gi|114666317|ref|XP_001172721.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 isoform 2 [Pan troglodytes] gi|114666320|ref|XP_001172743.1| PREDICTED: hypothetical protein LOC455195 isoform 3 [Pan troglodytes] gi|297715955|ref|XP_002834304.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Pongo abelii] gi|332847288|ref|XP_001172711.2| PREDICTED: hypothetical protein LOC455195 isoform 1 [Pan troglodytes] gi|461588|sp|P05496|AT5G1_HUMAN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|38430|emb|CAA49532.1| P1 gene for c subunit of human mitochondrial ATP synthase [Homo sapiens] gi|285908|dbj|BAA02420.1| ATP synthase subunit c precursor [Homo sapiens] gi|5262507|emb|CAB45704.1| hypothetical protein [Homo sapiens] gi|13436356|gb|AAH04963.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Homo sapiens] gi|30583299|gb|AAP35894.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Homo sapiens] gi|49065324|emb|CAG38480.1| ATP5G1 [Homo sapiens] gi|60655527|gb|AAX32327.1| ATP synthase mitochondrial F0 complex subunit c isoform 1 [synthetic construct] gi|60823066|gb|AAX36631.1| ATP synthase mitochondrial F0 complex subunit c isoform 1 [synthetic construct] gi|117644094|emb|CAL38315.1| hypothetical protein [synthetic construct] gi|119615111|gb|EAW94705.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), isoform CRA_a [Homo sapiens] gi|119615112|gb|EAW94706.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), isoform CRA_a [Homo sapiens] gi|189053168|dbj|BAG34790.1| unnamed protein product [Homo sapiens] gi|261859424|dbj|BAI46234.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 [synthetic construct] Length = 136 Score = 37.0 bits (84), Expect = 0.97, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|326936387|ref|XP_003214236.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Meleagris gallopavo] Length = 172 Score = 37.0 bits (84), Expect = 0.98, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 102 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 157 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 158 GLFCLMVAFLILF 170 >gi|41056119|ref|NP_957470.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 [Danio rerio] gi|28503019|gb|AAH47199.1| Zgc:55970 [Danio rerio] gi|50925106|gb|AAH78654.1| Zgc:55970 protein [Danio rerio] Length = 139 Score = 37.0 bits (84), Expect = 0.98, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 125 GLFCLMVAFLILF 137 >gi|327283486|ref|XP_003226472.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Anolis carolinensis] Length = 143 Score = 37.0 bits (84), Expect = 0.98, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 73 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 128 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 129 GLFCLMVAFLILFAM 143 >gi|296194948|ref|XP_002745184.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 215 Score = 37.0 bits (84), Expect = 0.98, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK+++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 145 AAKFISAGAATVGVAGSGAGIGTVFGSVIIGYARNP----SLKQQLFSYAILGFALSEAM 200 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 201 GLFCLMVAFLILF 213 >gi|23464607|ref|NP_696975.1| ATP synthase F0 subunit 9 [Monosiga brevicollis ATCC 50154] gi|23344070|gb|AAN28346.1| ATP synthase F0 subunit 9 [Monosiga brevicollis] Length = 73 Score = 37.0 bits (84), Expect = 0.98, Method: Compositional matrix adjust. Identities = 19/69 (27%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +G+ + +F + ++G RNP T ++ ++E++ LF Sbjct: 4 AAKFIGGGLAAIGVAGSGAGIGTVFGSLITGYARNPSLKQGMFTYAILGFALSEAVALFA 63 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 64 LMISFLILF 72 >gi|213512117|ref|NP_001133183.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-3 [Salmo salar] gi|197632367|gb|ACH70907.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-3 [Salmo salar] gi|209730842|gb|ACI66290.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223646610|gb|ACN10063.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223672457|gb|ACN12410.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 37.0 bits (84), Expect = 0.99, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 125 GLFCLMVAFLILFAM 139 >gi|18700491|dbj|BAB85212.1| ATP lipid-binding protein like protein [Marsupenaeus japonicus] Length = 128 Score = 37.0 bits (84), Expect = 0.99, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 58 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 113 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 114 GLFCLMMAFLLLF 126 >gi|209733112|gb|ACI67425.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 126 GLFCLMVAFLILF 138 >gi|94482791|gb|ABF22409.1| mitochondrial ATP synthase F0 complex subunit c isoform 1 [Takifugu rubripes] Length = 137 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 122 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 123 GLFCLMVAFLILF 135 >gi|225707250|gb|ACO09471.1| ATP synthase lipid-binding protein, mitochondrial precursor [Osmerus mordax] Length = 138 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 124 GLFCLMVAFLILF 136 >gi|221220858|gb|ACM09090.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 137 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 122 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 123 GLFCLMVAFLILF 135 >gi|115292010|gb|AAI22236.1| Zgc:153316 [Danio rerio] Length = 128 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 58 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 113 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 114 GLFCLMMAFLLLF 126 >gi|73996376|ref|XP_534788.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Canis familiaris] Length = 252 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 182 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 237 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 238 GLFCLMVAFLILFAM 252 >gi|149541038|ref|XP_001519284.1| PREDICTED: similar to ATP synthase lipid binding protein p3 [Ornithorhynchus anatinus] Length = 122 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 52 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 107 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 108 GLFCLMVAFLILFAM 122 >gi|281342170|gb|EFB17754.1| hypothetical protein PANDA_012605 [Ailuropoda melanoleuca] Length = 105 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 35 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 90 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 91 GLFCLMVAFLILF 103 >gi|229367004|gb|ACQ58482.1| ATP synthase lipid-binding protein, mitochondrial precursor [Anoplopoma fimbria] Length = 138 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 124 GLFCLMVAFLILF 136 >gi|209731238|gb|ACI66488.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|303665532|gb|ADM16188.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 126 GLFCLMVAFLILF 138 >gi|28603764|ref|NP_788822.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|416684|sp|P32876|AT5G1_BOVIN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|96|emb|CAA28845.1| P1 subunit [Bos taurus] gi|74355040|gb|AAI02953.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Bos taurus] gi|296476460|gb|DAA18575.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|224830|prf||1202261A ATP synthase proteolipid P1 Length = 136 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|225717276|gb|ACO14484.1| ATP synthase lipid-binding protein, mitochondrial precursor [Esox lucius] Length = 137 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 122 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 123 GLFCLMVAFLILF 135 >gi|321268746|gb|ADW79195.1| ATP synthase F0 subunit c [Cyanophora paradoxa] Length = 74 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 +AK + G+A + + + + N+F++ ++ RNP K +L FA + E++ LF Sbjct: 4 SAKLIGAGLATIALAGAGIGIGNVFSSLINSVARNPSLTKDLFKYAILGFA-LTEAIALF 62 Query: 80 LLLVVMLLLF 89 L++V L+LF Sbjct: 63 ALMIVFLILF 72 >gi|52346088|ref|NP_001005087.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Xenopus (Silurana) tropicalis] gi|49903762|gb|AAH77012.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus (Silurana) tropicalis] gi|89268626|emb|CAJ83365.1| atp5g3 [Xenopus (Silurana) tropicalis] Length = 142 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 128 GLFCLMVAFLILF 140 >gi|313241222|emb|CBY33504.1| unnamed protein product [Oikopleura dioica] Length = 103 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 AAK++ G A +G+ + +F + + G RNP A +L FA ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFA-LSEAMGLF 91 Query: 80 LLLVVMLLLFVI 91 L+V L+LF + Sbjct: 92 CLMVAFLILFAL 103 >gi|296114244|ref|ZP_06832899.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter hansenii ATCC 23769] gi|330991387|ref|ZP_08315338.1| ATP synthase subunit c [Gluconacetobacter sp. SXCC-1] gi|295979320|gb|EFG86043.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter hansenii ATCC 23769] gi|329761406|gb|EGG77899.1| ATP synthase subunit c [Gluconacetobacter sp. SXCC-1] Length = 74 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 26/72 (36%), Positives = 43/72 (59%), Gaps = 4/72 (5%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH--KTEVLIFAVIAESLGL 78 AA+ + G+A + + V + + NIF+T +S RNP +A H +L FA + E++ L Sbjct: 5 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNP-SARPHVFGLGMLGFA-LTEAVAL 62 Query: 79 FLLLVVMLLLFV 90 + LL+ L+LFV Sbjct: 63 YALLIAFLILFV 74 >gi|291230682|ref|XP_002735292.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3-like [Saccoglossus kowalevskii] Length = 149 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 79 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 134 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 135 GLFCLMVAFLILFAL 149 >gi|149286944|gb|ABR23371.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Ornithodoros parkeri] Length = 138 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 8/93 (8%) Query: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 + +Q + +A AAK++ G A +G+ + ++F + + G RNP Sbjct: 48 LGRQEVRTLQTSAVRKDIDSAAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP---- 103 Query: 61 AHKTEVLIFAVI----AESLGLFLLLVVMLLLF 89 + K ++ +A++ +E++GLF L++ LLLF Sbjct: 104 SLKQQLFSYAILGFALSEAMGLFCLMMAFLLLF 136 >gi|308321426|gb|ADO27864.1| mitochondrial ATP synthase lipid-binding protein [Ictalurus furcatus] Length = 139 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 125 GLFCLMVAFLILF 137 >gi|89266423|gb|ABD65503.1| ATP synthase H+ transporting mitochondrial F0 complex-like [Ictalurus punctatus] Length = 75 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 5 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 60 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 61 GLFCLMVAFLILF 73 >gi|31982497|ref|NP_031532.2| ATP synthase lipid-binding protein, mitochondrial [Mus musculus] gi|238637299|ref|NP_001154891.1| ATP synthase lipid-binding protein, mitochondrial [Mus musculus] gi|81903631|sp|Q9CR84|AT5G1_MOUSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|12842227|dbj|BAB25522.1| unnamed protein product [Mus musculus] gi|12843525|dbj|BAB26015.1| unnamed protein product [Mus musculus] gi|12844952|dbj|BAB26561.1| unnamed protein product [Mus musculus] gi|12846607|dbj|BAB27233.1| unnamed protein product [Mus musculus] gi|12846923|dbj|BAB27363.1| unnamed protein product [Mus musculus] gi|12847554|dbj|BAB27617.1| unnamed protein product [Mus musculus] gi|13277978|gb|AAH03854.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] gi|66267548|gb|AAH94664.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] gi|123243747|emb|CAM18271.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] gi|148684064|gb|EDL16011.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] gi|148684065|gb|EDL16012.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] gi|148684066|gb|EDL16013.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] Length = 136 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|323650074|gb|ADX97123.1| mitochondrial ATP synthase f0 complex subunit c isoform 1 [Perca flavescens] Length = 137 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 122 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 123 GLFCLMVAFLILF 135 >gi|260908342|gb|ACX53892.1| ATP synthase c-subunit [Rhipicephalus sanguineus] Length = 149 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 79 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 134 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 135 GLFCLMMAFLLLF 147 >gi|194217074|ref|XP_001499319.2| PREDICTED: similar to H(+)-transporting ATP synthase [Equus caballus] Length = 136 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|47230530|emb|CAF99723.1| unnamed protein product [Tetraodon nigroviridis] Length = 89 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 19 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 74 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 75 GLFCLMVAFLILF 87 >gi|166796912|gb|AAI59383.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus (Silurana) tropicalis] Length = 142 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 128 GLFCLMVAFLILF 140 >gi|295792294|gb|ADG29151.1| mitochondrial ATP synthase lipid-binding protein [Epinephelus coioides] gi|328677271|gb|AEB31358.1| mitochondrial ATP synthase F0 complex subunit c isoform 3 [Epinephelus bruneus] Length = 139 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 125 GLFCLMVAFLILF 137 >gi|57164393|ref|NP_001009396.1| ATP synthase lipid-binding protein, mitochondrial precursor [Ovis aries] gi|461590|sp|P17605|AT5G1_SHEEP RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|1201|emb|CAA49529.1| H(+)-transporting ATP synthase [Ovis aries] Length = 136 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|308323199|gb|ADO28736.1| mitochondrial ATP synthase lipid-binding protein [Ictalurus punctatus] Length = 139 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 125 GLFCLMVAFLILF 137 >gi|269925190|ref|YP_003321813.1| ATP synthase F0, C subunit [Thermobaculum terrenum ATCC BAA-798] gi|269788850|gb|ACZ40991.1| ATP synthase F0, C subunit [Thermobaculum terrenum ATCC BAA-798] Length = 103 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 5/70 (7%) Query: 22 AKYVAVGMACLGMGL-VALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A +A+G+ LG GL + LAV + RNP A+ +T ++I A +AE++ ++ Sbjct: 37 ASAIAIGVGALGPGLGIGLAVRG----AMEATGRNPEASGDIRTTLIIGAALAEAVAIYA 92 Query: 81 LLVVMLLLFV 90 L +L+LF Sbjct: 93 FLTALLILFT 102 >gi|225713172|gb|ACO12432.1| ATP synthase lipid-binding protein, mitochondrial precursor [Lepeophtheirus salmonis] gi|225713890|gb|ACO12791.1| ATP synthase lipid-binding protein, mitochondrial precursor [Lepeophtheirus salmonis] gi|290563012|gb|ADD38900.1| ATP synthase lipid-binding protein, mitochondrial [Lepeophtheirus salmonis] Length = 122 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 52 AAKFIGAGAATVGVAGSGAGIGSVFGSLVIGYARNP----SLKQQLFSYAILGFALSEAM 107 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 108 GLFCLMMAFLLLF 120 >gi|126308255|ref|XP_001367285.1| PREDICTED: similar to P1 subunit [Monodelphis domestica] Length = 136 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 122 GLFCLMVAFLILFAL 136 >gi|109074231|ref|XP_001104905.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] Length = 135 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 65 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 120 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 121 GLFCLMVAFLILF 133 >gi|30584765|gb|AAP36635.1| Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [synthetic construct] gi|61372842|gb|AAX43922.1| ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [synthetic construct] gi|61372846|gb|AAX43923.1| ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [synthetic construct] Length = 137 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|306774121|ref|NP_001182424.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Macaca mulatta] Length = 135 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 65 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 120 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 121 GLFCLMVAFLILF 133 >gi|209733972|gb|ACI67855.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 156 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 86 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 141 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 142 GLFCLMVAFLILFAM 156 >gi|126277462|ref|XP_001376036.1| PREDICTED: similar to P2 gene for c subunit of mitochondrial ATP synthase [Monodelphis domestica] Length = 104 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A + M + +F + + G RNP +L FA ++E++GLF Sbjct: 35 AAKFIGAGAATVEMAGSGTGIGTVFGSLIIGYARNPSLKQQLFYAILGFA-LSEAMGLFC 93 Query: 81 LLVVMLLLFVI 91 L+V L LFV+ Sbjct: 94 LMVTFLSLFVM 104 >gi|73975799|ref|XP_850856.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit C) [Canis familiaris] Length = 197 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 127 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 182 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 183 GLFCLMVAFLILFAM 197 >gi|73966257|ref|XP_851984.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 isoform 2 [Canis familiaris] gi|73966259|ref|XP_548181.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 isoform 1 [Canis familiaris] Length = 136 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|48101426|ref|XP_392672.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Apis mellifera] gi|66531719|ref|XP_623661.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Apis mellifera] gi|328778738|ref|XP_003249541.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Apis mellifera] gi|328778740|ref|XP_003249542.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Apis mellifera] gi|328778742|ref|XP_003249543.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Apis mellifera] Length = 142 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGSVFGSLIVGYARNP----SLKQQLFSYAILGFALSEAM 127 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 128 GLFCLMMAFLLLF 140 >gi|209737618|gb|ACI69678.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 125 GLFCLMVAFLILF 137 >gi|74204278|dbj|BAE39897.1| unnamed protein product [Mus musculus] Length = 136 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|301762942|ref|XP_002916871.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] gi|285804524|gb|ADC35740.1| ATP5G1 [Ailuropoda melanoleuca] gi|285804526|gb|ADC35741.1| ATP5G1 [Ailuropoda melanoleuca] Length = 136 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|291405855|ref|XP_002719355.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 [Oryctolagus cuniculus] Length = 136 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|161087399|gb|ABX56859.1| ATP synthase subunit 9 mitochondrial precursor [Litopenaeus vannamei] Length = 116 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 46 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 101 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 102 GLFCLMMAFLLLF 114 >gi|51011614|gb|AAT92216.1| ATP synthase c-subunit [Ixodes pacificus] Length = 152 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 82 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 137 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 138 GLFCLMMAFLLLF 150 >gi|327275826|ref|XP_003222673.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Anolis carolinensis] gi|327275828|ref|XP_003222674.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Anolis carolinensis] gi|327275830|ref|XP_003222675.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Anolis carolinensis] Length = 135 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 65 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 120 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 121 GLFCLMVAFLILF 133 >gi|68534968|ref|NP_001020389.1| ATP synthase lipid-binding protein, mitochondrial [Sus scrofa] gi|55274178|gb|AAV48969.1| mitochondrial H+ transporting ATP synthase subunit c isoform 1 [Sus scrofa] Length = 136 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSMIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|147903501|ref|NP_001085928.1| MGC82833 protein [Xenopus laevis] gi|49119456|gb|AAH73551.1| MGC82833 protein [Xenopus laevis] Length = 130 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 115 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 116 GLFCLMVAFLILF 128 >gi|296202556|ref|XP_002748508.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Callithrix jacchus] gi|296202558|ref|XP_002748509.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Callithrix jacchus] Length = 136 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|225710294|gb|ACO10993.1| ATP synthase lipid-binding protein, mitochondrial precursor [Caligus rogercresseyi] Length = 122 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 52 AAKFIGAGAATVGVAGSGAGIGSVFGSLVIGYARNP----SLKQQLFSYAILGFALSEAM 107 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 108 GLFCLMMAFLLLF 120 >gi|224086930|ref|XP_002187275.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), partial [Taeniopygia guttata] Length = 94 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 24 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 79 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 80 GLFCLMVAFLILF 92 >gi|196476769|gb|ACG76249.1| ATP synthase c-subunit [Amblyomma americanum] Length = 147 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 77 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 132 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 133 GLFCLMMAFLLLF 145 >gi|58039572|ref|YP_191536.1| ATP synthase C chain [Gluconobacter oxydans 621H] gi|81352056|sp|Q5FRW6|ATPL_GLUOX RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|58001986|gb|AAW60880.1| ATP synthase C chain [Gluconobacter oxydans 621H] Length = 85 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 4/71 (5%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH--KTEVLIFAVIAESLGL 78 AA+ + G+A + V + + NIF+T +S RNP A+ H +L FA + E++ L Sbjct: 16 AARDLGAGIAVFALAGVGMGLGNIFSTLISSVARNP-ASRPHVFGIGMLGFA-LTEAVAL 73 Query: 79 FLLLVVMLLLF 89 F LL+ L+LF Sbjct: 74 FALLIAFLILF 84 >gi|4588722|gb|AAD26193.1|AF114952_1 ATP synthase subunit 9 [Naumovia dairenensis] Length = 76 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 20/72 (27%), Positives = 39/72 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LLF + Sbjct: 65 CLMISFMLLFAV 76 >gi|327263846|ref|XP_003216728.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Anolis carolinensis] Length = 140 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 126 GLFCLMVAFLILF 138 >gi|218508793|ref|ZP_03506671.1| F0F1 ATP synthase subunit C [Rhizobium etli Brasil 5] Length = 37 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 18/26 (69%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASAH 62 AL + NIF +YLSGA RNP AA + Sbjct: 4 TALGLGNIFGSYLSGALRNPSAADSQ 29 >gi|67083899|gb|AAY66884.1| ATP synthase C subunit [Ixodes scapularis] Length = 152 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 82 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 137 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 138 GLFCLMMAFLLLF 150 >gi|307200014|gb|EFN80360.1| ATP synthase lipid-binding protein, mitochondrial [Harpegnathos saltator] Length = 138 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|296200751|ref|XP_002747736.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 131 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 13/73 (17%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ VG+A G G + +F + +SG RNP + K ++ + ++ +E Sbjct: 66 AAKFIGVGVAGSGTG-----IGTVFGSLISGYGRNP----SLKQQLFCYGILGFALSEVT 116 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 117 GLFCLMVAFLILF 129 >gi|19424234|ref|NP_598240.1| ATP synthase lipid-binding protein, mitochondrial precursor [Rattus norvegicus] gi|543879|sp|Q06646|AT5G2_RAT RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|286202|dbj|BAA02426.1| ATP synthase subunit c precursor [Rattus norvegicus] gi|124504543|gb|AAI28727.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus] gi|149031904|gb|EDL86816.1| rCG50567, isoform CRA_a [Rattus norvegicus] gi|149031905|gb|EDL86817.1| rCG50567, isoform CRA_a [Rattus norvegicus] Length = 141 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|94498733|ref|ZP_01305283.1| H+-transporting two-sector ATPase, C subunit [Sphingomonas sp. SKA58] gi|294012249|ref|YP_003545709.1| F0F1-type ATP synthase subunit c [Sphingobium japonicum UT26S] gi|307294415|ref|ZP_07574259.1| H+transporting two-sector ATPase C subunit [Sphingobium chlorophenolicum L-1] gi|94421832|gb|EAT06883.1| H+-transporting two-sector ATPase, C subunit [Sphingomonas sp. SKA58] gi|292675579|dbj|BAI97097.1| F0F1-type ATP synthase subunit c [Sphingobium japonicum UT26S] gi|306880566|gb|EFN11783.1| H+transporting two-sector ATPase C subunit [Sphingobium chlorophenolicum L-1] Length = 75 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 31/50 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 V N+F+++L GA RNP AA + + I AE LGL ++ M+L+FV Sbjct: 25 VGNVFSSFLEGALRNPGAADGQQGRLFIGFAAAELLGLLAFVIAMILVFV 74 >gi|8392939|ref|NP_059007.1| ATP synthase lipid-binding protein, mitochondrial precursor [Rattus norvegicus] gi|543878|sp|Q06645|AT5G1_RAT RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|286200|dbj|BAA02425.1| ATP synthase subunit c precursor [Rattus norvegicus] gi|149053967|gb|EDM05784.1| rCG33837, isoform CRA_a [Rattus norvegicus] gi|149053968|gb|EDM05785.1| rCG33837, isoform CRA_a [Rattus norvegicus] gi|149053969|gb|EDM05786.1| rCG33837, isoform CRA_a [Rattus norvegicus] Length = 136 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|300870196|ref|YP_003785067.1| ATP synthase subunit C [Brachyspira pilosicoli 95/1000] gi|300687895|gb|ADK30566.1| ATP synthase, subunit C (H(+)-transporting two-sector ATPase) [Brachyspira pilosicoli 95/1000] Length = 73 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 3/72 (4%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +++ + G+A +G+GL + I + + G R P A+ +T +LI A + E +G Sbjct: 3 FAIIGATIGAGLAAIGVGL---GIGFIGSRAVEGIARQPEASGKIQTAMLISAALIEGVG 59 Query: 78 LFLLLVVMLLLF 89 LF L++ +L LF Sbjct: 60 LFALVICILALF 71 >gi|313233400|emb|CBY24515.1| unnamed protein product [Oikopleura dioica] gi|313246959|emb|CBY35805.1| unnamed protein product [Oikopleura dioica] Length = 103 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 AAK++ G A +G+ + +F + + G RNP A +L FA ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFA-LSEAMGLF 91 Query: 80 LLLVVMLLLFVI 91 L+V L+LF + Sbjct: 92 CLMVAFLILFAL 103 >gi|313227152|emb|CBY22299.1| unnamed protein product [Oikopleura dioica] gi|313245798|emb|CBY34791.1| unnamed protein product [Oikopleura dioica] Length = 103 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 AAK++ G A +G+ + +F + + G RNP A +L FA ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFA-LSEAMGLF 91 Query: 80 LLLVVMLLLFVI 91 L+V L+LF + Sbjct: 92 CLMVAFLILFAL 103 >gi|47217003|emb|CAG01631.1| unnamed protein product [Tetraodon nigroviridis] Length = 136 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|119933584|ref|XP_001256922.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Bos taurus] Length = 170 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 100 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 155 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 156 GLFCLMVAFLILFAV 170 >gi|109096969|ref|XP_001106939.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 1 [Macaca mulatta] Length = 141 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|13385960|ref|NP_080744.1| ATP synthase lipid-binding protein, mitochondrial precursor [Mus musculus] gi|309263385|ref|XP_003086035.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Mus musculus] gi|309263387|ref|XP_003086036.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Mus musculus] gi|309263389|ref|XP_003086037.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Mus musculus] gi|309265804|ref|XP_003086621.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Mus musculus] gi|309268674|ref|XP_003084720.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Mus musculus] gi|309272952|ref|XP_001472331.2| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Mus musculus] gi|51338784|sp|P56383|AT5G2_MOUSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|12832200|dbj|BAB22005.1| unnamed protein product [Mus musculus] gi|12841492|dbj|BAB25231.1| unnamed protein product [Mus musculus] gi|12848921|dbj|BAB28137.1| unnamed protein product [Mus musculus] gi|13905060|gb|AAH06813.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] gi|26344626|dbj|BAC35962.1| unnamed protein product [Mus musculus] gi|51980721|gb|AAH81437.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] gi|77415523|gb|AAI06139.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] gi|148669715|gb|EDL01662.1| mCG118574 [Mus musculus] gi|148672010|gb|EDL03957.1| mCG17597 [Mus musculus] gi|148692417|gb|EDL24364.1| mCG113310 [Mus musculus] Length = 146 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 76 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 131 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 132 GLFCLMVAFLILF 144 >gi|297493588|gb|ADI40516.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C2 [Miniopterus schreibersii] Length = 114 Score = 36.2 bits (82), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 45 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 100 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 101 GLFCLMVAFLILF 113 >gi|268370179|ref|NP_001161269.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] gi|268370183|ref|NP_001161270.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] gi|268370187|ref|NP_001161272.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] gi|268370189|ref|NP_001161273.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] Length = 137 Score = 36.2 bits (82), Expect = 1.3, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 122 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 123 GLFCLMMAFLLLF 135 >gi|306991573|pdb|2XND|J Chain J, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991574|pdb|2XND|K Chain K, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991575|pdb|2XND|L Chain L, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991576|pdb|2XND|M Chain M, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991577|pdb|2XND|N Chain N, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991578|pdb|2XND|O Chain O, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991579|pdb|2XND|P Chain P, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991580|pdb|2XND|Q Chain Q, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 72 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 4 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 59 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 60 GLFCLMVAFLILF 72 >gi|332030330|gb|EGI70073.1| ATP synthase lipid-binding protein, mitochondrial [Acromyrmex echinatior] Length = 138 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|157112701|ref|XP_001657606.1| ATPase subunit, putative [Aedes aegypti] gi|108877954|gb|EAT42179.1| ATPase subunit, putative [Aedes aegypti] Length = 125 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 55 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 110 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 111 GLFCLMMAFLLLF 123 >gi|148237171|ref|NP_001088407.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Xenopus laevis] gi|54261572|gb|AAH84317.1| LOC495263 protein [Xenopus laevis] Length = 130 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 115 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 116 GLFCLMVAFLILF 128 >gi|301776104|ref|XP_002923472.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] Length = 145 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 75 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 130 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 131 GLFCLMVAFLILF 143 >gi|326935772|ref|XP_003213941.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Meleagris gallopavo] Length = 130 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 115 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 116 GLFCLMVAFLILF 128 >gi|269146606|gb|ACZ28249.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Simulium nigrimanum] Length = 136 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 122 GLFCLMMAFLLLF 134 >gi|307181254|gb|EFN68944.1| ATP synthase lipid-binding protein, mitochondrial [Camponotus floridanus] Length = 134 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++ Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 119 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 120 GLFCLMMAFLLLF 132 >gi|195341714|ref|XP_002037451.1| GM12097 [Drosophila sechellia] gi|194131567|gb|EDW53610.1| GM12097 [Drosophila sechellia] Length = 138 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATIGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|52346136|ref|NP_001005112.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Xenopus (Silurana) tropicalis] gi|49904303|gb|AAH77049.1| MGC89969 protein [Xenopus (Silurana) tropicalis] gi|115530779|emb|CAL49358.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Xenopus (Silurana) tropicalis] Length = 130 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 115 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 116 GLFCLMVAFLILF 128 >gi|114644464|ref|XP_001137325.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 2 [Pan troglodytes] gi|114644466|ref|XP_001137401.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 3 [Pan troglodytes] gi|332839211|ref|XP_003313697.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|332839217|ref|XP_003313700.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|461592|sp|Q06055|AT5G2_HUMAN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|38432|emb|CAA49533.1| P2 gene for c subunit of mitochondrial ATP synthase [Homo sapiens] gi|285910|dbj|BAA02421.1| ATP synthase subunit c precursor [Homo sapiens] gi|18088565|gb|AAH20826.1| ATP5G2 protein [Homo sapiens] gi|119617132|gb|EAW96726.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_b [Homo sapiens] gi|123980928|gb|ABM82293.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [synthetic construct] gi|123995743|gb|ABM85473.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [synthetic construct] Length = 141 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|296223453|ref|XP_002757659.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 160 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 90 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 145 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 146 GLFCLMVAFLILF 158 >gi|332206028|ref|XP_003252091.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 4 [Nomascus leucogenys] Length = 141 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|197260868|gb|ACH56931.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Simulium vittatum] Length = 136 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 122 GLFCLMMAFLLLF 134 >gi|28603708|ref|NP_788786.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|114680|sp|P07926|AT5G2_BOVIN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|99|emb|CAA28846.1| P2 subunit [Bos taurus] gi|28189645|dbj|BAC56437.1| similar to mit-ATP synthase proteolipid P2 subunit precursor [Bos taurus] gi|84202593|gb|AAI11614.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Bos taurus] gi|296487906|gb|DAA30019.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|224831|prf||1202261B ATP synthase proteolipid P2 Length = 143 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 73 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 128 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 129 GLFCLMVAFLILF 141 >gi|57164181|ref|NP_001009468.1| ATP synthase lipid-binding protein, mitochondrial precursor [Ovis aries] gi|461593|sp|Q06056|AT5G2_SHEEP RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|1203|emb|CAA49530.1| H(+)-transporting ATP synthase [Ovis aries] Length = 143 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 73 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 128 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 129 GLFCLMVAFLILF 141 >gi|296210152|ref|XP_002751853.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 112 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 42 AAKFIGAGAATVGVASSGAGIGTVFGSLIIGYARNPSLKQQLFSYTILGFALSEAMGLFC 101 Query: 81 LLVVMLLLF 89 L+V L+LF Sbjct: 102 LMVAFLILF 110 >gi|302850096|ref|XP_002956576.1| hypothetical protein VOLCADRAFT_83693 [Volvox carteri f. nagariensis] gi|300258103|gb|EFJ42343.1| hypothetical protein VOLCADRAFT_83693 [Volvox carteri f. nagariensis] Length = 169 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 100 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 159 Query: 81 LLVVMLLLF 89 LLVV L+LF Sbjct: 160 LLVVFLILF 168 >gi|1753202|dbj|BAA13165.1| ATP synthase subunit [Caenorhabditis elegans] gi|2340836|dbj|BAA21841.1| ATP synthase subunit [Caenorhabditis elegans] Length = 92 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAKY+ G A +G+ + N+F + G RNP + K ++ +A+ ++E++ Sbjct: 22 AAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNP----SLKQQLFSYAILGFALSEAM 77 Query: 77 GLFLLLVVMLLLFVI 91 GLF L + ++LF + Sbjct: 78 GLFCLTMGFMILFAL 92 >gi|328672363|ref|YP_004362952.1| F-type H+-transporting ATPase subunit c [Pichia pastoris CBS 7435] gi|328354782|emb|CCA41178.1| F-type H+-transporting ATPase subunit c [Pichia pastoris CBS 7435] Length = 76 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ +A +G+ + ++ +F ++G RNP + + FA+ ++E+ Sbjct: 5 LAAKYIGAAIATIGLTGAGIGIAIVFAALINGTSRNP----GLRNTLFPFAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 61 TGLFCLMISFLLLY 74 >gi|23752286|ref|NP_705624.1| ATP synthase F0 subunit 9 [Schizosaccharomyces japonicus] gi|23506670|gb|AAN37917.1| ATP synthase F0 subunit 9 [Schizosaccharomyces japonicus] Length = 74 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 19/69 (27%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A KYV G+A +G+ + + IF++ ++G RNP + ++ + E+ GLF Sbjct: 4 AMKYVGAGLATIGVSGAGVGIGLIFSSLINGTSRNPSLRPQLFSMAILGFALTEATGLFC 63 Query: 81 LLVVMLLLF 89 L++ L+++ Sbjct: 64 LMLAFLIIY 72 >gi|150456406|ref|YP_001331014.1| ATP synthase, subunit 9 [Vanderwaltozyma polyspora] gi|218563489|sp|A6H4Q2|ATP9_VANPO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|149999733|emb|CAN85575.1| ATP synthase, subunit 9 [Vanderwaltozyma polyspora] Length = 76 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 43/73 (58%), Gaps = 2/73 (2%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGL 78 LAAKY+ G++ +G+ + ++ +F ++G RNP + +L FA ++E+ GL Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSLRETLFPMAILGFA-LSEATGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LL++ + Sbjct: 64 FCLMISFLLIYAV 76 >gi|197101063|ref|NP_001125678.1| ATP synthase lipid-binding protein, mitochondrial precursor [Pongo abelii] gi|68565129|sp|Q5RAP9|AT5G2_PONAB RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|55728845|emb|CAH91161.1| hypothetical protein [Pongo abelii] Length = 141 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|158514029|sp|A1XQS5|AT5G1_PIG RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|117660669|gb|ABK55631.1| mitochondrial ATP5G1 [Sus scrofa] Length = 136 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA----ESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ E++ Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALFEAM 121 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 122 GLFCLMVAFLILF 134 >gi|56417588|gb|AAV90735.1| mitochondrial ATP synthase lipid binding protein precursor [Aedes albopictus] Length = 138 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|332839209|ref|XP_003313696.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] Length = 196 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 126 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 181 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 182 GLFCLMVAFLILF 194 >gi|157133453|ref|XP_001656257.1| ATPase subunit, putative [Aedes aegypti] gi|94468368|gb|ABF18033.1| mitochondrial ATP synthase lipid binding protein precursor [Aedes aegypti] gi|108870848|gb|EAT35073.1| ATPase subunit, putative [Aedes aegypti] Length = 138 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|164421217|ref|YP_001648670.1| ATP synthase F0 subunit 9 [Igernella notabilis] gi|158939029|gb|ABW83950.1| ATP synthase F0 subunit 9 [Igernella notabilis] Length = 78 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K++ G A +G+ + +F + G RNP T ++ I+E++GLF Sbjct: 8 ASKFIGAGAATIGVAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|170044391|ref|XP_001849833.1| mitochondrial ATP synthase lipid binding protein [Culex quinquefasciatus] gi|167867565|gb|EDS30948.1| mitochondrial ATP synthase lipid binding protein [Culex quinquefasciatus] Length = 138 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|223029543|gb|ACM78493.1| MIP02330p [Drosophila melanogaster] Length = 134 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 119 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 120 GLFCLMMAFLLLF 132 >gi|38048075|gb|AAR09940.1| similar to Drosophila melanogaster CG1746 [Drosophila yakuba] Length = 129 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 59 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 114 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 115 GLFCLMMAFLLLF 127 >gi|289743209|gb|ADD20352.1| mitochondrial ATP synthase lipid binding protein precursor [Glossina morsitans morsitans] gi|289743213|gb|ADD20354.1| mitochondrial F1F0-ATP synthase subunit C/ATP9/proteolipid [Glossina morsitans morsitans] Length = 138 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|85794840|ref|NP_005167.2| ATP synthase lipid-binding protein, mitochondrial isoform b precursor [Homo sapiens] gi|114644458|ref|XP_509102.2| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 5 [Pan troglodytes] gi|332839205|ref|XP_003313694.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|332839213|ref|XP_003339277.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|332839215|ref|XP_003313698.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|119617131|gb|EAW96725.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_a [Homo sapiens] Length = 198 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 183 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 184 GLFCLMVAFLILF 196 >gi|12585194|sp|Q9U505|ATP9_MANSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|6560655|gb|AAF16705.1|AF117583_1 ATP synthase subunit c [Manduca sexta] Length = 131 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 61 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 116 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 117 GLFCLMMAFLLLF 129 >gi|158288718|ref|XP_001688294.1| AGAP000523-PA [Anopheles gambiae str. PEST] gi|114864975|gb|ABI83790.1| mitochondrial F1F0-ATP synthase subunit c [Anopheles funestus] gi|157018704|gb|EDO64318.1| AGAP000523-PA [Anopheles gambiae str. PEST] Length = 138 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|29126609|ref|NP_803512.1| ATP synthase F0 subunit 9 [Monoblepharella sp. JEL15] gi|29029507|gb|AAO64957.1| ATP synthase F0 subunit 9 [Monoblepharella sp. JEL15] Length = 74 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLFL 80 K + G+A + +G A+ + IF+ ++G RNP + +L FA + E++GLF Sbjct: 5 GKLIGAGIAAVALGGAAMGIGTIFSALIAGTSRNPSLRRELFQMAILGFA-LTEAMGLFA 63 Query: 81 LLVVMLLLF 89 L++ +++L+ Sbjct: 64 LMMALIILY 72 >gi|332206022|ref|XP_003252088.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Nomascus leucogenys] gi|332206024|ref|XP_003252089.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Nomascus leucogenys] gi|332206030|ref|XP_003252092.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 5 [Nomascus leucogenys] gi|332206032|ref|XP_003252093.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 6 [Nomascus leucogenys] Length = 198 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 183 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 184 GLFCLMVAFLILF 196 >gi|109096967|ref|XP_001107007.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 2 [Macaca mulatta] Length = 198 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 183 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 184 GLFCLMVAFLILF 196 >gi|24651599|ref|NP_651852.1| CG1746, isoform A [Drosophila melanogaster] gi|24651601|ref|NP_733422.1| CG1746, isoform B [Drosophila melanogaster] gi|24651603|ref|NP_733423.1| CG1746, isoform C [Drosophila melanogaster] gi|194905019|ref|XP_001981105.1| GG11879 [Drosophila erecta] gi|7302028|gb|AAF57131.1| CG1746, isoform B [Drosophila melanogaster] gi|23172756|gb|AAN14267.1| CG1746, isoform A [Drosophila melanogaster] gi|23172757|gb|AAN14268.1| CG1746, isoform C [Drosophila melanogaster] gi|41058227|gb|AAR99150.1| GM13193p [Drosophila melanogaster] gi|190655743|gb|EDV52975.1| GG11879 [Drosophila erecta] Length = 138 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|195449282|ref|XP_002072006.1| GK22551 [Drosophila willistoni] gi|194168091|gb|EDW82992.1| GK22551 [Drosophila willistoni] Length = 138 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|91091934|ref|XP_967645.1| PREDICTED: similar to GA14517-PA [Tribolium castaneum] gi|270001304|gb|EEZ97751.1| hypothetical protein TcasGA2_TC011455 [Tribolium castaneum] Length = 140 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 126 GLFCLMMAFLLLF 138 >gi|125772503|ref|XP_001357564.1| GA14517 [Drosophila pseudoobscura pseudoobscura] gi|194744513|ref|XP_001954738.1| GF16589 [Drosophila ananassae] gi|195062153|ref|XP_001996145.1| GH14335 [Drosophila grimshawi] gi|195159000|ref|XP_002020371.1| GL13949 [Drosophila persimilis] gi|54637296|gb|EAL26698.1| GA14517 [Drosophila pseudoobscura pseudoobscura] gi|190627775|gb|EDV43299.1| GF16589 [Drosophila ananassae] gi|193891937|gb|EDV90803.1| GH14335 [Drosophila grimshawi] gi|194117140|gb|EDW39183.1| GL13949 [Drosophila persimilis] Length = 138 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|291280110|ref|YP_003496945.1| hypothetical protein DEFDS_1734 [Deferribacter desulfuricans SSM1] gi|290754812|dbj|BAI81189.1| hypothetical protein [Deferribacter desulfuricans SSM1] Length = 106 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Query: 9 ATFAAANGYYSLA---AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 A+ AA G Y A A + +G+A G GL + + G RNP A+ T Sbjct: 23 ASEGAAGGNYKWAIYLAAGLGIGIAAFGTGL---GQGRAVGSAVEGISRNPSASGKIMTS 79 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFVI 91 +++ + ESL ++ L++ ++LLFV+ Sbjct: 80 MIVGLAMIESLAIYALVICLILLFVV 105 >gi|50593533|ref|NP_001002031.1| ATP synthase lipid-binding protein, mitochondrial isoform a precursor [Homo sapiens] gi|114644462|ref|XP_001137490.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 4 [Pan troglodytes] gi|332839207|ref|XP_003313695.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] Length = 157 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 87 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 142 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 143 GLFCLMVAFLILF 155 >gi|195505392|ref|XP_002099484.1| GE23327 [Drosophila yakuba] gi|194185585|gb|EDW99196.1| GE23327 [Drosophila yakuba] Length = 138 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|15187310|ref|NP_150642.1| ATP synthase F0 subunit 9 [Spizellomyces punctatus] gi|15100095|gb|AAK84258.1|AF404304_1 ATP synthase F0 subunit 9 [Spizellomyces punctatus] Length = 74 Score = 35.8 bits (81), Expect = 2.0, Method: Compositional matrix adjust. Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGL 78 +AAK + G+A + + A+ V IF + G RNP T +L FA + E+LGL Sbjct: 3 MAAKLIGAGLATIALAGAAVGVGLIFAALIQGTSRNPSLRKELFNTAILGFA-LTEALGL 61 Query: 79 FLLLVVMLLLF 89 F L++ ++ L+ Sbjct: 62 FALMMALIFLY 72 >gi|195112483|ref|XP_002000802.1| GI10430 [Drosophila mojavensis] gi|193917396|gb|EDW16263.1| GI10430 [Drosophila mojavensis] Length = 138 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|332206026|ref|XP_003252090.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] Length = 157 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 87 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 142 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 143 GLFCLMVAFLILF 155 >gi|71996409|ref|NP_001022966.1| hypothetical protein Y82E9BR.3 [Caenorhabditis elegans] gi|268571193|ref|XP_002640963.1| Hypothetical protein CBG11706 [Caenorhabditis briggsae] gi|308479989|ref|XP_003102202.1| hypothetical protein CRE_05884 [Caenorhabditis remanei] gi|75021564|sp|Q9BKS0|AT5G_CAEEL RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase c subunit; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|308191401|sp|A8XDX2|AT5G_CAEBR RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|13435326|gb|AAK26152.1| Hypothetical protein Y82E9BR.3 [Caenorhabditis elegans] gi|187030080|emb|CAP30867.1| hypothetical protein CBG_11706 [Caenorhabditis briggsae AF16] gi|308262128|gb|EFP06081.1| hypothetical protein CRE_05884 [Caenorhabditis remanei] Length = 116 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAKY+ G A +G+ + N+F + G RNP + K ++ +A+ ++E++ Sbjct: 46 AAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNP----SLKQQLFSYAILGFALSEAM 101 Query: 77 GLFLLLVVMLLLFVI 91 GLF L + ++LF + Sbjct: 102 GLFCLTMGFMILFAL 116 >gi|195394561|ref|XP_002055911.1| GJ10646 [Drosophila virilis] gi|194142620|gb|EDW59023.1| GJ10646 [Drosophila virilis] Length = 138 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|114328532|ref|YP_745689.1| ATP synthase C chain [Granulibacter bethesdensis CGDNIH1] gi|122326514|sp|Q0BQY6|ATPL_GRABC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|114316706|gb|ABI62766.1| ATP synthase C chain [Granulibacter bethesdensis CGDNIH1] Length = 74 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASA-HKTEVLIFAVIAESLGLF 79 AAK + G++ + + V L + NIF + ++ RNP + +L FA + E++ LF Sbjct: 5 AAKALGAGISVIALAGVGLGIGNIFASLIASVARNPSSRDQVFSIGILGFA-LTEAVALF 63 Query: 80 LLLVVMLLLF 89 LL+ L+LF Sbjct: 64 ALLIAFLILF 73 >gi|195998197|ref|XP_002108967.1| conserved hypothetical protein [Trichoplax adhaerens] gi|190589743|gb|EDV29765.1| conserved hypothetical protein [Trichoplax adhaerens] Length = 116 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 46 AAKFIGAGAATVGVAGSGAGIGTVFGSLVIGYARNP----SLKQQLFSYAILGFALSEAM 101 Query: 77 GLFLLLVVMLLLFVI 91 GLF L++ L+LF + Sbjct: 102 GLFCLMMAFLILFAL 116 >gi|21263118|ref|NP_644685.1| ATP synthase subunit 9 [Saccharomyces castellii] gi|4588717|gb|AAD26191.1|AF114949_1 ATP synthase subunit 9 [Naumovia castellii] gi|4588719|gb|AAD26192.1|AF114950_1 ATP synthase subunit 9 [Naumovia castellii] gi|21105291|gb|AAM34594.1|AF437291_7 ATP synthase subunit 9 [Naumovia castellii] Length = 77 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 19/71 (26%), Positives = 39/71 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFV 90 L++ +L+F+ Sbjct: 65 CLMISFMLMFM 75 >gi|299830439|ref|YP_003734810.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|299830500|ref|YP_003734871.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269810816|gb|ACZ43845.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269810877|gb|ACZ43906.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269812129|gb|ACZ44427.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269812190|gb|ACZ44488.1| ATP synthase F0 subunit 9 [Pythium ultimum] Length = 75 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 ++K++ G+A +G+ + + ++F + + G RNP +T +L FA + E++ LF Sbjct: 5 SSKFIGAGLATIGLAGAGVGIGSVFGSLVLGISRNPSLQQELTRTAILGFA-LTEAIALF 63 Query: 80 LLLVVMLLLF 89 L++ L+LF Sbjct: 64 CLMMAFLILF 73 >gi|159486952|ref|XP_001701500.1| F1F0 ATP synthase subunit 9, isoform B [Chlamydomonas reinhardtii] gi|158271561|gb|EDO97377.1| F1F0 ATP synthase subunit 9, isoform B [Chlamydomonas reinhardtii] Length = 157 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 88 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 147 Query: 81 LLVVMLLLF 89 LLVV L+LF Sbjct: 148 LLVVFLILF 156 >gi|74325193|ref|YP_316613.1| ATPase subunit 9 [Thalassiosira pseudonana] gi|74100259|gb|AAZ99420.1| ATPase subunit 9 [Thalassiosira pseudonana] Length = 75 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASA-HKTEVLIFAVIAESLGLF 79 AAK+V G+A +G+ + + +F + G RNP K +L FA + E++ LF Sbjct: 5 AAKFVGAGLATIGLAGAGVGIGTVFGALVIGVSRNPSLKDELFKLAILGFA-LTEAIALF 63 Query: 80 LLLVVMLLLF 89 L++ L+LF Sbjct: 64 SLMMAFLILF 73 >gi|159487014|ref|XP_001701531.1| F1F0 ATP synthase subunit 9, isoform A [Chlamydomonas reinhardtii] gi|158271592|gb|EDO97408.1| F1F0 ATP synthase subunit 9, isoform A [Chlamydomonas reinhardtii] Length = 159 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 90 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 149 Query: 81 LLVVMLLLF 89 LLVV L+LF Sbjct: 150 LLVVFLILF 158 >gi|302850172|ref|XP_002956614.1| F1F0 ATP synthase, subunit C, mitochondrial [Volvox carteri f. nagariensis] gi|300258141|gb|EFJ42381.1| F1F0 ATP synthase, subunit C, mitochondrial [Volvox carteri f. nagariensis] Length = 168 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 99 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 158 Query: 81 LLVVMLLLF 89 LLVV L+LF Sbjct: 159 LLVVFLILF 167 >gi|294494193|gb|ADE92942.1| mitochondrial ATP synthase subunit c [Polytomella sp. Pringsheim 198.80] Length = 127 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 58 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 117 Query: 81 LLVVMLLLF 89 LLVV L+LF Sbjct: 118 LLVVFLILF 126 >gi|103486566|ref|YP_616127.1| H+-transporting two-sector ATPase, C subunit [Sphingopyxis alaskensis RB2256] gi|98976643|gb|ABF52794.1| H+-transporting two-sector ATPase, C subunit [Sphingopyxis alaskensis RB2256] Length = 75 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 30/51 (58%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+F ++L A RNP AA + + I AE LGL +V M+LLFV+ Sbjct: 25 VGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELLGLLAFVVAMILLFVV 75 >gi|74272627|gb|ABA01109.1| mitochondrial ATP synthase F0 subunit 9 [Chlamydomonas incerta] Length = 159 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 90 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 149 Query: 81 LLVVMLLLF 89 LLVV L+LF Sbjct: 150 LLVVFLILF 158 >gi|74002223|ref|XP_851540.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit C) [Canis familiaris] Length = 131 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 61 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFAFSEAM 116 Query: 77 GLFLLLVVMLLLF 89 GLF L+V +LF Sbjct: 117 GLFCLMVAFFILF 129 >gi|328847399|gb|EGF96908.1| hypothetical protein MELLADRAFT_91983 [Melampsora larici-populina 98AG31] Length = 73 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK + G+A +G+ + + +F ++G RNP A + ++ +A++ +E+ Sbjct: 4 AAKIIGSGLATIGLTGAGVGIGVVFQGLITGTARNP----AIRNQLFSYAILGFALSEAT 59 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 60 GLFALMISFLLLY 72 >gi|29825397|gb|AAO92282.1| ATP synthase c-subunit [Dermacentor variabilis] Length = 149 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 21/72 (29%), Positives = 41/72 (56%), Gaps = 8/72 (11%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESLG 77 AK++ G A +G+ + ++F + + G RNP + K ++ +A++ +E++G Sbjct: 80 AKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAMG 135 Query: 78 LFLLLVVMLLLF 89 LF L++ LLLF Sbjct: 136 LFCLMMAFLLLF 147 >gi|15088709|ref|NP_150118.1| ATP synthase F0 subunit 9 [Schizophyllum commune] gi|15077916|gb|AAK83402.1|AF402141_6 ATP synthase F0 subunit 9 [Schizophyllum commune] Length = 73 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAKY+ G+AC G+ + IF++ ++ RNP + ++ FA+ +AE+ Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGLIFSSLIASTARNP----QLRGQLFTFAILGFALAEAT 59 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 60 GLFSLMIAFLLLY 72 >gi|195996711|ref|XP_002108224.1| ATPase subunit 9 [Trichoplax adhaerens] gi|190589000|gb|EDV29022.1| ATPase subunit 9 [Trichoplax adhaerens] Length = 109 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 42/75 (56%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 39 AAKFIGAGAATVGVAGSGAGIGTVFGSLVIGYARNP----SLKQQLFSYAILGFALSEAM 94 Query: 77 GLFLLLVVMLLLFVI 91 GLF L++ L+LF + Sbjct: 95 GLFCLMMAFLILFAL 109 >gi|11466062|ref|NP_038221.1| ATPase subunit 9 [Pichia canadensis] gi|1352022|sp|P48881|ATP9_PICCA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|1000985|dbj|BAA06576.1| ATPase subunit 9 [Pichia canadensis] Length = 76 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ +A +G+ + ++ +F ++G RNP + + + FA+ ++E+ Sbjct: 5 LAAKYIGAAIATIGLLGAGIGIAIVFAALINGTSRNP----SLRNTLFPFAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 61 TGLFCLMISFLLLY 74 >gi|224924404|gb|ACN69152.1| mitochondrial F1F0-ATP synthase, subunit c/ATP9/proteolipid [Stomoxys calcitrans] Length = 138 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK+ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 68 AAKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 123 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLLF Sbjct: 124 GLFCLMMAFLLLF 136 >gi|324548154|gb|ADY49731.1| ATP synthase lipid-binding protein [Ascaris suum] Length = 115 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAKY+ G A +G+ + N+F + G RNP + K ++ +A+ ++E++ Sbjct: 45 AAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNP----SLKAQLFSYAILGFALSEAM 100 Query: 77 GLFLLLVVMLLLFVI 91 GLF L + ++LF + Sbjct: 101 GLFCLTMGFMILFAL 115 >gi|301057690|ref|ZP_07198763.1| ATP synthase F0, C subunit [delta proteobacterium NaphS2] gi|300448151|gb|EFK11843.1| ATP synthase F0, C subunit [delta proteobacterium NaphS2] Length = 126 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +GMA LG G+ + N L G RNP A T ++I + ESL ++ L++ Sbjct: 47 IGIGMAALGTGI---GMGNAINGALQGTARNPEAGGKIMTTMIIGLALIESLCIYALVIC 103 Query: 85 MLLLFVI 91 +L+F I Sbjct: 104 FILVFKI 110 >gi|56551564|ref|YP_162403.1| H+transporting two-sector ATPase subunit C [Zymomonas mobilis subsp. mobilis ZM4] gi|241761304|ref|ZP_04759392.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|260752836|ref|YP_003225729.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|56543138|gb|AAV89292.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis ZM4] gi|241374211|gb|EER63708.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|258552199|gb|ACV75145.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 79 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 18/46 (39%), Positives = 25/46 (54%) Query: 45 FTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 F +L A RNP AA + + I AE LGL ++ +LL+FV Sbjct: 33 FAGFLESALRNPAAADGQQGRLFIGFAAAELLGLLSFVISILLIFV 78 >gi|301353302|ref|YP_003795374.1| ATP9 [Phakopsora pachyrhizi] gi|301353463|ref|YP_003795684.1| ATP synthase subunit 9 [Phakopsora meibomiae] gi|251765315|gb|ACT15468.1| ATP9 [Phakopsora pachyrhizi] gi|253807587|gb|ACT36166.1| ATP synthase subunit 9 [Phakopsora meibomiae] Length = 73 Score = 34.7 bits (78), Expect = 3.9, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK + G+A +G+ + + +F ++G RNP A + ++ +A++ +E+ Sbjct: 4 AAKIIGSGLATIGLAGAGVGIGIVFQGLITGTARNP----AIRNQLFSYAILGFALSEAT 59 Query: 77 GLFLLLVVMLLLF 89 GLF L++ LLL+ Sbjct: 60 GLFALMMSFLLLY 72 >gi|315248829|ref|YP_004072416.1| ATP synthase subunit 9 [Pichia angusta] gi|314911726|gb|ADT63563.1| ATP synthase subunit 9 [Pichia angusta] Length = 76 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LAAKY+ +A +G+ + ++ +F ++G RNP + + + FA+ ++E+ Sbjct: 5 LAAKYIGAAIATIGLTGAGIGIAIVFAALINGTSRNP----SLRNTLFPFAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF ++ LLL+ Sbjct: 61 TGLFCTMISFLLLY 74 >gi|27376298|ref|NP_767827.1| F0F1 ATP synthase subunit C [Bradyrhizobium japonicum USDA 110] gi|27349438|dbj|BAC46452.1| FoF1 ATP synthase C chain [Bradyrhizobium japonicum USDA 110] Length = 76 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+AC+GMG + V IF YL+ A RNP AA ++ + E+LG+F Sbjct: 5 AAKLIGAGIACIGMGGAGVGVGVIFGNYLAAAVRNPSAAQGQFGNLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLFV 90 LL+ +LLLFV Sbjct: 65 LLIALLLLFV 74 >gi|402604|emb|CAA52876.1| ATP synthase subunit 9 [Pichia jadinii] Length = 76 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AES 75 LAAKY+ ++ +G+ + ++ +F ++G RNP + + + FA++ +E+ Sbjct: 5 LAAKYIGAAISTIGLLGAGIGIAIVFAALINGTSRNP----SLRNTLFPFAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF L+V LLL+ Sbjct: 61 TGLFCLMVSFLLLY 74 >gi|322491552|emb|CBZ26823.1| putative ATPase subunit 9 [Leishmania mexicana MHOM/GT/2001/U1103] Length = 106 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 33/67 (49%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 YV G+A + +G V L + IF L G R P ++ + E++GLF L+ Sbjct: 39 HYVGTGLAAIALGGVGLGIGTIFGCLLMGCARQPNLTKMLFNYAILGFALTEAIGLFALM 98 Query: 83 VVMLLLF 89 + L+LF Sbjct: 99 LAFLMLF 105 >gi|322492115|emb|CBZ27389.1| putative ATPase subunit 9 [Leishmania mexicana MHOM/GT/2001/U1103] gi|322492592|emb|CBZ27869.1| putative ATPase subunit 9 [Leishmania mexicana MHOM/GT/2001/U1103] Length = 106 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 20/67 (29%), Positives = 33/67 (49%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ G+A + +G V L + IF L G R P ++ + E++GLF L+ Sbjct: 39 HYIGTGLAAIALGGVGLGIGTIFGCLLMGCARQPNLTKMLFNYAILGFALTEAIGLFALM 98 Query: 83 VVMLLLF 89 + L+LF Sbjct: 99 LAFLMLF 105 >gi|109010281|ref|XP_001099796.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 1 [Macaca mulatta] gi|297279255|ref|XP_002801695.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 2 [Macaca mulatta] gi|297279257|ref|XP_002801696.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 3 [Macaca mulatta] Length = 141 Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AA++ G A +G+ + +F + + G RNP + K ++ +A++ +E++ Sbjct: 71 AAEFTGAGAATVGVAGSGAGIGTVFGSLIIGCARNP----SLKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L++F Sbjct: 127 GLFCLMVAFLIVF 139 >gi|29570610|ref|NP_818784.1| ATP synthase protein 9 [Candida glabrata CBS138] gi|51315959|sp|Q85Q98|ATP9_CANGA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|29500875|emb|CAD54425.1| ATP synthase protein 9 [Candida glabrata] Length = 76 Score = 34.3 bits (77), Expect = 5.1, Method: Compositional matrix adjust. Identities = 20/73 (27%), Positives = 41/73 (56%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ G++ +G+ + + +F ++G RNP + ++ ++E+ GL Sbjct: 4 ALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEATGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ +LLF + Sbjct: 64 FCLMISFMLLFAV 76 >gi|330929319|ref|XP_003302596.1| hypothetical protein PTT_14474 [Pyrenophora teres f. teres 0-1] gi|311321929|gb|EFQ89297.1| hypothetical protein PTT_14474 [Pyrenophora teres f. teres 0-1] Length = 140 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 8/72 (11%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESLGL 78 K G+A +G+ + + +F + G RNP + ++ +AV+ AE+ GL Sbjct: 72 KIQGAGLATIGLAGAGVGIGTVFGGLIQGVARNPSL----RGQLFQYAVLGFAFAEATGL 127 Query: 79 FLLLVVMLLLFV 90 F L++ LLL+V Sbjct: 128 FALMMSFLLLYV 139 >gi|256427311|ref|YP_003127074.1| Atp9p [Dekkera bruxellensis] gi|255761608|gb|ACU32844.1| Atp9p [Dekkera bruxellensis] Length = 76 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 8/74 (10%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAES 75 LA KY+ G+A +G+ + ++ +F ++G RNP K + +A+ ++E+ Sbjct: 5 LAGKYIGAGIATVGLLGAGIGIAIVFAALINGTSRNP----GIKDTIFPYAILGFALSEA 60 Query: 76 LGLFLLLVVMLLLF 89 GLF ++ LLL+ Sbjct: 61 TGLFCMMNAFLLLY 74 >gi|193786795|dbj|BAG52118.1| unnamed protein product [Homo sapiens] Length = 141 Score = 34.3 bits (77), Expect = 5.4, Method: Compositional matrix adjust. Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + +F + + G RNP K ++ +A++ +E++ Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPF----LKQQLFSYAILGFALSEAM 126 Query: 77 GLFLLLVVMLLLF 89 GLF L+V L+LF Sbjct: 127 GLFCLMVAFLILF 139 >gi|117660743|gb|ABK55635.1| mitochondrial ATP5G2 [Sus scrofa] Length = 155 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A+ ++E++ Sbjct: 85 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 140 Query: 77 GLFLLLVVMLLLFVI 91 GLF +V L+LF + Sbjct: 141 GLFCPMVAFLILFAM 155 >gi|86990311|ref|YP_492534.1| ATP synthase F0 subunit 9 [Hanseniaspora uvarum] gi|66473328|gb|AAY46309.1| ATP synthase F0 subunit 9 [Hanseniaspora uvarum] Length = 76 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 19/72 (26%), Positives = 38/72 (52%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L AKY+ G+A +G+ + ++ +F ++ RNP ++ ++ES GLF Sbjct: 5 LGAKYIGAGIAAVGLIGAGIGIAIVFAALINAVSRNPSMTKTLFPYAILGFSLSESTGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LL+ + Sbjct: 65 CLMISFILLYAV 76 >gi|189198047|ref|XP_001935361.1| ATP synthase subunit 9 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981309|gb|EDU47935.1| ATP synthase subunit 9 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 133 Score = 34.3 bits (77), Expect = 6.0, Method: Compositional matrix adjust. Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLFLL 81 K G+A +G+ + + +F + G RNP + VL FA AE+ GLF L Sbjct: 65 KIQGAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFA-FAEATGLFAL 123 Query: 82 LVVMLLLFV 90 ++ LLL+V Sbjct: 124 MMSFLLLYV 132 >gi|312378349|gb|EFR24952.1| hypothetical protein AND_10147 [Anopheles darlingi] Length = 183 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK V +A +G+ + + +F + + G RNP K ++ +A++ +E++ Sbjct: 113 AAKLVGASLATIGVAGSGVGIGTVFGSLMLGYARNP----PLKQQIFSYAILGFALSEAM 168 Query: 77 GLFLLLVVMLLLF 89 GLF L++ L+LF Sbjct: 169 GLFCLMMAFLMLF 181 >gi|13579|emb|CAA28962.1| unnamed protein product [Saccharomyces cerevisiae] Length = 76 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 2/71 (2%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGL 78 LAAKY+ G++ +G+ + ++ +F ++G RNP + +L FA ++E+ GL Sbjct: 5 LAAKYIGAGISTIGLLGGGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFA-LSEATGL 63 Query: 79 FLLLVVMLLLF 89 F L+V LLLF Sbjct: 64 FCLMVSFLLLF 74 >gi|325105223|ref|YP_004274877.1| ATP synthase F0 subcomplex C subunit [Pedobacter saltans DSM 12145] gi|324974071|gb|ADY53055.1| ATP synthase F0 subcomplex C subunit [Pedobacter saltans DSM 12145] Length = 71 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G G+ + N+ + + G R P AAS +T ++I A + E + LF ++V Sbjct: 8 IGAGLAVIGAGI---GIGNVGSKAMEGIARQPEAASKIQTAMIIAAALIEGVALFGVVVA 64 Query: 85 ML 86 +L Sbjct: 65 LL 66 >gi|158251733|ref|YP_001504347.1| ATP synthase A chain subunit 9 [Pleurotus ostreatus] gi|122893334|gb|ABM67606.1| ATP synthase A chain subunit 9 [Pleurotus ostreatus] Length = 73 Score = 33.9 bits (76), Expect = 6.7, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + IF++ ++ RNP + ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGLIFSSLIASTARNPQIRGQLFSYAILGFALAEATGLFS 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMIAFLLLY 72 >gi|169620263|ref|XP_001803543.1| hypothetical protein SNOG_13334 [Phaeosphaeria nodorum SN15] gi|160703995|gb|EAT79218.2| hypothetical protein SNOG_13334 [Phaeosphaeria nodorum SN15] Length = 133 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLFLL 81 K G+A +G+ + + +F + G RNP + VL FA AE+ GLF L Sbjct: 65 KIQGAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFA-FAEATGLFAL 123 Query: 82 LVVMLLLFV 90 ++ LLL+V Sbjct: 124 MMSFLLLYV 132 >gi|22653456|gb|AAN04072.1| ATP synthase F0 subunit 9 [Amoebidium parasiticum] Length = 74 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 17/67 (25%), Positives = 35/67 (52%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K+V G+A +G+ + + +F+ L+ RNP + ++ + E++ LF L+ Sbjct: 6 KFVGAGLATIGLTGAGIGIGMVFSALLNATSRNPSLKQQLFSNAILGFALTEAIALFALM 65 Query: 83 VVMLLLF 89 + L+LF Sbjct: 66 IAFLILF 72 >gi|10802940|gb|AAG23688.1|AF288091_33 ATP synthase F0 subunit 9 [Thraustochytrium aureum] Length = 75 Score = 33.9 bits (76), Expect = 7.1, Method: Compositional matrix adjust. Identities = 19/69 (27%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F ++ G RNP L+ + E++ LF+ Sbjct: 5 AAKLIGAGVATVGLTGAGIGIGTVFGAFIVGMSRNPSMEQKMFKFCLMGFALTEAIALFV 64 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 65 LMMAFLILF 73 >gi|225704546|gb|ACO08119.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 140 Score = 33.9 bits (76), Expect = 7.4, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV----IAESL 76 AAK++ G A +G+ + +F + + G RNP + K ++ +A+ ++E++ Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 125 Query: 77 GLFLLLVVMLLLFVI 91 GL L+V L+LF + Sbjct: 126 GLSCLMVAFLILFAM 140 >gi|288818678|ref|YP_003433026.1| ATP synthase C chain [Hydrogenobacter thermophilus TK-6] gi|288788078|dbj|BAI69825.1| ATP synthase C chain [Hydrogenobacter thermophilus TK-6] gi|308752267|gb|ADO45750.1| ATP synthase F0, C subunit [Hydrogenobacter thermophilus TK-6] Length = 102 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 +A+G+A LG G+ + + G RNP +T + I E+L L+ LLV Sbjct: 39 LAIGLAALGTGI---GMGHAVRGTQEGTARNPTVGGRLQTVMFIGLAFIETLALYALLVA 95 Query: 85 MLLLFV 90 ++LLFV Sbjct: 96 IILLFV 101 >gi|146087746|ref|XP_001465892.1| ATPase subunit 9 [Leishmania infantum JPCM5] gi|157870055|ref|XP_001683578.1| ATPase subunit 9 [Leishmania major strain Friedlin] gi|68126644|emb|CAJ04348.1| putative ATPase subunit 9 [Leishmania major strain Friedlin] gi|134069993|emb|CAM68323.1| putative ATPase subunit 9 [Leishmania infantum JPCM5] gi|322499379|emb|CBZ34452.1| unnamed protein product [Leishmania donovani BPK282A1] Length = 106 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 33/67 (49%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 YV G+A + +G V L + IF L G R P ++ + E++GLF L+ Sbjct: 39 HYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALM 98 Query: 83 VVMLLLF 89 + L+LF Sbjct: 99 LAFLMLF 105 >gi|289065194|ref|YP_003434246.1| ATP synthase F0 subunit 9 [Chattonella marina] gi|288871906|dbj|BAI70593.1| ATP synthase F0 subunit 9 [Chattonella marina] Length = 75 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASA-HKTEVLIFAVIAESLGLFL 80 AK+V G+A +G+ + + +F + G RNP + +L FA + E++ LF Sbjct: 6 AKFVGAGLATIGLAGAGVGIGTVFGALVLGTSRNPSLKDELFRIAILGFA-LTEAIALFA 64 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 65 LMMAFLILFAL 75 >gi|157868914|ref|XP_001683009.1| ATPase subunit 9 [Leishmania major strain Friedlin] gi|68223892|emb|CAJ04246.1| putative ATPase subunit 9 [Leishmania major strain Friedlin] Length = 106 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 33/67 (49%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 YV G+A + +G V L + IF L G R P ++ + E++GLF L+ Sbjct: 39 HYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALM 98 Query: 83 VVMLLLF 89 + L+LF Sbjct: 99 LAFLMLF 105 >gi|292559469|ref|YP_003540837.1| ATP synthase F0 subunit c [Hartmannella vermiformis] gi|290775722|gb|ADD62221.1| ATP synthase F0 subunit c [Hartmannella vermiformis] Length = 82 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 23/85 (27%), Positives = 48/85 (56%), Gaps = 5/85 (5%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNP-CAASAHKT 64 ME + F A+ + +AK++ G+A +G+ + + +F+ Y++ A RN A + Sbjct: 1 MENSVFFAS---LTTSAKFIGAGLATIGVAGAGMGIGVVFSGYMNAAARNEMIRAELFRY 57 Query: 65 EVLIFAVIAESLGLFLLLVVMLLLF 89 +L FA + E++GL +++ L+L+ Sbjct: 58 AILGFA-LTEAMGLLAIMIAFLILY 81 >gi|293349888|ref|XP_002727281.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] gi|293361756|ref|XP_002730087.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] Length = 139 Score = 33.9 bits (76), Expect = 7.9, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK+ G A +G+ + +F + + G RNP + K ++ ++++ +E++ Sbjct: 69 AAKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNP----SLKQQLFSYSILGFTLSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 G F L+V L+LF I Sbjct: 125 GPFCLMVAFLILFAI 139 >gi|322498821|emb|CBZ33893.1| unnamed protein product [Leishmania donovani BPK282A1] Length = 106 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 33/67 (49%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 YV G+A + +G V L + IF L G R P ++ + E++GLF L+ Sbjct: 39 HYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALM 98 Query: 83 VVMLLLF 89 + L+LF Sbjct: 99 LAFLMLF 105 >gi|313673431|ref|YP_004051542.1| ATP synthase f0 subcomplex c subunit [Calditerrivibrio nitroreducens DSM 19672] gi|312940187|gb|ADR19379.1| ATP synthase F0 subcomplex C subunit [Calditerrivibrio nitroreducens DSM 19672] Length = 105 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Query: 30 ACLGMGLVA----LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 A LGMG+ A L + + G RNP A+ T ++I + ESL ++ L++ + Sbjct: 40 AGLGMGIAAFGTGLGQGKAVASAVEGISRNPGASGKIMTPMIIGLAMIESLAIYALVISL 99 Query: 86 LLLFVI 91 +LLFV+ Sbjct: 100 ILLFVV 105 >gi|4588732|gb|AAD26196.1|AF114959_1 ATP synthase subunit 9 [Kazachstania unispora] Length = 80 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 33/60 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+A +G+ + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAGIATIGLLGAGIGIAIVFAALINGVARNPSLKDQLFSYTILGMALSEATGLF 64 >gi|296190512|ref|XP_002743224.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 136 Score = 33.9 bits (76), Expect = 8.6, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASA-HKTEVLIFAVIAESLGLF 79 AAK++ G A +G+ + +F + + G RNP +L FA ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQRLFSCAILSFA-LSEAMGLF 124 Query: 80 LLLVVMLLLF 89 L+V L+ F Sbjct: 125 CLMVAFLIFF 134 >gi|145603091|ref|XP_362034.2| hypothetical protein [Magnaporthe oryzae 70-15] gi|145011413|gb|EDJ96069.1| predicted protein [Magnaporthe oryzae 70-15] Length = 154 Score = 33.5 bits (75), Expect = 8.7, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 8/67 (11%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESLGLFLLLV 83 G+A +G+ + + +F + G RNP A + ++ +A++ +E+ GLF L+V Sbjct: 91 GLATIGLAGAGVGIGTVFGALIQGVARNP----ALRGQLFSYAILGFAFSEATGLFALMV 146 Query: 84 VMLLLFV 90 LL++V Sbjct: 147 AFLLMYV 153 >gi|902019|gb|AAA70035.1| ATP synthase subunit 9 [Pythium oligandrum] gi|902021|gb|AAA70037.1| ATP synthase subunit 9 [Pythium oligandrum] Length = 75 Score = 33.5 bits (75), Expect = 8.8, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 42/70 (60%), Gaps = 2/70 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC-AASAHKTEVLIFAVIAESLGLF 79 +AK++ G+A +G+ + + ++F++ + G RNP +T +L FA + ES+ LF Sbjct: 5 SAKFIGAGLATIGLAGAGIGIGSVFSSLVLGISRNPSLQQDLTRTAILGFA-LTESIALF 63 Query: 80 LLLVVMLLLF 89 L++ L+LF Sbjct: 64 CLMIAFLILF 73 >gi|291195764|gb|ADD84598.1| H+-transporting ATP synthase [Magnaporthe oryzae] Length = 154 Score = 33.5 bits (75), Expect = 9.1, Method: Compositional matrix adjust. Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 8/67 (11%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESLGLFLLLV 83 G+A +G+ + + +F + G RNP A + ++ +A++ +E+ GLF L+V Sbjct: 91 GLATIGLAGAGVGIGTVFGALIQGVARNP----ALRGQLFSYAILGFAFSEATGLFALMV 146 Query: 84 VMLLLFV 90 LL++V Sbjct: 147 AFLLMYV 153 >gi|299737836|ref|XP_002910005.1| ATP synthase F0 subunit 9 [Coprinopsis cinerea okayama7#130] gi|298402997|gb|EFI26511.1| ATP synthase F0 subunit 9 [Coprinopsis cinerea okayama7#130] Length = 73 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 22/69 (31%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + +F + + RNP T ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGTVFGSLIIATARNPQLRGQLFTYAILGFALAEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMAFLLLY 72 >gi|225705940|gb|ACO08816.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 139 Score = 33.5 bits (75), Expect = 9.4, Method: Compositional matrix adjust. Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 8/75 (10%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI----AESL 76 AAK++ G A +G+ + + + + G RNP + K ++ +A++ +E++ Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVSGSLIIGYARNP----SLKQQLFSYAILGFALSEAM 124 Query: 77 GLFLLLVVMLLLFVI 91 GLF L+V L+LF + Sbjct: 125 GLFCLMVAFLILFAM 139 >gi|281428814|ref|YP_003354993.1| ATP synthase subunit 9 [Pneumocystis carinii] gi|270486331|gb|ACZ82954.1| ATP synthase subunit 9 [Pneumocystis carinii] Length = 74 Score = 33.5 bits (75), Expect = 9.6, Method: Compositional matrix adjust. Identities = 21/69 (30%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F L RNP T ++ +AE+ GLF Sbjct: 4 AAKIIGSGLATIGLAGAGVGIGLVFGNLLVATSRNPSLKGQLFTYAILGFALAEATGLFC 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMAFLLLY 72 >gi|85708926|ref|ZP_01039992.1| ATP synthase subunit A [Erythrobacter sp. NAP1] gi|85690460|gb|EAQ30463.1| ATP synthase subunit A [Erythrobacter sp. NAP1] Length = 76 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 21/50 (42%), Positives = 29/50 (58%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 V N+F ++L A RNP AA + + I AE LGL +V M+L+FV Sbjct: 25 VGNVFGSFLESALRNPGAADGQQGRLFIGFAAAELLGLLAFVVAMILIFV 74 >gi|146085898|ref|XP_001465387.1| ATPase subunit 9 [Leishmania infantum JPCM5] gi|134069485|emb|CAM67808.1| putative ATPase subunit 9 [Leishmania infantum JPCM5] Length = 106 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 33/67 (49%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 YV G+A + +G V L + IF L G R P ++ + E++GLF L+ Sbjct: 39 HYVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALM 98 Query: 83 VVMLLLF 89 + L+LF Sbjct: 99 LAFLMLF 105 Searching..................................................done Results from round 2 >gi|74004280|ref|XP_545452.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Canis familiaris] Length = 393 Score = 89.1 bits (220), Expect = 2e-16, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 323 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 382 Query: 81 LLVVMLLLFVI 91 L+V L+ F + Sbjct: 383 LIVAFLIFFAM 393 >gi|254781087|ref|YP_003065500.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] gi|254040764|gb|ACT57560.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 84.1 bits (207), Expect = 6e-15, Method: Composition-based stats. Identities = 91/91 (100%), Positives = 91/91 (100%) Query: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS Sbjct: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 Query: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI Sbjct: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 >gi|73996376|ref|XP_534788.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Canis familiaris] Length = 252 Score = 80.3 bits (197), Expect = 8e-14, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 182 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 241 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 242 LMVAFLILFAM 252 >gi|311272672|ref|XP_003133540.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Sus scrofa] Length = 269 Score = 80.3 bits (197), Expect = 9e-14, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 199 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 258 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 259 LMVAFLILFAM 269 >gi|296223453|ref|XP_002757659.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 160 Score = 78.3 bits (192), Expect = 3e-13, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 90 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 149 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 150 LMVAFLILFAM 160 >gi|218512640|ref|ZP_03509480.1| F0F1 ATP synthase subunit C [Rhizobium etli 8C-3] Length = 138 Score = 78.0 bits (191), Expect = 4e-13, Method: Composition-based stats. Identities = 28/70 (40%), Positives = 41/70 (58%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F + + AAK++ G+AC GM AL + NIF +YLSGA RNP AA + ++ Sbjct: 58 FQRSFNMEAEAAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGF 117 Query: 71 VIAESLGLFL 80 + E+LG+F Sbjct: 118 AVTEALGIFS 127 >gi|119933584|ref|XP_001256922.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Bos taurus] Length = 170 Score = 78.0 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 100 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 159 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 160 LMVAFLILFAV 170 >gi|332839209|ref|XP_003313696.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] Length = 196 Score = 77.2 bits (189), Expect = 7e-13, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 126 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 185 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 186 LMVAFLILFAM 196 >gi|109096967|ref|XP_001107007.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 2 [Macaca mulatta] Length = 198 Score = 76.4 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 187 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 188 LMVAFLILFAM 198 >gi|296194948|ref|XP_002745184.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 215 Score = 76.4 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 39/71 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 145 AAKFISAGAATVGVAGSGAGIGTVFGSVIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 204 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 205 LMVAFLILFAM 215 >gi|332206022|ref|XP_003252088.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Nomascus leucogenys] gi|332206024|ref|XP_003252089.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Nomascus leucogenys] gi|332206030|ref|XP_003252092.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 5 [Nomascus leucogenys] gi|332206032|ref|XP_003252093.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 6 [Nomascus leucogenys] Length = 198 Score = 75.7 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 187 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 188 LMVAFLILFAM 198 >gi|85794840|ref|NP_005167.2| ATP synthase lipid-binding protein, mitochondrial isoform b precursor [Homo sapiens] gi|114644458|ref|XP_509102.2| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 5 [Pan troglodytes] gi|332839205|ref|XP_003313694.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|332839213|ref|XP_003339277.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|332839215|ref|XP_003313698.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|119617131|gb|EAW96725.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_a [Homo sapiens] Length = 198 Score = 75.7 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 187 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 188 LMVAFLILFAM 198 >gi|28603708|ref|NP_788786.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|114680|sp|P07926|AT5G2_BOVIN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|99|emb|CAA28846.1| P2 subunit [Bos taurus] gi|28189645|dbj|BAC56437.1| similar to mit-ATP synthase proteolipid P2 subunit precursor [Bos taurus] gi|84202593|gb|AAI11614.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Bos taurus] gi|296487906|gb|DAA30019.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|224831|prf||1202261B ATP synthase proteolipid P2 Length = 143 Score = 74.9 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 73 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 132 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 133 LMVAFLILFAM 143 >gi|57164181|ref|NP_001009468.1| ATP synthase lipid-binding protein, mitochondrial precursor [Ovis aries] gi|461593|sp|Q06056|AT5G2_SHEEP RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|1203|emb|CAA49530.1| H(+)-transporting ATP synthase [Ovis aries] Length = 143 Score = 74.9 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 73 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 132 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 133 LMVAFLILFAM 143 >gi|209733972|gb|ACI67855.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 156 Score = 74.1 bits (181), Expect = 5e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 86 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 145 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 146 LMVAFLILFAM 156 >gi|13385960|ref|NP_080744.1| ATP synthase lipid-binding protein, mitochondrial precursor [Mus musculus] gi|309263385|ref|XP_003086035.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Mus musculus] gi|309263387|ref|XP_003086036.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Mus musculus] gi|309263389|ref|XP_003086037.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Mus musculus] gi|309265804|ref|XP_003086621.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Mus musculus] gi|309268674|ref|XP_003084720.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Mus musculus] gi|309272952|ref|XP_001472331.2| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Mus musculus] gi|51338784|sp|P56383|AT5G2_MOUSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|12832200|dbj|BAB22005.1| unnamed protein product [Mus musculus] gi|12841492|dbj|BAB25231.1| unnamed protein product [Mus musculus] gi|12848921|dbj|BAB28137.1| unnamed protein product [Mus musculus] gi|13905060|gb|AAH06813.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] gi|26344626|dbj|BAC35962.1| unnamed protein product [Mus musculus] gi|51980721|gb|AAH81437.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] gi|77415523|gb|AAI06139.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 2 [Mus musculus] gi|148669715|gb|EDL01662.1| mCG118574 [Mus musculus] gi|148672010|gb|EDL03957.1| mCG17597 [Mus musculus] gi|148692417|gb|EDL24364.1| mCG113310 [Mus musculus] Length = 146 Score = 74.1 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 76 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 135 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 136 LMVAFLILFAM 146 >gi|8392939|ref|NP_059007.1| ATP synthase lipid-binding protein, mitochondrial precursor [Rattus norvegicus] gi|543878|sp|Q06645|AT5G1_RAT RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|286200|dbj|BAA02425.1| ATP synthase subunit c precursor [Rattus norvegicus] gi|149053967|gb|EDM05784.1| rCG33837, isoform CRA_a [Rattus norvegicus] gi|149053968|gb|EDM05785.1| rCG33837, isoform CRA_a [Rattus norvegicus] gi|149053969|gb|EDM05786.1| rCG33837, isoform CRA_a [Rattus norvegicus] Length = 136 Score = 74.1 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|73966257|ref|XP_851984.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 isoform 2 [Canis familiaris] gi|73966259|ref|XP_548181.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 isoform 1 [Canis familiaris] Length = 136 Score = 73.7 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|149639699|ref|XP_001514999.1| PREDICTED: hypothetical protein [Ornithorhynchus anatinus] Length = 161 Score = 73.7 bits (180), Expect = 7e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 91 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 150 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 151 LMVAFLILFAM 161 >gi|291405855|ref|XP_002719355.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 [Oryctolagus cuniculus] Length = 136 Score = 73.7 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|74204278|dbj|BAE39897.1| unnamed protein product [Mus musculus] Length = 136 Score = 73.3 bits (179), Expect = 9e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|301762942|ref|XP_002916871.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] gi|285804524|gb|ADC35740.1| ATP5G1 [Ailuropoda melanoleuca] gi|285804526|gb|ADC35741.1| ATP5G1 [Ailuropoda melanoleuca] Length = 136 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|326936387|ref|XP_003214236.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Meleagris gallopavo] Length = 172 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 102 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 161 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 162 LMVAFLILFAM 172 >gi|19424234|ref|NP_598240.1| ATP synthase lipid-binding protein, mitochondrial precursor [Rattus norvegicus] gi|543879|sp|Q06646|AT5G2_RAT RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|286202|dbj|BAA02426.1| ATP synthase subunit c precursor [Rattus norvegicus] gi|124504543|gb|AAI28727.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [Rattus norvegicus] gi|149031904|gb|EDL86816.1| rCG50567, isoform CRA_a [Rattus norvegicus] gi|149031905|gb|EDL86817.1| rCG50567, isoform CRA_a [Rattus norvegicus] Length = 141 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|332206026|ref|XP_003252090.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] Length = 157 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 87 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 146 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 147 LMVAFLILFAM 157 >gi|50593533|ref|NP_001002031.1| ATP synthase lipid-binding protein, mitochondrial isoform a precursor [Homo sapiens] gi|114644462|ref|XP_001137490.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 4 [Pan troglodytes] gi|332839207|ref|XP_003313695.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] Length = 157 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 87 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 146 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 147 LMVAFLILFAM 157 >gi|73966422|ref|XP_851758.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Canis familiaris] Length = 202 Score = 73.0 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A + + + +F + + G RNP + ++ ++E++GLF Sbjct: 132 AAKFIGAGTAPVRVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSHAILGFALSEAMGLFC 191 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 192 LMLAFLILFAM 202 >gi|194217074|ref|XP_001499319.2| PREDICTED: similar to H(+)-transporting ATP synthase [Equus caballus] Length = 136 Score = 73.0 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|31982497|ref|NP_031532.2| ATP synthase lipid-binding protein, mitochondrial [Mus musculus] gi|238637299|ref|NP_001154891.1| ATP synthase lipid-binding protein, mitochondrial [Mus musculus] gi|81903631|sp|Q9CR84|AT5G1_MOUSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|12842227|dbj|BAB25522.1| unnamed protein product [Mus musculus] gi|12843525|dbj|BAB26015.1| unnamed protein product [Mus musculus] gi|12844952|dbj|BAB26561.1| unnamed protein product [Mus musculus] gi|12846607|dbj|BAB27233.1| unnamed protein product [Mus musculus] gi|12846923|dbj|BAB27363.1| unnamed protein product [Mus musculus] gi|12847554|dbj|BAB27617.1| unnamed protein product [Mus musculus] gi|13277978|gb|AAH03854.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] gi|66267548|gb|AAH94664.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] gi|123243747|emb|CAM18271.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Mus musculus] gi|148684064|gb|EDL16011.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] gi|148684065|gb|EDL16012.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] gi|148684066|gb|EDL16013.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1, isoform CRA_a [Mus musculus] Length = 136 Score = 73.0 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|327263846|ref|XP_003216728.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Anolis carolinensis] Length = 140 Score = 72.6 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|309288|gb|AAA16434.1| H+ ATP synthase [Mus musculus] gi|148670618|gb|EDL02565.1| mCG134178 [Mus musculus] Length = 136 Score = 72.6 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVTFLILFAM 136 >gi|312378349|gb|EFR24952.1| hypothetical protein AND_10147 [Anopheles darlingi] Length = 183 Score = 72.2 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK V +A +G+ + + +F + + G RNP + ++ ++E++GLF Sbjct: 113 AAKLVGASLATIGVAGSGVGIGTVFGSLMLGYARNPPLKQQIFSYAILGFALSEAMGLFC 172 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 173 LMMAFLMLFA 182 >gi|329850280|ref|ZP_08265125.1| ATP synthase F0, C subunit [Asticcacaulis biprosthecum C19] gi|328840595|gb|EGF90166.1| ATP synthase F0, C subunit [Asticcacaulis biprosthecum C19] Length = 85 Score = 72.2 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 25/72 (34%), Positives = 42/72 (58%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +++ KY+ G+A LGM + + +F Y GA RNP AA +T + I + E+LG Sbjct: 9 FAVGLKYIGAGLATLGMIGAGIGLGILFGNYYVGALRNPSAAKTQQTNLFIGMALTEALG 68 Query: 78 LFLLLVVMLLLF 89 +F ++ +L+LF Sbjct: 69 IFAFVIALLILF 80 >gi|291230682|ref|XP_002735292.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3-like [Saccoglossus kowalevskii] Length = 149 Score = 72.2 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 79 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 138 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 139 LMVAFLILFAL 149 >gi|73975799|ref|XP_850856.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P2) (ATPase protein 9) (ATPase subunit C) [Canis familiaris] Length = 197 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 127 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 186 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 187 LMVAFLILFAM 197 >gi|126308255|ref|XP_001367285.1| PREDICTED: similar to P1 subunit [Monodelphis domestica] Length = 136 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAL 136 >gi|154251152|ref|YP_001411976.1| F0F1 ATP synthase subunit C [Parvibaculum lavamentivorans DS-1] gi|154155102|gb|ABS62319.1| H+transporting two-sector ATPase C subunit [Parvibaculum lavamentivorans DS-1] Length = 74 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 35/70 (50%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGMG A+ V NIF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGIACLGMGGAAIGVGNIFGNYLAGALRNPSAADGQFARLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLFV 90 LLV ++LLFV Sbjct: 65 LLVALILLFV 74 >gi|326935772|ref|XP_003213941.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Meleagris gallopavo] Length = 130 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 119 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 120 LMVAFLILFAM 130 >gi|197101063|ref|NP_001125678.1| ATP synthase lipid-binding protein, mitochondrial precursor [Pongo abelii] gi|68565129|sp|Q5RAP9|AT5G2_PONAB RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|55728845|emb|CAH91161.1| hypothetical protein [Pongo abelii] Length = 141 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|301776104|ref|XP_002923472.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] Length = 145 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 75 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 134 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 135 LMVAFLILFAM 145 >gi|57164393|ref|NP_001009396.1| ATP synthase lipid-binding protein, mitochondrial precursor [Ovis aries] gi|461590|sp|P17605|AT5G1_SHEEP RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|1201|emb|CAA49529.1| H(+)-transporting ATP synthase [Ovis aries] Length = 136 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|117660743|gb|ABK55635.1| mitochondrial ATP5G2 [Sus scrofa] Length = 155 Score = 71.0 bits (173), Expect = 4e-11, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 85 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 144 Query: 81 LLVVMLLLFVI 91 +V L+LF + Sbjct: 145 PMVAFLILFAM 155 >gi|307200014|gb|EFN80360.1| ATP synthase lipid-binding protein, mitochondrial [Harpegnathos saltator] Length = 138 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|158514029|sp|A1XQS5|AT5G1_PIG RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|117660669|gb|ABK55631.1| mitochondrial ATP5G1 [Sus scrofa] Length = 136 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ + E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALFEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|68534968|ref|NP_001020389.1| ATP synthase lipid-binding protein, mitochondrial [Sus scrofa] gi|55274178|gb|AAV48969.1| mitochondrial H+ transporting ATP synthase subunit c isoform 1 [Sus scrofa] Length = 136 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSMIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|109074231|ref|XP_001104905.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] Length = 135 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 65 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 124 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 125 LMVAFLILFAM 135 >gi|28603764|ref|NP_788822.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|416684|sp|P32876|AT5G1_BOVIN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|96|emb|CAA28845.1| P1 subunit [Bos taurus] gi|74355040|gb|AAI02953.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Bos taurus] gi|296476460|gb|DAA18575.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|224830|prf||1202261A ATP synthase proteolipid P1 Length = 136 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|307181254|gb|EFN68944.1| ATP synthase lipid-binding protein, mitochondrial [Camponotus floridanus] Length = 134 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 123 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 124 LMMAFLLLFA 133 >gi|332206028|ref|XP_003252091.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 4 [Nomascus leucogenys] Length = 141 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|306774121|ref|NP_001182424.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Macaca mulatta] Length = 135 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 65 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 124 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 125 LMVAFLILFAM 135 >gi|332259428|ref|XP_003278791.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Nomascus leucogenys] gi|332259430|ref|XP_003278792.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Nomascus leucogenys] gi|332259432|ref|XP_003278793.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] gi|332259434|ref|XP_003278794.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 4 [Nomascus leucogenys] gi|332259436|ref|XP_003278795.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 5 [Nomascus leucogenys] Length = 136 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|114644464|ref|XP_001137325.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 2 [Pan troglodytes] gi|114644466|ref|XP_001137401.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 3 [Pan troglodytes] gi|332839211|ref|XP_003313697.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|332839217|ref|XP_003313700.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Pan troglodytes] gi|461592|sp|Q06055|AT5G2_HUMAN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P2; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|38432|emb|CAA49533.1| P2 gene for c subunit of mitochondrial ATP synthase [Homo sapiens] gi|285910|dbj|BAA02421.1| ATP synthase subunit c precursor [Homo sapiens] gi|18088565|gb|AAH20826.1| ATP5G2 protein [Homo sapiens] gi|119617132|gb|EAW96726.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), isoform CRA_b [Homo sapiens] gi|123980928|gb|ABM82293.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [synthetic construct] gi|123995743|gb|ABM85473.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9) [synthetic construct] Length = 141 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|332030330|gb|EGI70073.1| ATP synthase lipid-binding protein, mitochondrial [Acromyrmex echinatior] Length = 138 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|109096969|ref|XP_001106939.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 1 [Macaca mulatta] Length = 141 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|4885081|ref|NP_005166.1| ATP synthase lipid-binding protein, mitochondrial precursor [Homo sapiens] gi|50659069|ref|NP_001002027.1| ATP synthase lipid-binding protein, mitochondrial precursor [Homo sapiens] gi|55646787|ref|XP_511941.1| PREDICTED: hypothetical protein LOC455195 isoform 4 [Pan troglodytes] gi|114666317|ref|XP_001172721.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 isoform 2 [Pan troglodytes] gi|114666320|ref|XP_001172743.1| PREDICTED: hypothetical protein LOC455195 isoform 3 [Pan troglodytes] gi|297715955|ref|XP_002834304.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Pongo abelii] gi|332847288|ref|XP_001172711.2| PREDICTED: hypothetical protein LOC455195 isoform 1 [Pan troglodytes] gi|461588|sp|P05496|AT5G1_HUMAN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P1; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|38430|emb|CAA49532.1| P1 gene for c subunit of human mitochondrial ATP synthase [Homo sapiens] gi|285908|dbj|BAA02420.1| ATP synthase subunit c precursor [Homo sapiens] gi|5262507|emb|CAB45704.1| hypothetical protein [Homo sapiens] gi|13436356|gb|AAH04963.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) [Homo sapiens] gi|30583299|gb|AAP35894.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Homo sapiens] gi|49065324|emb|CAG38480.1| ATP5G1 [Homo sapiens] gi|60655527|gb|AAX32327.1| ATP synthase mitochondrial F0 complex subunit c isoform 1 [synthetic construct] gi|60823066|gb|AAX36631.1| ATP synthase mitochondrial F0 complex subunit c isoform 1 [synthetic construct] gi|117644094|emb|CAL38315.1| hypothetical protein [synthetic construct] gi|119615111|gb|EAW94705.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), isoform CRA_a [Homo sapiens] gi|119615112|gb|EAW94706.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9), isoform CRA_a [Homo sapiens] gi|189053168|dbj|BAG34790.1| unnamed protein product [Homo sapiens] gi|261859424|dbj|BAI46234.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 [synthetic construct] Length = 136 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|30584765|gb|AAP36635.1| Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [synthetic construct] gi|61372842|gb|AAX43922.1| ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [synthetic construct] gi|61372846|gb|AAX43923.1| ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [synthetic construct] Length = 137 Score = 70.6 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|77736329|ref|NP_001029864.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] gi|109940311|sp|Q3ZC75|AT5G3_BOVIN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|73586705|gb|AAI02869.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Bos taurus] gi|296490649|gb|DAA32762.1| ATP synthase lipid-binding protein, mitochondrial precursor [Bos taurus] Length = 141 Score = 70.6 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 22/80 (27%), Positives = 40/80 (50%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A N AAK++ G A +G+ + +F + + G RNP + ++ Sbjct: 62 TAVNRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFA 121 Query: 72 IAESLGLFLLLVVMLLLFVI 91 ++E++GLF L+V L+LF + Sbjct: 122 LSEAMGLFCLMVAFLILFAM 141 >gi|166796912|gb|AAI59383.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus (Silurana) tropicalis] Length = 142 Score = 70.3 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 132 LMVAFLILFAM 142 >gi|188582610|ref|YP_001926055.1| ATP synthase F0 subunit C [Methylobacterium populi BJ001] gi|179346108|gb|ACB81520.1| ATP synthase F0, C subunit [Methylobacterium populi BJ001] Length = 75 Score = 70.3 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 41/62 (66%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+ACLGM ++ + N+F + SGA RNP AA + +T +L+ + E+LG+ Sbjct: 3 PVAAKYIGAGLACLGMAGASIGLGNLFGQFYSGALRNPSAADSQRTNLLLGFALTEALGI 62 Query: 79 FL 80 F Sbjct: 63 FS 64 >gi|166406825|gb|ABY87376.1| mitochondrial ATP synthase subunit 9 precursor-like protein [Haliotis diversicolor] Length = 157 Score = 70.3 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 23/80 (28%), Positives = 42/80 (52%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 +AA AAKY+ G A +G+ + ++F + + G RNP + ++ Sbjct: 78 SAAQRDIDQAAKYIGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFA 137 Query: 72 IAESLGLFLLLVVMLLLFVI 91 ++E++GLF L++ LLLF + Sbjct: 138 LSEAMGLFCLMMAFLLLFAL 157 >gi|52346088|ref|NP_001005087.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Xenopus (Silurana) tropicalis] gi|49903762|gb|AAH77012.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Xenopus (Silurana) tropicalis] gi|89268626|emb|CAJ83365.1| atp5g3 [Xenopus (Silurana) tropicalis] Length = 142 Score = 70.3 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 132 LMVAFLILFAM 142 >gi|94482844|gb|ABF22459.1| mitochondrial ATP synthase F0 complex subunit c isoform 3 [Takifugu rubripes] Length = 139 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 23/91 (25%), Positives = 45/91 (49%) Query: 1 MDKQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAAS 60 + + M A +A + AAK++ G A +G+ + +F + + G RNP Sbjct: 49 LSQVTMRAFQTSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQ 108 Query: 61 AHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + ++ ++E++GLF L+V L+LF + Sbjct: 109 QLFSYAILGFALSEAMGLFCLMVAFLILFAM 139 >gi|74003411|ref|XP_545225.2| PREDICTED: similar to 5-hydroxytryptamine receptor 3 subunit C [Canis familiaris] Length = 557 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG-LF 79 AAK++ G A +G+ + +F + + G RNP + ++ ++E+LG LF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEALGSLF 130 Query: 80 L 80 Sbjct: 131 S 131 >gi|209731238|gb|ACI66488.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|303665532|gb|ADM16188.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|308321426|gb|ADO27864.1| mitochondrial ATP synthase lipid-binding protein [Ictalurus furcatus] Length = 139 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|327275826|ref|XP_003222673.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Anolis carolinensis] gi|327275828|ref|XP_003222674.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Anolis carolinensis] gi|327275830|ref|XP_003222675.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Anolis carolinensis] Length = 135 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 65 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 124 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 125 LMVAFLILFAM 135 >gi|242016971|ref|XP_002428968.1| ATP synthase lipid-binding protein, putative [Pediculus humanus corporis] gi|212513797|gb|EEB16230.1| ATP synthase lipid-binding protein, putative [Pediculus humanus corporis] Length = 146 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 76 AAKYIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 135 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 136 LMMSFLLLFA 145 >gi|48101426|ref|XP_392672.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Apis mellifera] gi|66531719|ref|XP_623661.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Apis mellifera] gi|328778738|ref|XP_003249541.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Apis mellifera] gi|328778740|ref|XP_003249542.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Apis mellifera] gi|328778742|ref|XP_003249543.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Apis mellifera] Length = 142 Score = 69.9 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGSVFGSLIVGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 132 LMMAFLLLFA 141 >gi|209737618|gb|ACI69678.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|52346136|ref|NP_001005112.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Xenopus (Silurana) tropicalis] gi|49904303|gb|AAH77049.1| MGC89969 protein [Xenopus (Silurana) tropicalis] gi|115530779|emb|CAL49358.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 1 [Xenopus (Silurana) tropicalis] Length = 130 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 119 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 120 LMVAFLILFAM 130 >gi|27923925|ref|NP_778180.1| ATP synthase lipid-binding protein, mitochondrial precursor [Mus musculus] gi|3023368|sp|P56384|AT5G3_MOUSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|26346845|dbj|BAC37071.1| unnamed protein product [Mus musculus] gi|26352852|dbj|BAC40056.1| unnamed protein product [Mus musculus] gi|71121748|gb|AAH99786.1| Unknown (protein for MGC:124584) [Rattus norvegicus] gi|109730713|gb|AAI16219.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] gi|123857846|emb|CAM15305.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3 [Mus musculus] gi|148695207|gb|EDL27154.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3, isoform CRA_a [Mus musculus] gi|148695208|gb|EDL27155.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), isoform 3, isoform CRA_a [Mus musculus] gi|149022270|gb|EDL79164.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) isoform 3, isoform CRA_a [Rattus norvegicus] Length = 141 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|74005789|ref|XP_853361.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 1 [Canis familiaris] Length = 115 Score = 69.5 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 21/80 (26%), Positives = 41/80 (51%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 + +G AAK++ G A +G+ + +F + + G RNP + ++ Sbjct: 36 SVVSGDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFA 95 Query: 72 IAESLGLFLLLVVMLLLFVI 91 ++E++GLF L+V L+LF + Sbjct: 96 LSEAMGLFCLMVAFLILFAM 115 >gi|297493590|gb|ADI40517.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C2 [Cynopterus sphinx] Length = 110 Score = 69.5 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 41 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 100 Query: 81 LLVVMLLLFV 90 L+V L+LF Sbjct: 101 LMVAFLILFA 110 >gi|291383079|ref|XP_002708072.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Oryctolagus cuniculus] Length = 136 Score = 69.5 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ +++++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSKAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+ L+LF + Sbjct: 126 LMFAFLILFAM 136 >gi|193786795|dbj|BAG52118.1| unnamed protein product [Homo sapiens] Length = 141 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPFLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|293349888|ref|XP_002727281.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] gi|293361756|ref|XP_002730087.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] Length = 139 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+ G A +G+ + +F + + G RNP + ++ ++E++G F Sbjct: 69 AAKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYSILGFTLSEAMGPFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF I Sbjct: 129 LMVAFLILFAI 139 >gi|197632365|gb|ACH70906.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-2 [Salmo salar] gi|209732094|gb|ACI66916.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209737424|gb|ACI69581.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209737884|gb|ACI69811.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223646556|gb|ACN10036.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223672403|gb|ACN12383.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|225717276|gb|ACO14484.1| ATP synthase lipid-binding protein, mitochondrial precursor [Esox lucius] Length = 137 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 126 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 127 LMVAFLILFAM 137 >gi|209738122|gb|ACI69930.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 22/80 (27%), Positives = 42/80 (52%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 +AA+ AAK++ G A +G+ + +F + + G RNP + ++ Sbjct: 60 SAASRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFA 119 Query: 72 IAESLGLFLLLVVMLLLFVI 91 ++E++GLF L+V L+LF + Sbjct: 120 LSEAMGLFCLMVAFLILFAM 139 >gi|74002223|ref|XP_851540.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit C) [Canis familiaris] Length = 131 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ +E++GLF Sbjct: 61 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFAFSEAMGLFC 120 Query: 81 LLVVMLLLFVI 91 L+V +LF + Sbjct: 121 LMVAFFILFAM 131 >gi|209733112|gb|ACI67425.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|148237171|ref|NP_001088407.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C1 (subunit 9) [Xenopus laevis] gi|54261572|gb|AAH84317.1| LOC495263 protein [Xenopus laevis] Length = 130 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 119 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 120 LMVAFLILFAM 130 >gi|296202556|ref|XP_002748508.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Callithrix jacchus] gi|296202558|ref|XP_002748509.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Callithrix jacchus] Length = 136 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|223029543|gb|ACM78493.1| MIP02330p [Drosophila melanogaster] Length = 134 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 123 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 124 LMMAFLLLFA 133 >gi|310756730|gb|ADP20506.1| mitochondrial ATP synthase lipid-binding protein isoform A precursor [Heterocephalus glaber] Length = 141 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|295792294|gb|ADG29151.1| mitochondrial ATP synthase lipid-binding protein [Epinephelus coioides] gi|328677271|gb|AEB31358.1| mitochondrial ATP synthase F0 complex subunit c isoform 3 [Epinephelus bruneus] Length = 139 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|224055127|ref|XP_002199194.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 2 [Taeniopygia guttata] gi|224055131|ref|XP_002199191.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) isoform 1 [Taeniopygia guttata] Length = 141 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|209734668|gb|ACI68203.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGTATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAV 140 >gi|18700491|dbj|BAB85212.1| ATP lipid-binding protein like protein [Marsupenaeus japonicus] Length = 128 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 58 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 117 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 118 LMMAFLLLFA 127 >gi|190692013|gb|ACE87781.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein [synthetic construct] Length = 142 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF I Sbjct: 132 LMVAFLILFAI 142 >gi|118102906|ref|XP_001233576.1| PREDICTED: similar to P1 subunit isoform 1 [Gallus gallus] gi|118102908|ref|XP_001233587.1| PREDICTED: similar to P1 subunit isoform 2 [Gallus gallus] Length = 136 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|74004876|ref|XP_535971.2| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c, isoform 3 [Canis familiaris] Length = 141 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|118102910|ref|XP_001233603.1| PREDICTED: similar to P1 subunit isoform 3 [Gallus gallus] gi|118102912|ref|XP_418114.2| PREDICTED: similar to P1 subunit isoform 4 [Gallus gallus] Length = 136 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|149286944|gb|ABR23371.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Ornithodoros parkeri] Length = 138 Score = 68.7 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|326934069|ref|XP_003213118.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Meleagris gallopavo] Length = 115 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 45 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 104 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 105 LMVAFLILFAM 115 >gi|213511946|ref|NP_001133182.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-2 [Salmo salar] gi|209733544|gb|ACI67641.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|91091934|ref|XP_967645.1| PREDICTED: similar to GA14517-PA [Tribolium castaneum] gi|270001304|gb|EEZ97751.1| hypothetical protein TcasGA2_TC011455 [Tribolium castaneum] Length = 140 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 130 LMMAFLLLFA 139 >gi|308323199|gb|ADO28736.1| mitochondrial ATP synthase lipid-binding protein [Ictalurus punctatus] Length = 139 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|221220858|gb|ACM09090.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 137 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 126 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 127 LMVAFLILFAM 137 >gi|163852589|ref|YP_001640632.1| H+transporting two-sector ATPase C subunit [Methylobacterium extorquens PA1] gi|218531430|ref|YP_002422246.1| H+transporting two-sector ATPase C subunit [Methylobacterium chloromethanicum CM4] gi|240139924|ref|YP_002964401.1| F0 sector of membrane-bound ATP synthase, subunit c [Methylobacterium extorquens AM1] gi|254562348|ref|YP_003069443.1| ATP synthase F0 sector subunit c [Methylobacterium extorquens DM4] gi|163664194|gb|ABY31561.1| H+transporting two-sector ATPase C subunit [Methylobacterium extorquens PA1] gi|218523733|gb|ACK84318.1| H+transporting two-sector ATPase C subunit [Methylobacterium chloromethanicum CM4] gi|240009898|gb|ACS41124.1| F0 sector of membrane-bound ATP synthase, subunit c [Methylobacterium extorquens AM1] gi|254269626|emb|CAX25597.1| ATP synthase F0 sector subunit c [Methylobacterium extorquens DM4] Length = 75 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 41/62 (66%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+ACLGM ++ + N+F + +GA RNP AA + +T +L+ + E+LG+ Sbjct: 3 PVAAKYIGAGLACLGMAGASIGLGNLFGQFYAGALRNPSAADSQRTNLLLGFALTEALGI 62 Query: 79 FL 80 F Sbjct: 63 FS 64 >gi|229367004|gb|ACQ58482.1| ATP synthase lipid-binding protein, mitochondrial precursor [Anoplopoma fimbria] Length = 138 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 128 LMVAFLILFAM 138 >gi|147903501|ref|NP_001085928.1| MGC82833 protein [Xenopus laevis] gi|49119456|gb|AAH73551.1| MGC82833 protein [Xenopus laevis] Length = 130 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 119 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 120 LMVAFLILFAM 130 >gi|296204470|ref|XP_002749356.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Callithrix jacchus] gi|296204472|ref|XP_002749357.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Callithrix jacchus] gi|296204474|ref|XP_002749358.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Callithrix jacchus] Length = 141 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|195394561|ref|XP_002055911.1| GJ10646 [Drosophila virilis] gi|194142620|gb|EDW59023.1| GJ10646 [Drosophila virilis] Length = 138 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|225706460|gb|ACO09076.1| ATP synthase lipid-binding protein, mitochondrial precursor [Osmerus mordax] Length = 139 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|149541038|ref|XP_001519284.1| PREDICTED: similar to ATP synthase lipid binding protein p3 [Ornithorhynchus anatinus] Length = 122 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 52 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 112 LMVAFLILFAM 122 >gi|225707250|gb|ACO09471.1| ATP synthase lipid-binding protein, mitochondrial precursor [Osmerus mordax] Length = 138 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 128 LMVAFLILFAM 138 >gi|4502301|ref|NP_001680.1| ATP synthase lipid-binding protein, mitochondrial isoform A precursor [Homo sapiens] gi|16758592|ref|NP_446208.1| ATP synthase lipid-binding protein, mitochondrial precursor [Rattus norvegicus] gi|50659074|ref|NP_001002258.1| ATP synthase lipid-binding protein, mitochondrial isoform A precursor [Homo sapiens] gi|332209390|ref|XP_003253795.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Nomascus leucogenys] gi|332209392|ref|XP_003253796.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Nomascus leucogenys] gi|332209394|ref|XP_003253797.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Nomascus leucogenys] gi|332814788|ref|XP_525965.3| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 3 [Pan troglodytes] gi|332814790|ref|XP_003309369.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 1 [Pan troglodytes] gi|332814792|ref|XP_003309370.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 2 [Pan troglodytes] gi|1352048|sp|P48201|AT5G3_HUMAN RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|51315713|sp|Q71S46|AT5G3_RAT RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|12620380|gb|AAG60677.1|AF315374_1 ATP synthase lipid-binding protein P3 precursor [Rattus norvegicus] gi|511450|gb|AAA78807.1| mitochondrial ATP synthase subunit 9 precursor [Homo sapiens] gi|62630225|gb|AAX88970.1| unknown [Homo sapiens] gi|76827802|gb|AAI06882.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) [Homo sapiens] gi|119631510|gb|EAX11105.1| hCG16568, isoform CRA_a [Homo sapiens] gi|119631511|gb|EAX11106.1| hCG16568, isoform CRA_a [Homo sapiens] gi|119631512|gb|EAX11107.1| hCG16568, isoform CRA_a [Homo sapiens] gi|189065214|dbj|BAG34937.1| unnamed protein product [Homo sapiens] gi|254071377|gb|ACT64448.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 (subunit 9) protein [synthetic construct] Length = 142 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 132 LMVAFLILFAM 142 >gi|47217003|emb|CAG01631.1| unnamed protein product [Tetraodon nigroviridis] Length = 136 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|323650074|gb|ADX97123.1| mitochondrial ATP synthase f0 complex subunit c isoform 1 [Perca flavescens] Length = 137 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 126 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 127 LMVAFLILFAM 137 >gi|126326335|ref|XP_001368353.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 141 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAL 141 >gi|327283486|ref|XP_003226472.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Anolis carolinensis] Length = 143 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 73 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 132 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 133 LMVAFLILFAM 143 >gi|213512117|ref|NP_001133183.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-3 [Salmo salar] gi|197632367|gb|ACH70907.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-3 [Salmo salar] gi|209730842|gb|ACI66290.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223646610|gb|ACN10063.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223672457|gb|ACN12410.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 68.3 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|297493588|gb|ADI40516.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C2 [Miniopterus schreibersii] Length = 114 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 45 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 104 Query: 81 LLVVMLLLFV 90 L+V L+LF Sbjct: 105 LMVAFLILFA 114 >gi|289743209|gb|ADD20352.1| mitochondrial ATP synthase lipid binding protein precursor [Glossina morsitans morsitans] gi|289743213|gb|ADD20354.1| mitochondrial F1F0-ATP synthase subunit C/ATP9/proteolipid [Glossina morsitans morsitans] Length = 138 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|158425885|ref|YP_001527177.1| ATP synthase C chain precursor [Azorhizobium caulinodans ORS 571] gi|158332774|dbj|BAF90259.1| ATP synthase C chain precursor [Azorhizobium caulinodans ORS 571] Length = 75 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 37/70 (52%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGMGL + V NIF +LSGA RNP AA I A +AE LG+F Sbjct: 5 AAKFIGAGLACLGMGLAGIGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGLGIFS 64 Query: 81 LLVVMLLLFV 90 L+V ++LLFV Sbjct: 65 LVVALILLFV 74 >gi|148230635|ref|NP_001080083.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Xenopus laevis] gi|27371265|gb|AAH41245.1| Cg1746-prov protein [Xenopus laevis] Length = 142 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 132 LMVAFLILFAM 142 >gi|114798825|ref|YP_760621.1| ATP synthase F0 subunit C [Hyphomonas neptunium ATCC 15444] gi|122942379|sp|Q0C0X2|ATPL_HYPNA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|114738999|gb|ABI77124.1| ATP synthase F0, C subunit [Hyphomonas neptunium ATCC 15444] Length = 78 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 32/70 (45%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 KYV G+A LGM AL V NIF ++L A RNP AA + I +AE+LG+F Sbjct: 8 GLKYVGAGLATLGMIGSALGVGNIFASFLDAAMRNPSAAPQQTGNLFIGMALAEALGIFS 67 Query: 81 LLVVMLLLFV 90 +L+ +L+LFV Sbjct: 68 VLIAILILFV 77 >gi|254293425|ref|YP_003059448.1| H+transporting two-sector ATPase C subunit [Hirschia baltica ATCC 49814] gi|254041956|gb|ACT58751.1| H+transporting two-sector ATPase C subunit [Hirschia baltica ATCC 49814] Length = 74 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 30/71 (42%), Positives = 41/71 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 KYV G+AC M AL V NIF++YL A RNP AA ++ + E+LG+F Sbjct: 4 GLKYVGAGLACFAMFGAALGVGNIFSSYLDAAMRNPSAAQGQFGNLIFGFAVTEALGIFG 63 Query: 81 LLVVMLLLFVI 91 L+ +LLLF + Sbjct: 64 FLIAILLLFAV 74 >gi|225703786|gb|ACO07739.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 140 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFTM 140 >gi|47115139|emb|CAG28411.1| ATP5G3 [Homo sapiens] Length = 142 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 132 LMVAFLILFAM 142 >gi|52430378|gb|AAU50550.1| ATPase synthase protein 9 [Fundulus heteroclitus] Length = 110 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 40 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 99 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 100 LMVAFLILFAM 110 >gi|256070459|ref|XP_002571560.1| ATP synthase lipid-binding protein-like protein [Schistosoma mansoni] gi|238656704|emb|CAZ27790.1| ATP synthase lipid-binding protein-like protein [Schistosoma mansoni] Length = 135 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 65 AAKYIGAGAATVGCAGSGAGIGSVFGSLTLAYARNPGLKQQLFTYAILGFALSEAMGLFC 124 Query: 81 LLVVMLLLFV 90 L++ L+L+V Sbjct: 125 LVMAFLILYV 134 >gi|223646126|gb|ACN09821.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|223671973|gb|ACN12168.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 137 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 126 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 127 LMVAFLILFAM 137 >gi|209732790|gb|ACI67264.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSPIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|225704066|gb|ACO07879.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] gi|225704792|gb|ACO08242.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 140 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|291391779|ref|XP_002712346.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 [Oryctolagus cuniculus] Length = 141 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|157871007|ref|XP_001684053.1| ATPase subunit 9 [Leishmania major strain Friedlin] gi|68127121|emb|CAJ04716.1| putative ATPase subunit 9 [Leishmania major strain Friedlin] Length = 252 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 186 YVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALML 245 Query: 84 VMLLLF 89 L+LF Sbjct: 246 AFLMLF 251 >gi|195341714|ref|XP_002037451.1| GM12097 [Drosophila sechellia] gi|194131567|gb|EDW53610.1| GM12097 [Drosophila sechellia] Length = 138 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATIGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|195449282|ref|XP_002072006.1| GK22551 [Drosophila willistoni] gi|194168091|gb|EDW82992.1| GK22551 [Drosophila willistoni] Length = 138 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|195112483|ref|XP_002000802.1| GI10430 [Drosophila mojavensis] gi|193917396|gb|EDW16263.1| GI10430 [Drosophila mojavensis] Length = 138 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|22003998|dbj|BAC06448.1| mitochondrial ATP synthase c-subunit (P3) precursor [Cyprinus carpio] Length = 140 Score = 67.6 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V LLLF + Sbjct: 130 LMVAFLLLFAM 140 >gi|170592337|ref|XP_001900925.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Brugia malayi] gi|158591620|gb|EDP30225.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Brugia malayi] Length = 113 Score = 67.6 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKYV G A +G+ + N+F + + G RNP A + + ++ ++E++GLF Sbjct: 43 AAKYVGAGAATVGVAGSGAGIGNVFGSLVIGYARNPSAKNQLFSYAILGFALSEAMGLFC 102 Query: 81 LLVVMLLLFV 90 L + +LF Sbjct: 103 LCMGFCILFA 112 >gi|311213907|ref|NP_001185663.1| ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9) [Macaca mulatta] gi|109081176|ref|XP_001086288.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] gi|301769737|ref|XP_002920285.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Ailuropoda melanoleuca] gi|301769739|ref|XP_002920286.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Ailuropoda melanoleuca] gi|301769741|ref|XP_002920287.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Ailuropoda melanoleuca] gi|90078110|dbj|BAE88735.1| unnamed protein product [Macaca fascicularis] Length = 141 Score = 67.6 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|125772503|ref|XP_001357564.1| GA14517 [Drosophila pseudoobscura pseudoobscura] gi|194744513|ref|XP_001954738.1| GF16589 [Drosophila ananassae] gi|195062153|ref|XP_001996145.1| GH14335 [Drosophila grimshawi] gi|195159000|ref|XP_002020371.1| GL13949 [Drosophila persimilis] gi|54637296|gb|EAL26698.1| GA14517 [Drosophila pseudoobscura pseudoobscura] gi|190627775|gb|EDV43299.1| GF16589 [Drosophila ananassae] gi|193891937|gb|EDV90803.1| GH14335 [Drosophila grimshawi] gi|194117140|gb|EDW39183.1| GL13949 [Drosophila persimilis] Length = 138 Score = 67.6 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|197098748|ref|NP_001124618.1| ATP synthase lipid-binding protein, mitochondrial precursor [Pongo abelii] gi|68565143|sp|Q5RFL2|AT5G3_PONAB RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase proteolipid P3; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|55725157|emb|CAH89445.1| hypothetical protein [Pongo abelii] Length = 142 Score = 67.6 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 132 LMVAFLILFAM 142 >gi|24651599|ref|NP_651852.1| CG1746, isoform A [Drosophila melanogaster] gi|24651601|ref|NP_733422.1| CG1746, isoform B [Drosophila melanogaster] gi|24651603|ref|NP_733423.1| CG1746, isoform C [Drosophila melanogaster] gi|194905019|ref|XP_001981105.1| GG11879 [Drosophila erecta] gi|7302028|gb|AAF57131.1| CG1746, isoform B [Drosophila melanogaster] gi|23172756|gb|AAN14267.1| CG1746, isoform A [Drosophila melanogaster] gi|23172757|gb|AAN14268.1| CG1746, isoform C [Drosophila melanogaster] gi|41058227|gb|AAR99150.1| GM13193p [Drosophila melanogaster] gi|190655743|gb|EDV52975.1| GG11879 [Drosophila erecta] Length = 138 Score = 67.6 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|163867852|ref|YP_001609056.1| F0F1 ATP synthase subunit C [Bartonella tribocorum CIP 105476] gi|161017503|emb|CAK01061.1| ATP synthase, subunit C [Bartonella tribocorum CIP 105476] Length = 76 Score = 67.2 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 35/72 (48%), Positives = 48/72 (66%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 64 Query: 80 LLLVVMLLLFVI 91 LL+ +LLLF + Sbjct: 65 SLLIALLLLFGV 76 >gi|94482791|gb|ABF22409.1| mitochondrial ATP synthase F0 complex subunit c isoform 1 [Takifugu rubripes] Length = 137 Score = 67.2 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 126 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 127 LMVAFLILFAM 137 >gi|195505392|ref|XP_002099484.1| GE23327 [Drosophila yakuba] gi|194185585|gb|EDW99196.1| GE23327 [Drosophila yakuba] Length = 138 Score = 67.2 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|308324351|gb|ADO29310.1| mitochondrial ATP synthase lipid-binding protein [Ictalurus punctatus] Length = 140 Score = 67.2 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|213511574|ref|NP_001135171.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-1 [Salmo salar] gi|197632363|gb|ACH70905.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c-1 [Salmo salar] gi|209732020|gb|ACI66879.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209735800|gb|ACI68769.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|303659177|gb|ADM15948.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 127 Score = 67.2 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 57 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 116 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 117 LMVAFLILFAM 127 >gi|41056119|ref|NP_957470.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C3 [Danio rerio] gi|28503019|gb|AAH47199.1| Zgc:55970 [Danio rerio] gi|50925106|gb|AAH78654.1| Zgc:55970 protein [Danio rerio] Length = 139 Score = 67.2 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|209731794|gb|ACI66766.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] gi|209734262|gb|ACI68000.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 140 Score = 67.2 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|149730746|ref|XP_001499985.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit c) [Equus caballus] Length = 141 Score = 67.2 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|67083899|gb|AAY66884.1| ATP synthase C subunit [Ixodes scapularis] Length = 152 Score = 66.8 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 82 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 141 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 142 LMMAFLLLFA 151 >gi|196476769|gb|ACG76249.1| ATP synthase c-subunit [Amblyomma americanum] Length = 147 Score = 66.8 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 77 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 136 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 137 LMMAFLLLFA 146 >gi|49473960|ref|YP_032002.1| F0F1 ATP synthase subunit C [Bartonella quintana str. Toulouse] gi|49475210|ref|YP_033251.1| F0F1 ATP synthase subunit C [Bartonella henselae str. Houston-1] gi|49238015|emb|CAF27221.1| ATP synthase subunit C [Bartonella henselae str. Houston-1] gi|49239463|emb|CAF25814.1| ATP synthase subunit C [Bartonella quintana str. Toulouse] Length = 76 Score = 66.8 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 29/61 (47%), Positives = 39/61 (63%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 64 Query: 80 L 80 Sbjct: 65 S 65 >gi|240850060|ref|YP_002971453.1| ATP synthase subunit C [Bartonella grahamii as4aup] gi|240267183|gb|ACS50771.1| ATP synthase subunit C [Bartonella grahamii as4aup] Length = 76 Score = 66.8 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 35/72 (48%), Positives = 48/72 (66%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIF 64 Query: 80 LLLVVMLLLFVI 91 LL+ +LLLF + Sbjct: 65 SLLIALLLLFGV 76 >gi|116250700|ref|YP_766538.1| F0F1 ATP synthase subunit C [Rhizobium leguminosarum bv. viciae 3841] gi|241203302|ref|YP_002974398.1| F0F1 ATP synthase subunit C [Rhizobium leguminosarum bv. trifolii WSM1325] gi|115255348|emb|CAK06423.1| ATP synthase subunit c [Rhizobium leguminosarum bv. viciae 3841] gi|240857192|gb|ACS54859.1| H+transporting two-sector ATPase C subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 75 Score = 66.8 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 38/60 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFS 64 >gi|221130316|ref|XP_002162613.1| PREDICTED: similar to predicted protein [Hydra magnipapillata] Length = 126 Score = 66.8 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G + +F + + G RNP + ++ ++E++GLF Sbjct: 56 AAKFIGAGAATVGCAGSGAGIGTVFGSLIIGYARNPSLKPQLFSYAILGFALSEAMGLFS 115 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 116 LMMSFLILF 124 >gi|198427649|ref|XP_002122403.1| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P1) (ATPase protein 9) (ATPase subunit c) [Ciona intestinalis] Length = 125 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP T ++ ++E++GLF Sbjct: 55 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFALSEAMGLFC 114 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 115 LMVAFLILFAL 125 >gi|47271372|ref|NP_571836.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] gi|28279669|gb|AAH45894.1| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9) [Danio rerio] Length = 140 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|281344387|gb|EFB19971.1| hypothetical protein PANDA_005022 [Ailuropoda melanoleuca] Length = 97 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 27 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 86 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 87 LMVAFLILFAM 97 >gi|38048075|gb|AAR09940.1| similar to Drosophila melanogaster CG1746 [Drosophila yakuba] Length = 129 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 59 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 118 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 119 LMMAFLLLFA 128 >gi|179255|gb|AAA51806.1| ATPase subunit 9 [Homo sapiens] Length = 100 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 30 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 89 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 90 LMVAFLILFAM 100 >gi|195996711|ref|XP_002108224.1| ATPase subunit 9 [Trichoplax adhaerens] gi|190589000|gb|EDV29022.1| ATPase subunit 9 [Trichoplax adhaerens] Length = 109 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 39 AAKFIGAGAATVGVAGSGAGIGTVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 98 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 99 LMMAFLILFAL 109 >gi|51011614|gb|AAT92216.1| ATP synthase c-subunit [Ixodes pacificus] Length = 152 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 82 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 141 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 142 LMMAFLLLFA 151 >gi|218662074|ref|ZP_03518004.1| F0F1 ATP synthase subunit C [Rhizobium etli IE4771] gi|218670342|ref|ZP_03520013.1| F0F1 ATP synthase subunit C [Rhizobium etli GR56] Length = 75 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 27/60 (45%), Positives = 37/60 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+AC GM AL + NIF YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKFIGAGLACFGMAGTALGLGNIFGNYLSGALRNPSAADSQFGRLVFGFAVTEALGIFS 64 >gi|170044391|ref|XP_001849833.1| mitochondrial ATP synthase lipid binding protein [Culex quinquefasciatus] gi|167867565|gb|EDS30948.1| mitochondrial ATP synthase lipid binding protein [Culex quinquefasciatus] Length = 138 Score = 66.0 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|229367984|gb|ACQ58972.1| ATP synthase lipid-binding protein, mitochondrial precursor [Anoplopoma fimbria] Length = 141 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|157929876|gb|ABW04126.1| ATP synthase H+ transporting F0 complex subunit c [Epinephelus coioides] Length = 139 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|269146606|gb|ACZ28249.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Simulium nigrimanum] Length = 136 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 126 LMMAFLLLFA 135 >gi|197260868|gb|ACH56931.1| mitochondrial F1F0-ATP synthase subunit c/ATP9/proteolipid [Simulium vittatum] Length = 136 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 126 LMMAFLLLFA 135 >gi|56417588|gb|AAV90735.1| mitochondrial ATP synthase lipid binding protein precursor [Aedes albopictus] Length = 138 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|88608692|ref|YP_506284.1| F0F1 ATP synthase subunit C [Neorickettsia sennetsu str. Miyayama] gi|254796764|ref|YP_003081600.1| hypothetical protein NRI_0378 [Neorickettsia risticii str. Illinois] gi|123736361|sp|Q2GE12|ATPL_NEOSM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|88600861|gb|ABD46329.1| ATP synthase F0, C chain [Neorickettsia sennetsu str. Miyayama] gi|254589960|gb|ACT69322.1| conserved domain protein [Neorickettsia risticii str. Illinois] Length = 75 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 26/70 (37%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 K++ +G++ +GM A+ VSNIF+ L+G RNP + K V A + E++GLF Sbjct: 5 GLKFLGIGLSVVGMLGAAIGVSNIFSMMLNGIARNPESEEKLKKYVYAGAALTEAMGLFS 64 Query: 81 LLVVMLLLFV 90 ++ +LL+FV Sbjct: 65 FVLALLLIFV 74 >gi|324548154|gb|ADY49731.1| ATP synthase lipid-binding protein [Ascaris suum] Length = 115 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G+ + N+F + G RNP + + ++ ++E++GLF Sbjct: 45 AAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKAQLFSYAILGFALSEAMGLFC 104 Query: 81 LLVVMLLLFVI 91 L + ++LF + Sbjct: 105 LTMGFMILFAL 115 >gi|224924404|gb|ACN69152.1| mitochondrial F1F0-ATP synthase, subunit c/ATP9/proteolipid [Stomoxys calcitrans] Length = 138 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|47218104|emb|CAG09976.1| unnamed protein product [Tetraodon nigroviridis] Length = 176 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 33/66 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVML 86 V+L Sbjct: 128 KTSVIL 133 >gi|37589803|gb|AAH59619.1| Zgc:73293 [Danio rerio] Length = 138 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 128 LMVAFLILFAM 138 >gi|158288718|ref|XP_001688294.1| AGAP000523-PA [Anopheles gambiae str. PEST] gi|114864975|gb|ABI83790.1| mitochondrial F1F0-ATP synthase subunit c [Anopheles funestus] gi|157018704|gb|EDO64318.1| AGAP000523-PA [Anopheles gambiae str. PEST] Length = 138 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|225705940|gb|ACO08816.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 139 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + + + + G RNP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVSGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|300024393|ref|YP_003757004.1| ATP synthase F0 C subunit [Hyphomicrobium denitrificans ATCC 51888] gi|299526214|gb|ADJ24683.1| ATP synthase F0, C subunit [Hyphomicrobium denitrificans ATCC 51888] Length = 74 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 30/69 (43%), Positives = 43/69 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+AC + + + NIF YLSGA RNP AA T +LI +AE+ GLF Sbjct: 5 AAKMIGAGLACSALIGAGVGIGNIFGNYLSGAMRNPSAAPGQFTNLLIGFALAEATGLFG 64 Query: 81 LLVVMLLLF 89 LL+ +++L+ Sbjct: 65 LLIALIILY 73 >gi|224086930|ref|XP_002187275.1| PREDICTED: similar to ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), partial [Taeniopygia guttata] Length = 94 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 24 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 83 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 84 LMVAFLILFAM 94 >gi|240247670|emb|CAX51429.1| ATP synthase-like protein [Opisthacanthus cayaporum] Length = 147 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G R P + ++ ++E++GLF Sbjct: 77 AAKFIGAGAATVGVAGSGAGIGSVFGSPIIGYARYPSLIQQLFSYAILGFALSEAMGLFC 136 Query: 81 LLVVMLLLFV 90 L++V LLLF Sbjct: 137 LMMVFLLLFA 146 >gi|297274794|ref|XP_002800876.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Macaca mulatta] Length = 156 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 17/72 (23%), Positives = 35/72 (48%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAK + G A +G+ + +F + + RN + ++ ++E++GLF Sbjct: 85 IAAKLIGAGAATVGVAGSGAGIGMVFGSLVIAYVRNLSLKQQLFSCAILGFALSEAMGLF 144 Query: 80 LLLVVMLLLFVI 91 +V L+LF + Sbjct: 145 CRMVAFLILFAM 156 >gi|157112701|ref|XP_001657606.1| ATPase subunit, putative [Aedes aegypti] gi|108877954|gb|EAT42179.1| ATPase subunit, putative [Aedes aegypti] Length = 125 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 55 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 114 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 115 LMMAFLLLFA 124 >gi|260574857|ref|ZP_05842859.1| H+transporting two-sector ATPase C subunit [Rhodobacter sp. SW2] gi|259022862|gb|EEW26156.1| H+transporting two-sector ATPase C subunit [Rhodobacter sp. SW2] Length = 78 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 40/70 (57%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC GMG A+ V N+ +LSGA RNP AA + I AE+ G+F Sbjct: 9 GAYIGAGLACTGMGGAAIGVGNVAGNFLSGALRNPSAAPGQTAMLFIGIAFAEAFGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|50878271|ref|NP_998193.1| ATP synthase lipid-binding protein, mitochondrial [Danio rerio] gi|47937900|gb|AAH71368.1| Zgc:73293 [Danio rerio] Length = 138 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 128 LMVAFLILFAM 138 >gi|256070461|ref|XP_002571561.1| ATP synthase lipid-binding protein-like protein [Schistosoma mansoni] gi|238656705|emb|CAZ27791.1| ATP synthase lipid-binding protein-like protein [Schistosoma mansoni] Length = 122 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGCAGSGAGIGSVFGSLTLAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+V Sbjct: 112 LVMAFLILYV 121 >gi|29825397|gb|AAO92282.1| ATP synthase c-subunit [Dermacentor variabilis] Length = 149 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 37/69 (53%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 AK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF L Sbjct: 80 AKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCL 139 Query: 82 LVVMLLLFV 90 ++ LLLF Sbjct: 140 MMAFLLLFA 148 >gi|260908342|gb|ACX53892.1| ATP synthase c-subunit [Rhipicephalus sanguineus] Length = 149 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 79 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 138 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 139 LMMAFLLLFA 148 >gi|157133453|ref|XP_001656257.1| ATPase subunit, putative [Aedes aegypti] gi|94468368|gb|ABF18033.1| mitochondrial ATP synthase lipid binding protein precursor [Aedes aegypti] gi|108870848|gb|EAT35073.1| ATPase subunit, putative [Aedes aegypti] Length = 138 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 128 LMMAFLLLFA 137 >gi|62736231|ref|YP_227559.1| ATP synthase subunit 9 [Candida metapsilosis] gi|62177743|gb|AAX73034.1| ATP synthase subunit 9 [Candida metapsilosis] gi|170779376|gb|ACB37040.1| ATP synthase subunit 9 [Candida metapsilosis] Length = 76 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 25/73 (34%), Positives = 45/73 (61%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ G+A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 TLAAKYIGAGIATLGLGGAAIGIAIVFAALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYAV 76 >gi|270266733|gb|ACZ65231.1| mitochondrial ATP synthase subunit 9 [Sinonovacula constricta] Length = 146 Score = 65.3 bits (158), Expect = 2e-09, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+++ G A +G+ + +IF + RNP T ++ +AE++GLF Sbjct: 76 AARFIGAGAATVGVAGSGAGIGSIFGSLCIAYARNPSLKQQLFTYAVLGFALAEAMGLFC 135 Query: 81 LLVVMLLLFVI 91 L++ ++++++ Sbjct: 136 LMMAFMIVYIL 146 >gi|15888059|ref|NP_353740.1| F0F1 ATP synthase subunit C [Agrobacterium tumefaciens str. C58] gi|325292101|ref|YP_004277965.1| ATP synthase subunit C [Agrobacterium sp. H13-3] gi|15155683|gb|AAK86525.1| ATP synthase epsilon chain [Agrobacterium tumefaciens str. C58] gi|325059954|gb|ADY63645.1| ATP synthase subunit C [Agrobacterium sp. H13-3] Length = 75 Score = 65.3 bits (158), Expect = 2e-09, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 38/60 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGM +LA+ IF YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKYIGAGLACLGMAGTSLALGRIFGDYLSGALRNPSAADSQFGRLVFGFAVTEALGIFS 64 >gi|225704546|gb|ACO08119.1| ATP synthase lipid-binding protein, mitochondrial precursor [Oncorhynchus mykiss] Length = 140 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GL Sbjct: 70 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLSC 129 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 130 LMVAFLILFAM 140 >gi|12597402|gb|AAG60044.1|AF311603_1 ATP synthase lipid binding protein p3 precursor [Danio rerio] Length = 118 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 48 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 107 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 108 LMVAFLILFAM 118 >gi|227821027|ref|YP_002824997.1| F0F1 ATP synthase subunit C [Sinorhizobium fredii NGR234] gi|227340026|gb|ACP24244.1| ATP synthase, subunit C [Sinorhizobium fredii NGR234] Length = 75 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 38/60 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGM AL + NIF +YLSGA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADGQFGRLVFGFAVTEALGIFS 64 >gi|109010281|ref|XP_001099796.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 1 [Macaca mulatta] gi|297279255|ref|XP_002801695.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 2 [Macaca mulatta] gi|297279257|ref|XP_002801696.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial isoform 3 [Macaca mulatta] Length = 141 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 71 AAEFTGAGAATVGVAGSGAGIGTVFGSLIIGCARNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L++F + Sbjct: 131 LMVAFLIVFAM 141 >gi|296235834|ref|XP_002763067.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 141 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 39/71 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ VG A +G+ + +F + + G RNP + ++ ++E++GL Sbjct: 71 AAKFIGVGAATVGVAGFGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLSC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LFV+ Sbjct: 131 LMVAFLILFVM 141 >gi|86356511|ref|YP_468403.1| F0F1 ATP synthase subunit C [Rhizobium etli CFN 42] gi|190890576|ref|YP_001977118.1| ATP synthase, subunit C [Rhizobium etli CIAT 652] gi|209548119|ref|YP_002280036.1| F0F1 ATP synthase subunit C [Rhizobium leguminosarum bv. trifolii WSM2304] gi|222147702|ref|YP_002548659.1| F0F1 ATP synthase subunit C [Agrobacterium vitis S4] gi|86280613|gb|ABC89676.1| ATP synthase protein, subunit C [Rhizobium etli CFN 42] gi|190695855|gb|ACE89940.1| ATP synthase protein, subunit C [Rhizobium etli CIAT 652] gi|209533875|gb|ACI53810.1| H+transporting two-sector ATPase C subunit [Rhizobium leguminosarum bv. trifolii WSM2304] gi|221734690|gb|ACM35653.1| ATP synthase C chain [Agrobacterium vitis S4] gi|327190879|gb|EGE57938.1| F0F1 ATP synthase subunit C [Rhizobium etli CNPAF512] Length = 75 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 27/60 (45%), Positives = 38/60 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG+F Sbjct: 5 AAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFS 64 >gi|195998197|ref|XP_002108967.1| conserved hypothetical protein [Trichoplax adhaerens] gi|190589743|gb|EDV29765.1| conserved hypothetical protein [Trichoplax adhaerens] Length = 116 Score = 65.3 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 46 AAKFIGAGAATVGVAGSGAGIGTVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 105 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 106 LMMAFLILFAL 116 >gi|170744958|ref|YP_001773613.1| H+transporting two-sector ATPase C subunit [Methylobacterium sp. 4-46] gi|220927389|ref|YP_002502691.1| H+transporting two-sector ATPase subunit C [Methylobacterium nodulans ORS 2060] gi|168199232|gb|ACA21179.1| H+transporting two-sector ATPase C subunit [Methylobacterium sp. 4-46] gi|219951996|gb|ACL62388.1| H+transporting two-sector ATPase C subunit [Methylobacterium nodulans ORS 2060] Length = 75 Score = 64.9 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 40/62 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+ACLGM A+ + N+F + +GA RNP AA + + +L+ + E+LG+ Sbjct: 3 PVAAKYIGAGLACLGMAGAAVGLGNLFGQFFAGALRNPSAADSQRANLLLGFALTEALGI 62 Query: 79 FL 80 F Sbjct: 63 FS 64 >gi|297493598|gb|ADI40521.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C3 [Cynopterus sphinx] Length = 129 Score = 64.9 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 34/66 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 123 Query: 81 LLVVML 86 L+V L Sbjct: 124 LMVAFL 129 >gi|50750411|ref|XP_421992.1| PREDICTED: similar to mitochondrial ATP synthase subunit 9 [Gallus gallus] Length = 136 Score = 64.9 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|281342170|gb|EFB17754.1| hypothetical protein PANDA_012605 [Ailuropoda melanoleuca] Length = 105 Score = 64.9 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 35 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 94 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 95 LMVAFLILFAM 105 >gi|34581013|ref|ZP_00142493.1| ATP synthase C chain [Rickettsia sibirica 246] gi|229586252|ref|YP_002844753.1| F0F1 ATP synthase subunit C [Rickettsia africae ESF-5] gi|259585526|sp|C3PM50|ATPL_RICAE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|28262398|gb|EAA25902.1| ATP synthase C chain [Rickettsia sibirica 246] gi|228021302|gb|ACP53010.1| ATP synthase C chain [Rickettsia africae ESF-5] Length = 74 Score = 64.9 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 28/70 (40%), Positives = 43/70 (61%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ G+ +GM AL VSNIF++ LS RNP A + LI A + E++GLF Sbjct: 4 VSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLTEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|297493600|gb|ADI40522.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C3 [Rousettus leschenaultii] Length = 129 Score = 64.9 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 34/66 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 123 Query: 81 LLVVML 86 L+V L Sbjct: 124 LMVAFL 129 >gi|209733748|gb|ACI67743.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 139 Score = 64.9 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G NP + ++ ++E++GLF Sbjct: 69 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYAGNPSLKQQLFSYAILGFALSEAMGLFC 128 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 129 LMVAFLILFAM 139 >gi|268370179|ref|NP_001161269.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] gi|268370183|ref|NP_001161270.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] gi|268370187|ref|NP_001161272.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] gi|268370189|ref|NP_001161273.1| ATP synthase lipid-binding protein, mitochondrial precursor [Nasonia vitripennis] Length = 137 Score = 64.9 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 67 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 126 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 127 LMMAFLLLFA 136 >gi|182677735|ref|YP_001831881.1| H+transporting two-sector ATPase C subunit [Beijerinckia indica subsp. indica ATCC 9039] gi|182633618|gb|ACB94392.1| H+transporting two-sector ATPase C subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 76 Score = 64.5 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 36/73 (49%), Positives = 47/73 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 LAAKY+ G +GMG A+ V+ IF ++LSGA RNP A+ A I A +AE LG+ Sbjct: 3 PLAAKYLGAGFTVIGMGAAAIGVAIIFASFLSGALRNPTASDAQFGRAFIGAALAEGLGI 62 Query: 79 FLLLVVMLLLFVI 91 F LV +LLLFV+ Sbjct: 63 FSFLVAILLLFVM 75 >gi|148672340|gb|EDL04287.1| mCG19742 [Mus musculus] Length = 146 Score = 64.5 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 76 AAKFIGAGAATVGVAGSGGGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 135 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 136 LMVAFLILFAM 146 >gi|297493596|gb|ADI40520.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C3 [Miniopterus schreibersii] Length = 129 Score = 64.5 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 34/66 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 64 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 123 Query: 81 LLVVML 86 L+V L Sbjct: 124 LMVAFL 129 >gi|239831259|ref|ZP_04679588.1| ATP synthase C chain [Ochrobactrum intermedium LMG 3301] gi|239823526|gb|EEQ95094.1| ATP synthase C chain [Ochrobactrum intermedium LMG 3301] Length = 75 Score = 64.5 bits (156), Expect = 4e-09, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 35/57 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+AC GM AL + NIF YLSGA RNP AA + ++ + E+LG Sbjct: 5 AAKYIGAGLACFGMAGTALGLGNIFGNYLSGALRNPSAADSQFGRLVFGFAVTEALG 61 >gi|291195764|gb|ADD84598.1| H+-transporting ATP synthase [Magnaporthe oryzae] Length = 154 Score = 64.5 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 32/65 (49%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 G+A +G+ + + +F + G RNP + ++ +E+ GLF L+V Sbjct: 89 GAGLATIGLAGAGVGIGTVFGALIQGVARNPALRGQLFSYAILGFAFSEATGLFALMVAF 148 Query: 86 LLLFV 90 LL++V Sbjct: 149 LLMYV 153 >gi|115767413|ref|XP_788804.2| PREDICTED: similar to mitochondrial ATP synthase c-subunit (P3) precursor, partial [Strongylocentrotus purpuratus] gi|115967699|ref|XP_001194359.1| PREDICTED: similar to mitochondrial ATP synthase c-subunit (P3) precursor, partial [Strongylocentrotus purpuratus] Length = 117 Score = 64.5 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP T ++ ++E++GLF Sbjct: 47 AAKFIGAGAATVGLAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFALSEAMGLFC 106 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 107 LMMAFLILFAL 117 >gi|288903394|ref|YP_003434116.1| ATP synthase subunit 9 [Candida maltosa] gi|162401907|gb|ABX09999.1| ATP synthase subunit 9 [Candida maltosa] Length = 76 Score = 64.5 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 25/73 (34%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F LL+ LLL+ + Sbjct: 64 FCLLISFLLLYAV 76 >gi|145603091|ref|XP_362034.2| hypothetical protein [Magnaporthe oryzae 70-15] gi|145011413|gb|EDJ96069.1| predicted protein [Magnaporthe oryzae 70-15] Length = 154 Score = 64.5 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 32/65 (49%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 G+A +G+ + + +F + G RNP + ++ +E+ GLF L+V Sbjct: 89 GAGLATIGLAGAGVGIGTVFGALIQGVARNPALRGQLFSYAILGFAFSEATGLFALMVAF 148 Query: 86 LLLFV 90 LL++V Sbjct: 149 LLMYV 153 >gi|301768290|ref|XP_002919558.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] Length = 136 Score = 64.5 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 39/71 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+++VG+A +G+ + +F + + G RN + ++ ++E++GLF Sbjct: 66 AAKFISVGVATVGVAGSRAXIGTVFGSLIIGYARNLSLKQQLFSHAILGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+ L+LF + Sbjct: 126 LMAAFLILFAM 136 >gi|91206106|ref|YP_538461.1| F0F1 ATP synthase subunit C [Rickettsia bellii RML369-C] gi|157826461|ref|YP_001495525.1| F0F1 ATP synthase subunit C [Rickettsia bellii OSU 85-389] gi|123084547|sp|Q1RGZ2|ATPL_RICBR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810028|sp|A8GUJ2|ATPL_RICB8 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|91069650|gb|ABE05372.1| ATP synthase C chain [Rickettsia bellii RML369-C] gi|157801765|gb|ABV78488.1| F0F1 ATP synthase subunit C [Rickettsia bellii OSU 85-389] Length = 74 Score = 64.1 bits (155), Expect = 5e-09, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 44/70 (62%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ VG +GM AL VSNIF++ L+ RNP A + LI A +AE++GLF Sbjct: 4 VSLKFIGVGCMAIGMLGAALGVSNIFSSLLNSIARNPSATEQLQRMALIGAGLAEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|148746164|dbj|BAF63847.1| putative F0 subunit of ATP synthase [Hydroides elegans] Length = 156 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 33/66 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A G+ + +F + + RNP + + ++ ++E++GLF Sbjct: 68 AAKYIGAGCATAGVAGSGAGIGTVFGSLMISVARNPSMKAQLFSYAILGFALSEAMGLFC 127 Query: 81 LLVVML 86 L++ L Sbjct: 128 LMIAFL 133 >gi|109459801|ref|XP_001072698.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] gi|293344576|ref|XP_002725827.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] Length = 136 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ V +F + + G RNP + ++E++GLF Sbjct: 66 AAKFIGAGTATVGVAGSGAGVGTVFGSLIIGDARNPSLKQQLFAYAIPGFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 126 LMVAFLILFAM 136 >gi|32454284|gb|AAP82941.1| putative ATP synthase c-subunit [Paralichthys olivaceus] Length = 120 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 50 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAVGLFC 109 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 110 LMVAFLILFAM 120 >gi|296200751|ref|XP_002747736.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 131 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 5/71 (7%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ VG+A + +F + +SG RNP ++ ++E GLF Sbjct: 66 AAKFIGVGVA-----GSGTGIGTVFGSLISGYGRNPSLKQQLFCYGILGFALSEVTGLFC 120 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 121 LMVAFLILFAM 131 >gi|115292010|gb|AAI22236.1| Zgc:153316 [Danio rerio] Length = 128 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 58 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 117 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 118 LMMAFLLLFA 127 >gi|321469540|gb|EFX80520.1| hypothetical protein DAPPUDRAFT_304028 [Daphnia pulex] Length = 130 Score = 64.1 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +IF + + G RNP + ++ ++E++GLF Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGSIFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 119 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 120 LMMAFLLLFA 129 >gi|38640867|ref|NP_943642.1| ATP synthase subunit 9 [Candida parapsilosis] gi|62736215|ref|YP_227574.1| ATP synthase subunit 9 [Candida orthopsilosis] gi|312233387|ref|YP_004021599.1| Atp9p [Candida jiufengensis] gi|396470|emb|CAA52434.1| ATP synthase subunit 9 [Candida parapsilosis] gi|62177727|gb|AAX73019.1| ATP synthase subunit 9 [Candida orthopsilosis] gi|170785414|gb|ACB37771.1| ATP synthase subunit 9 [Candida orthopsilosis] gi|183229569|gb|ACC60283.1| Atp9p [Candida parapsilosis] gi|224474104|gb|ACN49295.1| Atp9p [Candida orthopsilosis] gi|268373374|gb|ACZ03946.1| Atp9p [Candida jiufengensis] Length = 76 Score = 63.7 bits (154), Expect = 7e-09, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYAV 76 >gi|225713172|gb|ACO12432.1| ATP synthase lipid-binding protein, mitochondrial precursor [Lepeophtheirus salmonis] gi|225713890|gb|ACO12791.1| ATP synthase lipid-binding protein, mitochondrial precursor [Lepeophtheirus salmonis] gi|290563012|gb|ADD38900.1| ATP synthase lipid-binding protein, mitochondrial [Lepeophtheirus salmonis] Length = 122 Score = 63.7 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 52 AAKFIGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 112 LMMAFLLLFA 121 >gi|17987828|ref|NP_540462.1| F0F1 ATP synthase subunit C [Brucella melitensis bv. 1 str. 16M] gi|23501287|ref|NP_697414.1| F0F1 ATP synthase subunit C [Brucella suis 1330] gi|62289373|ref|YP_221166.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 1 str. 9-941] gi|82699298|ref|YP_413872.1| F0F1 ATP synthase subunit C [Brucella melitensis biovar Abortus 2308] gi|148559676|ref|YP_001258410.1| F0F1 ATP synthase subunit C [Brucella ovis ATCC 25840] gi|153007846|ref|YP_001369061.1| F0F1 ATP synthase subunit C [Ochrobactrum anthropi ATCC 49188] gi|161618359|ref|YP_001592246.1| F0F1 ATP synthase subunit C [Brucella canis ATCC 23365] gi|163842667|ref|YP_001627071.1| F0F1 ATP synthase subunit C [Brucella suis ATCC 23445] gi|189023626|ref|YP_001934394.1| F0F1 ATP synthase subunit C [Brucella abortus S19] gi|225626898|ref|ZP_03784937.1| ATP synthase C chain [Brucella ceti str. Cudo] gi|225851923|ref|YP_002732156.1| F0F1 ATP synthase subunit C [Brucella melitensis ATCC 23457] gi|237814860|ref|ZP_04593858.1| ATP synthase C chain [Brucella abortus str. 2308 A] gi|254688688|ref|ZP_05151942.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 6 str. 870] gi|254693171|ref|ZP_05154999.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 3 str. Tulya] gi|254696815|ref|ZP_05158643.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 2 str. 86/8/59] gi|254701195|ref|ZP_05163023.1| F0F1 ATP synthase subunit C [Brucella suis bv. 5 str. 513] gi|254703740|ref|ZP_05165568.1| F0F1 ATP synthase subunit C [Brucella suis bv. 3 str. 686] gi|254707880|ref|ZP_05169708.1| F0F1 ATP synthase subunit C [Brucella pinnipedialis M163/99/10] gi|254709536|ref|ZP_05171347.1| F0F1 ATP synthase subunit C [Brucella pinnipedialis B2/94] gi|254713047|ref|ZP_05174858.1| F0F1 ATP synthase subunit C [Brucella ceti M644/93/1] gi|254716600|ref|ZP_05178411.1| F0F1 ATP synthase subunit C [Brucella ceti M13/05/1] gi|254718567|ref|ZP_05180378.1| F0F1 ATP synthase subunit C [Brucella sp. 83/13] gi|254729722|ref|ZP_05188300.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 4 str. 292] gi|256031030|ref|ZP_05444644.1| F0F1 ATP synthase subunit C [Brucella pinnipedialis M292/94/1] gi|256044105|ref|ZP_05447016.1| F0F1 ATP synthase subunit C [Brucella melitensis bv. 1 str. Rev.1] gi|256060522|ref|ZP_05450691.1| F0F1 ATP synthase subunit C [Brucella neotomae 5K33] gi|256112903|ref|ZP_05453819.1| F0F1 ATP synthase subunit C [Brucella melitensis bv. 3 str. Ether] gi|256159088|ref|ZP_05456914.1| F0F1 ATP synthase subunit C [Brucella ceti M490/95/1] gi|256254433|ref|ZP_05459969.1| F0F1 ATP synthase subunit C [Brucella ceti B1/94] gi|256256935|ref|ZP_05462471.1| F0F1 ATP synthase subunit C [Brucella abortus bv. 9 str. C68] gi|256264565|ref|ZP_05467097.1| ATP synthase subunit C [Brucella melitensis bv. 2 str. 63/9] gi|256368839|ref|YP_003106345.1| ATP synthase subunit C [Brucella microti CCM 4915] gi|260168162|ref|ZP_05754973.1| F0F1 ATP synthase subunit C [Brucella sp. F5/99] gi|260545874|ref|ZP_05821615.1| H+transporting two-sector ATPase C subunit [Brucella abortus NCTC 8038] gi|260563464|ref|ZP_05833950.1| ATP synthase subunit C [Brucella melitensis bv. 1 str. 16M] gi|260567005|ref|ZP_05837475.1| ATP synthase subunit C [Brucella suis bv. 4 str. 40] gi|260754164|ref|ZP_05866512.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 6 str. 870] gi|260757384|ref|ZP_05869732.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 4 str. 292] gi|260761208|ref|ZP_05873551.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 2 str. 86/8/59] gi|260883189|ref|ZP_05894803.1| H+transporting two-sector ATPase C subunit [Brucella abortus bv. 9 str. C68] gi|261213411|ref|ZP_05927692.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 3 str. Tulya] gi|261218399|ref|ZP_05932680.1| H+transporting two-sector ATPase C subunit [Brucella ceti M13/05/1] gi|261221601|ref|ZP_05935882.1| H+transporting two-sector ATPase C subunit [Brucella ceti B1/94] gi|261315371|ref|ZP_05954568.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M163/99/10] gi|261317062|ref|ZP_05956259.1| H+ transporting two-sector ATPase C subunit [Brucella pinnipedialis B2/94] gi|261320752|ref|ZP_05959949.1| H+transporting two-sector ATPase C subunit [Brucella ceti M644/93/1] gi|261324516|ref|ZP_05963713.1| H+transporting two-sector ATPase C subunit [Brucella neotomae 5K33] gi|261751732|ref|ZP_05995441.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 5 str. 513] gi|261754385|ref|ZP_05998094.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 3 str. 686] gi|261757620|ref|ZP_06001329.1| ATP synthase subunit C [Brucella sp. F5/99] gi|265983542|ref|ZP_06096277.1| H+transporting two-sector ATPase C subunit [Brucella sp. 83/13] gi|265988100|ref|ZP_06100657.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M292/94/1] gi|265990517|ref|ZP_06103074.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 1 str. Rev.1] gi|265994345|ref|ZP_06106902.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 3 str. Ether] gi|265997565|ref|ZP_06110122.1| H+transporting two-sector ATPase C subunit [Brucella ceti M490/95/1] gi|294851766|ref|ZP_06792439.1| F0F1 ATP synthase subunit C [Brucella sp. NVSL 07-0026] gi|297247786|ref|ZP_06931504.1| F-type H+-transporting ATPase subunit C [Brucella abortus bv. 5 str. B3196] gi|306837304|ref|ZP_07470187.1| F0F1 ATP synthase subunit C [Brucella sp. NF 2653] gi|306842326|ref|ZP_07474985.1| F0F1 ATP synthase subunit C [Brucella sp. BO2] gi|306845017|ref|ZP_07477598.1| F0F1 ATP synthase subunit C [Brucella sp. BO1] gi|2984781|gb|AAC08029.1| ATP synthase subunit C [Brucella melitensis] gi|17983556|gb|AAL52726.1| ATP synthase c chain [Brucella melitensis bv. 1 str. 16M] gi|23347175|gb|AAN29329.1| ATP synthase F0, C subunit [Brucella suis 1330] gi|62195505|gb|AAX73805.1| AtpE, ATP synthase F0, C subunit [Brucella abortus bv. 1 str. 9-941] gi|82615399|emb|CAJ10368.1| Eubacterial/plasma membrane H+-transporting two-sector ATPase, C subunit:H+-transporting two-sector ATPase, C subunit [Brucella melitensis biovar Abortus 2308] gi|148370933|gb|ABQ60912.1| ATP synthase F0, C subunit [Brucella ovis ATCC 25840] gi|151559734|gb|ABS13232.1| H+transporting two-sector ATPase C subunit [Ochrobactrum anthropi ATCC 49188] gi|161335170|gb|ABX61475.1| ATP synthase C chain [Brucella canis ATCC 23365] gi|163673390|gb|ABY37501.1| ATP synthase C chain [Brucella suis ATCC 23445] gi|189019198|gb|ACD71920.1| ATP synthase subunit C [Brucella abortus S19] gi|225618555|gb|EEH15598.1| ATP synthase C chain [Brucella ceti str. Cudo] gi|225640288|gb|ACO00202.1| ATP synthase C chain [Brucella melitensis ATCC 23457] gi|237789697|gb|EEP63907.1| ATP synthase C chain [Brucella abortus str. 2308 A] gi|255998997|gb|ACU47396.1| ATP synthase subunit C [Brucella microti CCM 4915] gi|260097281|gb|EEW81156.1| H+transporting two-sector ATPase C subunit [Brucella abortus NCTC 8038] gi|260153480|gb|EEW88572.1| ATP synthase subunit C [Brucella melitensis bv. 1 str. 16M] gi|260156523|gb|EEW91603.1| ATP synthase subunit C [Brucella suis bv. 4 str. 40] gi|260667702|gb|EEX54642.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 4 str. 292] gi|260671640|gb|EEX58461.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 2 str. 86/8/59] gi|260674272|gb|EEX61093.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 6 str. 870] gi|260872717|gb|EEX79786.1| H+transporting two-sector ATPase C subunit [Brucella abortus bv. 9 str. C68] gi|260915018|gb|EEX81879.1| H+ transporting two-sector ATPase C subunit [Brucella abortus bv. 3 str. Tulya] gi|260920185|gb|EEX86838.1| H+transporting two-sector ATPase C subunit [Brucella ceti B1/94] gi|260923488|gb|EEX90056.1| H+transporting two-sector ATPase C subunit [Brucella ceti M13/05/1] gi|261293442|gb|EEX96938.1| H+transporting two-sector ATPase C subunit [Brucella ceti M644/93/1] gi|261296285|gb|EEX99781.1| H+ transporting two-sector ATPase C subunit [Brucella pinnipedialis B2/94] gi|261300496|gb|EEY03993.1| H+transporting two-sector ATPase C subunit [Brucella neotomae 5K33] gi|261304397|gb|EEY07894.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M163/99/10] gi|261737604|gb|EEY25600.1| ATP synthase subunit C [Brucella sp. F5/99] gi|261741485|gb|EEY29411.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 5 str. 513] gi|261744138|gb|EEY32064.1| H+ transporting two-sector ATPase C subunit [Brucella suis bv. 3 str. 686] gi|262552033|gb|EEZ08023.1| H+transporting two-sector ATPase C subunit [Brucella ceti M490/95/1] gi|262765458|gb|EEZ11247.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 3 str. Ether] gi|263001301|gb|EEZ13876.1| H+transporting two-sector ATPase C subunit [Brucella melitensis bv. 1 str. Rev.1] gi|263094930|gb|EEZ18638.1| ATP synthase subunit C [Brucella melitensis bv. 2 str. 63/9] gi|264660297|gb|EEZ30558.1| H+transporting two-sector ATPase C subunit [Brucella pinnipedialis M292/94/1] gi|264662134|gb|EEZ32395.1| H+transporting two-sector ATPase C subunit [Brucella sp. 83/13] gi|294820355|gb|EFG37354.1| F0F1 ATP synthase subunit C [Brucella sp. NVSL 07-0026] gi|297174955|gb|EFH34302.1| F-type H+-transporting ATPase subunit C [Brucella abortus bv. 5 str. B3196] gi|306274649|gb|EFM56438.1| F0F1 ATP synthase subunit C [Brucella sp. BO1] gi|306287542|gb|EFM59001.1| F0F1 ATP synthase subunit C [Brucella sp. BO2] gi|306407617|gb|EFM63813.1| F0F1 ATP synthase subunit C [Brucella sp. NF 2653] gi|326408422|gb|ADZ65487.1| ATP synthase subunit C [Brucella melitensis M28] gi|326538136|gb|ADZ86351.1| ATP synthase C chain [Brucella melitensis M5-90] Length = 75 Score = 63.7 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 35/57 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+AC GM AL + NIF YLSGA RNP AA + ++ + E+LG Sbjct: 5 AAKYIGAGLACFGMAGTALGLGNIFGQYLSGALRNPSAADSQFGRLVFGFAVTEALG 61 >gi|15964589|ref|NP_384942.1| F0F1 ATP synthase subunit C [Sinorhizobium meliloti 1021] gi|150395673|ref|YP_001326140.1| F0F1 ATP synthase subunit C [Sinorhizobium medicae WSM419] gi|307309335|ref|ZP_07588998.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti BL225C] gi|307320071|ref|ZP_07599492.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti AK83] gi|15073767|emb|CAC45408.1| Probable ATP synthase subunit C transmembrane protein [Sinorhizobium meliloti 1021] gi|150027188|gb|ABR59305.1| H+transporting two-sector ATPase C subunit [Sinorhizobium medicae WSM419] gi|306894286|gb|EFN25051.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti AK83] gi|306900204|gb|EFN30822.1| H+transporting two-sector ATPase C subunit [Sinorhizobium meliloti BL225C] Length = 75 Score = 63.7 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 28/57 (49%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+ACLGM AL + NIF +YLSGA RNP AA ++ + E+LG Sbjct: 5 AAKYIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADGQFGRLVFGFAVTEALG 61 >gi|312373266|gb|EFR21041.1| hypothetical protein AND_17673 [Anopheles darlingi] Length = 1344 Score = 63.7 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 27/50 (54%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + +F + + G RNP + ++ ++E++GLF L++ LLLF Sbjct: 1294 IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFA 1343 >gi|12585569|ref|NP_075034.1| ATPase subunit 9 [Candida albicans SC5314] gi|301353203|ref|YP_003795201.1| Atp9p [Candida subhashii] gi|74623667|sp|Q9B8D5|ATP9_CANAL RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|12539620|gb|AAG59591.1|AF285261_4 ATPase subunit 9 [Candida albicans SC5314] gi|262410220|gb|ACY66213.1| Atp9p [Candida subhashii] Length = 76 Score = 63.7 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S + ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYAV 76 >gi|319899219|ref|YP_004159312.1| ATP synthase, subunit C [Bartonella clarridgeiae 73] gi|319403183|emb|CBI76742.1| ATP synthase, subunit C [Bartonella clarridgeiae 73] gi|319404577|emb|CBI78183.1| ATP synthase, subunit C [Bartonella rochalimae ATCC BAA-1498] gi|319406084|emb|CBI79714.1| ATP synthase, subunit C [Bartonella sp. AR 15-3] gi|319407568|emb|CBI81218.1| ATP synthase, subunit C [Bartonella sp. 1-1C] Length = 76 Score = 63.7 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 28/58 (48%), Positives = 37/58 (63%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 5 LAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 62 >gi|118590786|ref|ZP_01548187.1| F0F1 ATP synthase subunit C [Stappia aggregata IAM 12614] gi|118436762|gb|EAV43402.1| F0F1 ATP synthase subunit C [Stappia aggregata IAM 12614] Length = 74 Score = 63.3 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 33/70 (47%), Positives = 45/70 (64%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGNYLAGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLFV 90 LLV ++LLF Sbjct: 65 LLVALILLFA 74 >gi|304391256|ref|ZP_07373200.1| ATP synthase subunit 9 [Ahrensia sp. R2A130] gi|303296612|gb|EFL90968.1| ATP synthase subunit 9 [Ahrensia sp. R2A130] Length = 78 Score = 63.3 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 34/59 (57%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 KY+ G+AC+GM A+ + +IF +LSGA RNP AA +++ + E+LG Sbjct: 6 PEMGKYIGAGLACIGMAGAAIGLGSIFGNFLSGALRNPSAADGQFGRLILGFAVTEALG 64 >gi|296190512|ref|XP_002743224.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 136 Score = 63.3 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQRLFSCAILSFALSEAMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+ F + Sbjct: 126 LMVAFLIFFAM 136 >gi|161723852|ref|NP_359663.2| F0F1 ATP synthase subunit C [Rickettsia conorii str. Malish 7] gi|238650339|ref|YP_002916191.1| F0F1 ATP synthase subunit C [Rickettsia peacockii str. Rustic] gi|20454820|sp|Q92JP1|ATPL_RICCN RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|259585527|sp|C4K0P2|ATPL_RICPU RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|238624437|gb|ACR47143.1| F0F1 ATP synthase subunit C [Rickettsia peacockii str. Rustic] Length = 74 Score = 63.3 bits (153), Expect = 9e-09, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 44/70 (62%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ G+ +GM AL VSNIF++ LS RNP A + LI A +AE++GLF Sbjct: 4 VSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|281348310|gb|EFB23894.1| hypothetical protein PANDA_009005 [Ailuropoda melanoleuca] Length = 102 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 32 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 91 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 92 LMVAFLILFAM 102 >gi|157964087|ref|YP_001498911.1| F0F1 ATP synthase subunit C [Rickettsia massiliae MTU5] gi|157843863|gb|ABV84364.1| ATP synthase C chain [Rickettsia massiliae MTU5] Length = 78 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 43/70 (61%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ G +GM AL VSNIF++ LS RNP A + LI A +AE++GLF Sbjct: 8 VSLKFIGTGFMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLF 67 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 68 SFVIAMLLIF 77 >gi|161087399|gb|ABX56859.1| ATP synthase subunit 9 mitochondrial precursor [Litopenaeus vannamei] Length = 116 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 46 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 105 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 106 LMMAFLLLFA 115 >gi|297493594|gb|ADI40519.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C3 [Scotophilus kuhlii] Length = 119 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 33/63 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 57 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 116 Query: 81 LLV 83 L+V Sbjct: 117 LMV 119 >gi|330813671|ref|YP_004357910.1| ATP synthase C chain [Candidatus Pelagibacter sp. IMCC9063] gi|327486766|gb|AEA81171.1| ATP synthase C chain [Candidatus Pelagibacter sp. IMCC9063] Length = 75 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+AC+ + L + NIF +YLS A RNP AA +L+ +AE+ GLF Sbjct: 5 AAKMIGAGIACIALAGAGLGIGNIFGSYLSAAMRNPSAAQKQFPNLLLGFALAEATGLFG 64 Query: 81 LLVVMLLLFV 90 L+V +++LF Sbjct: 65 LVVALIILFA 74 >gi|83945332|ref|ZP_00957680.1| ATP synthase subunit C [Oceanicaulis alexandrii HTCC2633] gi|83851166|gb|EAP89023.1| ATP synthase subunit C [Oceanicaulis alexandrii HTCC2633] Length = 75 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 33/71 (46%), Positives = 47/71 (66%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A GM AL V NIF+++L+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGLATFGMLGAALGVGNIFSSFLAGALRNPSAAQGQFGNLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLFVI 91 LL+ +LLLFV+ Sbjct: 65 LLIALLLLFVV 75 >gi|289620957|emb|CBI52691.1| unnamed protein product [Sordaria macrospora] Length = 174 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 35/69 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 79 SKNLGMGAAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 138 Query: 82 LVVMLLLFV 90 +V ++ FV Sbjct: 139 MVALMAKFV 147 >gi|126277462|ref|XP_001376036.1| PREDICTED: similar to P2 gene for c subunit of mitochondrial ATP synthase [Monodelphis domestica] Length = 104 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A + M + +F + + G RNP ++ ++E++GLF Sbjct: 35 AAKFIGAGAATVEMAGSGTGIGTVFGSLIIGYARNPSLKQQLF-YAILGFALSEAMGLFC 93 Query: 81 LLVVMLLLFVI 91 L+V L LFV+ Sbjct: 94 LMVTFLSLFVM 104 >gi|11466046|ref|NP_039507.1| ATPase 9 [Schizosaccharomyces pombe] gi|23505435|ref|NP_700364.1| ATP synthase F0 subunit 9 [Schizosaccharomyces octosporus] gi|3915611|sp|P21537|ATP9_SCHPO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|2654252|emb|CAA38292.1| ATPase 9 [Schizosaccharomyces pombe] gi|23397384|gb|AAN31939.1| ATP synthase F0 subunit 9 [Schizosaccharomyces octosporus] Length = 74 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A +G+ + + IF+ +SG RNP + ++ + E+ GLF Sbjct: 4 AAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATGLFC 63 Query: 81 LLVVMLLLFV 90 L++ L+++ Sbjct: 64 LMLAFLIIYA 73 >gi|324105207|gb|ADY18366.1| mitochondrial ATP synthase subunit 9 precursor-like protein [Glycera tridactyla] Length = 90 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 20 AAKYIGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 79 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 80 LMMAFLILFA 89 >gi|315122433|ref|YP_004062922.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495835|gb|ADR52434.1| H+transporting two-sector ATPase C subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 45/72 (62%), Positives = 54/72 (75%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 ME A YYS AAKY+A+GMACLGMG VALA+ NIF++YLSGA RNP AA+ + Sbjct: 1 METEAARIAISYYSGAAKYIAIGMACLGMGFVALAIGNIFSSYLSGALRNPSAAADQQAR 60 Query: 66 VLIFAVIAESLG 77 VL+FA +AESLG Sbjct: 61 VLVFAAVAESLG 72 >gi|311270030|ref|XP_003132736.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 1 [Sus scrofa] gi|311270032|ref|XP_003132737.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 2 [Sus scrofa] gi|311270034|ref|XP_003132738.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like isoform 3 [Sus scrofa] Length = 136 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RN + ++ ++E++ LF Sbjct: 66 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNLSLKQQLFSCAILGFALSEAMELFC 125 Query: 81 LLVVMLLLFVI 91 L+V L+L + Sbjct: 126 LMVAFLILLAM 136 >gi|165932584|ref|YP_001649373.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. Iowa] gi|15619060|gb|AAL02564.1| ATP synthase C chain [Rickettsia conorii str. Malish 7] gi|165907671|gb|ABY71967.1| ATP synthase C chain [Rickettsia rickettsii str. Iowa] Length = 78 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 44/70 (62%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ G+ +GM AL VSNIF++ LS RNP A + LI A +AE++GLF Sbjct: 8 VSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLF 67 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 68 SFVIAMLLIF 77 >gi|310915116|emb|CBM41825.1| ATP synthase subunit 9 [Millerozyma farinosa] Length = 76 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 27/73 (36%), Positives = 43/73 (58%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 LAAKY+ MA LG+G A+ ++ +F ++G RNP + + ++ +AE+ GL Sbjct: 4 ELAAKYIGASMATLGLGGAAIGIALVFVALINGTSRNPSLRATLFPQAMLGFALAEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F LLV LLL+ + Sbjct: 64 FCLLVSFLLLYAV 76 >gi|52782701|sp|P92811|ATP9_KLULA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|1857253|gb|AAB48406.1| Fo ATP synthase subunit 9 [Kluyveromyces lactis] Length = 76 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F+ + G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLKDTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 CLMISFLLLYAV 76 >gi|197104051|ref|YP_002129428.1| AtpE, ATP synthase F0, C subunit [Phenylobacterium zucineum HLK1] gi|196477471|gb|ACG76999.1| AtpE, ATP synthase F0, C subunit [Phenylobacterium zucineum HLK1] Length = 74 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 27/69 (39%), Positives = 43/69 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM + V +F+ +L GA RNP AA T +++ A + E+LG+ Sbjct: 5 AAKYIGAGLATLGMIGAGIGVGTLFSGFLQGATRNPSAAGGQFTNLILGAALTEALGILA 64 Query: 81 LLVVMLLLF 89 ++ +L+LF Sbjct: 65 FVLGLLILF 73 >gi|260460368|ref|ZP_05808620.1| H+transporting two-sector ATPase C subunit [Mesorhizobium opportunistum WSM2075] gi|259034013|gb|EEW35272.1| H+transporting two-sector ATPase C subunit [Mesorhizobium opportunistum WSM2075] Length = 74 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 33/69 (47%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF +YLSGA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLF 89 LL+ +L LF Sbjct: 65 LLIALLALF 73 >gi|67458421|ref|YP_246045.1| F0F1 ATP synthase subunit C [Rickettsia felis URRWXCal2] gi|75537107|sp|Q4UNH9|ATPL_RICFE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|67003954|gb|AAY60880.1| ATP synthase C chain [Rickettsia felis URRWXCal2] Length = 74 Score = 62.9 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 46/70 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ +G+ +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF Sbjct: 4 VSLKFIGIGLMAIGMYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|319408193|emb|CBI81846.1| ATP synthase, subunit C [Bartonella schoenbuchensis R1] Length = 76 Score = 62.6 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 4 ALAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 62 >gi|209736002|gb|ACI68870.1| ATP synthase lipid-binding protein, mitochondrial precursor [Salmo salar] Length = 95 Score = 62.6 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 26 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 85 Query: 81 LLVVMLLLFV 90 L+V L+LF Sbjct: 86 LMVAFLILFA 95 >gi|254501631|ref|ZP_05113782.1| ATP synthase subunit C, putative [Labrenzia alexandrii DFL-11] gi|307941611|ref|ZP_07656966.1| conserved domain protein [Roseibium sp. TrichSKD4] gi|222437702|gb|EEE44381.1| ATP synthase subunit C, putative [Labrenzia alexandrii DFL-11] gi|307775219|gb|EFO34425.1| conserved domain protein [Roseibium sp. TrichSKD4] Length = 75 Score = 62.6 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 27/57 (47%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+ACLGMG A+A+ IF YL+GA RNP AA ++ + E+LG Sbjct: 5 AAKYIGAGIACLGMGGAAIALGTIFGNYLNGALRNPTAADGQFGRLVFGFAVTEALG 61 >gi|222085043|ref|YP_002543572.1| ATP synthase protein [Agrobacterium radiobacter K84] gi|221722491|gb|ACM25647.1| ATP synthase protein [Agrobacterium radiobacter K84] Length = 75 Score = 62.6 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAK++ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 5 AAKFIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 61 >gi|150456406|ref|YP_001331014.1| ATP synthase, subunit 9 [Vanderwaltozyma polyspora] gi|218563489|sp|A6H4Q2|ATP9_VANPO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|149999733|emb|CAN85575.1| ATP synthase, subunit 9 [Vanderwaltozyma polyspora] Length = 76 Score = 62.6 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSLRETLFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LL++ + Sbjct: 65 CLMISFLLIYAV 76 >gi|170747147|ref|YP_001753407.1| ATP synthase F0, C subunit [Methylobacterium radiotolerans JCM 2831] gi|170653669|gb|ACB22724.1| ATP synthase F0, C subunit [Methylobacterium radiotolerans JCM 2831] Length = 75 Score = 62.6 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 37/59 (62%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +AAKY+ G+ACLGM + + N+F +L+GA RNP AA + +L+ + E+LG Sbjct: 3 PVAAKYIGAGLACLGMAGAGIGLGNLFGQFLAGALRNPSAADGQRATLLLGFALTEALG 61 >gi|71996409|ref|NP_001022966.1| hypothetical protein Y82E9BR.3 [Caenorhabditis elegans] gi|268571193|ref|XP_002640963.1| Hypothetical protein CBG11706 [Caenorhabditis briggsae] gi|308479989|ref|XP_003102202.1| hypothetical protein CRE_05884 [Caenorhabditis remanei] gi|75021564|sp|Q9BKS0|AT5G_CAEEL RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATP synthase c subunit; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|308191401|sp|A8XDX2|AT5G_CAEBR RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|13435326|gb|AAK26152.1| Hypothetical protein Y82E9BR.3 [Caenorhabditis elegans] gi|187030080|emb|CAP30867.1| hypothetical protein CBG_11706 [Caenorhabditis briggsae AF16] gi|308262128|gb|EFP06081.1| hypothetical protein CRE_05884 [Caenorhabditis remanei] Length = 116 Score = 62.2 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G+ + N+F + G RNP + ++ ++E++GLF Sbjct: 46 AAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 105 Query: 81 LLVVMLLLFVI 91 L + ++LF + Sbjct: 106 LTMGFMILFAL 116 >gi|157827896|ref|YP_001494138.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. 'Sheila Smith'] gi|157800377|gb|ABV75630.1| F0F1 ATP synthase subunit C [Rickettsia rickettsii str. 'Sheila Smith'] Length = 72 Score = 62.2 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 44/70 (62%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ G+ +GM AL VSNIF++ LS RNP A + LI A +AE++GLF Sbjct: 2 VSLKFIGTGLMAIGMYGAALGVSNIFSSLLSSIARNPSATENLQRMALIGAGLAEAMGLF 61 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 62 SFVIAMLLIF 71 >gi|297286393|ref|XP_001082964.2| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] Length = 138 Score = 62.2 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL-GLF 79 A K++ A +G+ + +F + + G RNP + ++ ++E++ GLF Sbjct: 67 ATKFIGAEAATVGVAGSVAGIGIVFGSLIIGYARNPSLRQXLFSYAILGFTLSEAMGGLF 126 Query: 80 LLLVVMLLLFVI 91 L+V +LF + Sbjct: 127 CLMVTFHILFTV 138 >gi|328544977|ref|YP_004305086.1| H+transporting two-sector ATPase C subunit [polymorphum gilvum SL003B-26A1] gi|326414719|gb|ADZ71782.1| H+transporting two-sector ATPase C subunit [Polymorphum gilvum SL003B-26A1] Length = 74 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 28/57 (49%), Positives = 36/57 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 AAKY+ G+ACLGMG A+A+ IF YLSGA RNP AA ++ + E+LG Sbjct: 5 AAKYIGAGIACLGMGGAAIALGTIFGNYLSGALRNPSAADGQFGRLVFGFAVTEALG 61 >gi|157825172|ref|YP_001492892.1| F0F1 ATP synthase subunit C [Rickettsia akari str. Hartford] gi|254810027|sp|A8GLV9|ATPL_RICAH RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|157799130|gb|ABV74384.1| F0F1 ATP synthase subunit C [Rickettsia akari str. Hartford] Length = 74 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 46/70 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ +G+ +G+ AL VSNIF++ LS RNP AA + LI A +AE++GLF Sbjct: 4 VSLKFIGIGLMAIGIYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|298294368|ref|YP_003696307.1| H+transporting two-sector ATPase C subunit [Starkeya novella DSM 506] gi|296930879|gb|ADH91688.1| H+transporting two-sector ATPase C subunit [Starkeya novella DSM 506] Length = 75 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 31/60 (51%), Positives = 39/60 (65%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAK++ G+ACLGMGL A+ V NIF +LSGA RNP AA I A +AE LG+ Sbjct: 3 PIAAKFLGAGLACLGMGLAAIGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGLGI 62 >gi|297493586|gb|ADI40515.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C2 [Scotophilus kuhlii] Length = 120 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 62 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLF 120 >gi|13577|emb|CAA28961.1| unnamed protein product [Saccharomyces cerevisiae] Length = 76 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 23/72 (31%), Positives = 41/72 (56%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ V + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGVGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LLLF + Sbjct: 65 CLMVSFLLLFGV 76 >gi|6226533|ref|NP_009319.1| Oli1p [Saccharomyces cerevisiae S288c] gi|224588080|ref|YP_002640608.1| F0-ATP synthase subunit 9 [Saccharomyces pastorianus Weihenstephan 34/70] gi|48428794|sp|P61828|ATP9_SACDO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|48428795|sp|P61829|ATP9_YEAST RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein; AltName: Full=Oligomycin resistance protein 1 gi|7436173|pir||S44067 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - yeast (Saccharomyces sp.) mitochondrion gi|300193124|pdb|2WPD|J Chain J, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193125|pdb|2WPD|K Chain K, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193126|pdb|2WPD|L Chain L, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193127|pdb|2WPD|M Chain M, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193128|pdb|2WPD|N Chain N, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193129|pdb|2WPD|O Chain O, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193130|pdb|2WPD|P Chain P, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193131|pdb|2WPD|Q Chain Q, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193132|pdb|2WPD|R Chain R, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|300193133|pdb|2WPD|S Chain S, The Mg.Adp Inhibited State Of The Yeast F1c10 Atp Synthase gi|307568107|pdb|2XOK|K Chain K, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568108|pdb|2XOK|L Chain L, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568109|pdb|2XOK|M Chain M, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568110|pdb|2XOK|N Chain N, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568111|pdb|2XOK|O Chain O, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568112|pdb|2XOK|P Chain P, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568113|pdb|2XOK|Q Chain Q, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568114|pdb|2XOK|R Chain R, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568115|pdb|2XOK|S Chain S, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|307568116|pdb|2XOK|T Chain T, Refined Structure Of Yeast F1c10 Atpase Complex To 3 A Resolution gi|4588695|gb|AAD26181.1|AF114937_1 ATP synthase subunit 9 [Saccharomyces sp. IFO 1815] gi|4588700|gb|AAD26183.1|AF114940_1 ATP synthase subunit 9 [Saccharomyces sp. URFJ 50791] gi|6797711|gb|AAD26178.3|AF114930_1 ATP synthase subunit 9 [Saccharomyces bayanus] gi|6797713|gb|AAD26176.3|AF114924_1 ATP synthase subunit 9 [Saccharomyces pastorianus] gi|6797715|gb|AAD26174.3|AF114920_1 ATP synthase subunit 9 [Saccharomyces paradoxus] gi|6797717|gb|AAD26172.3|AF114916_1 ATP synthase subunit 9 [Saccharomyces pastorianus] gi|6797719|gb|AAD26170.3|AF114913_1 ATP synthase subunit 9 [Saccharomyces sp. IFO 1802] gi|6797722|gb|AAD26167.3|AF114908_1 ATP synthase subunit 9 [Saccharomyces paradoxus] gi|6797725|gb|AAD26164.3|AF114902_1 ATP synthase subunit 9 [Saccharomyces pastorianus] gi|13573|emb|CAA27605.1| unnamed protein product [Saccharomyces cerevisiae] gi|58151|emb|CAA30315.1| unnamed protein product [synthetic construct] gi|396250|emb|CAA80904.1| adenosine triphosphatase subunit 9 [Saccharomyces douglasii] gi|559291|gb|AAA67535.1| oli1 [Saccharomyces cerevisiae] gi|3550442|emb|CAA76566.1| mitochondrial ATPase subunit 9 [Saccharomyces sp. CID1] gi|3550446|emb|CAA76567.1| mitochondrial ATPase subunit 9 [Saccharomyces bayanus] gi|3550450|emb|CAA76568.1| mitochondrial ATPase subunit 9 [Saccharomyces sp. S6U] gi|4160380|emb|CAA09838.1| ATP9 [Saccharomyces cerevisiae] gi|152030931|gb|ABS28694.1| ATP synthase F0 subunit 9 [Saccharomyces cerevisiae YJM789] gi|193584770|gb|ACF19673.1| F0-ATP synthase subunit 9 [Saccharomyces pastorianus Weihenstephan 34/70] gi|207340124|gb|ACI24007.1| F0-ATP synthase subunit 9 [Saccharomyces bayanus] gi|256273157|gb|EEU08108.1| Oli1p [Saccharomyces cerevisiae JAY291] gi|283500325|gb|ADB25059.1| ATP synthase subunit 9 [Saccharomyces arboricola] gi|224735|prf||1112163A ATPase 9 mutant Length = 76 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LLLF + Sbjct: 65 CLMVSFLLLFGV 76 >gi|57790531|ref|YP_184726.1| putative ATP synthase, subunit 9 [Kluyveromyces thermotolerans] gi|57161737|emb|CAG25604.1| putative ATP synthase, subunit 9 [Lachancea thermotolerans] Length = 76 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSLKDTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 CLMISFLLLYGV 76 >gi|13615|emb|CAA24079.1| unnamed protein product [Saccharomyces cerevisiae] gi|343758|gb|AAA32146.1| H(+)-transporting ATP synthase [Saccharomyces cerevisiae] gi|343939|gb|AAA32169.1| ATPase proteolipid [Saccharomyces cerevisiae] Length = 76 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 39/72 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F ++G RNP + ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAIFGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LLLF + Sbjct: 65 CLMVSFLLLFGV 76 >gi|288900912|ref|YP_003433760.1| Atp9p [Candida viswanathii] gi|288903512|ref|YP_003434267.1| ATP synthase subunit 9 [Candida sojae] gi|288903519|ref|YP_003434274.1| ATP synthase subunit 9 [Candida sojae] gi|162401874|gb|ABO27133.1| ATP synthase subunit 9 [Candida sojae] gi|162401881|gb|ABO27140.1| ATP synthase subunit 9 [Candida sojae] gi|162401899|gb|ABP03920.1| Atp9p [Candida viswanathii] Length = 76 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 25/73 (34%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A +G+G A+ ++ +F ++G RNP S + ++ +AE+ GL Sbjct: 4 ALAAKYIGASIATIGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALAEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L+V LLL+ + Sbjct: 64 FSLMVSFLLLYGV 76 >gi|225710294|gb|ACO10993.1| ATP synthase lipid-binding protein, mitochondrial precursor [Caligus rogercresseyi] Length = 122 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GLF Sbjct: 52 AAKFIGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 112 LMMAFLLLFA 121 >gi|261334484|emb|CBH17478.1| ATPase subunit 9, putative [Trypanosoma brucei gambiense DAL972] Length = 151 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 85 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 144 Query: 84 VMLLLF 89 L+LF Sbjct: 145 AFLMLF 150 >gi|195975763|ref|YP_002122392.1| ATP synthase subunit 9 [Candida neerlandica] gi|162423303|gb|ABX89442.1| ATP synthase subunit 9 [Candida neerlandica] Length = 76 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A +G+G A+ ++ +F ++G RNP S + ++ +AE+ GL Sbjct: 4 ALAAKYIGASIATIGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALAEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FSLMISFLLLYGV 76 >gi|121602464|ref|YP_988696.1| F0F1 ATP synthase subunit C [Bartonella bacilliformis KC583] gi|120614641|gb|ABM45242.1| ATP synthase F0, C subunit [Bartonella bacilliformis KC583] Length = 76 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 28/59 (47%), Positives = 38/59 (64%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +LAAKY+ G+AC GM AL + NIF +YLSGA RNP AA + ++ + E+LG Sbjct: 4 ALAAKYLGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALG 62 >gi|154245921|ref|YP_001416879.1| H+transporting two-sector ATPase C subunit [Xanthobacter autotrophicus Py2] gi|154160006|gb|ABS67222.1| H+transporting two-sector ATPase C subunit [Xanthobacter autotrophicus Py2] Length = 75 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 30/60 (50%), Positives = 37/60 (61%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 A K++ G+ACLGMGL A+ V NIF +LSGA RNP AA I A +AE LG+ Sbjct: 3 PAAGKFIGAGLACLGMGLAAVGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGLGI 62 >gi|239948441|ref|ZP_04700194.1| ATP synthase C chain [Rickettsia endosymbiont of Ixodes scapularis] gi|239922717|gb|EER22741.1| ATP synthase C chain [Rickettsia endosymbiont of Ixodes scapularis] Length = 72 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 46/70 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ +G+ +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF Sbjct: 2 VSLKFIGIGLMAIGMYGAALGVSNIFSSLLSSIARNPSAAENLQRMALIGAGLAEAMGLF 61 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 62 SFVIAMLLIF 71 >gi|15603901|ref|NP_220416.1| F0F1 ATP synthase subunit C [Rickettsia prowazekii str. Madrid E] gi|6225075|sp|Q9ZEC2|ATPL_RICPR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|3860592|emb|CAA14493.1| ATP SYNTHASE C CHAIN (atpE) [Rickettsia prowazekii] gi|292571617|gb|ADE29532.1| ATP synthase C chain [Rickettsia prowazekii Rp22] Length = 74 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 45/70 (64%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ +G +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF Sbjct: 4 VSLKFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|296210152|ref|XP_002751853.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 112 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 42 AAKFIGAGAATVGVASSGAGIGTVFGSLIIGYARNPSLKQQLFSYTILGFALSEAMGLFC 101 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 102 LMVAFLILFSM 112 >gi|254419283|ref|ZP_05033007.1| ATP synthase subunit C, putative [Brevundimonas sp. BAL3] gi|196185460|gb|EDX80436.1| ATP synthase subunit C, putative [Brevundimonas sp. BAL3] Length = 74 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 30/69 (43%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM AL V NIF +L+GA RNP AA+ + + A +AE+LG+ Sbjct: 5 AAKYIGAGLATLGMIGSALGVGNIFGQFLAGALRNPSAAAGQVGNLFVGAALAEALGILA 64 Query: 81 LLVVMLLLF 89 ++ +L++F Sbjct: 65 FVLGILMIF 73 >gi|319784764|ref|YP_004144240.1| H+transporting two-sector ATPase C subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317170652|gb|ADV14190.1| H+transporting two-sector ATPase C subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 74 Score = 61.0 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 32/69 (46%), Positives = 45/69 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF +YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGSYLAGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 Query: 81 LLVVMLLLF 89 LL+ +L LF Sbjct: 65 LLIALLALF 73 >gi|12583548|emb|CAC27323.1| ATP synthase 9 [Colletotrichum gloeosporioides f. sp. aeschynomenes] Length = 179 Score = 61.0 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 33/65 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 73 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 132 Query: 82 LVVML 86 +V ++ Sbjct: 133 MVALM 137 >gi|256427271|ref|YP_003127036.1| Atp9p [Brettanomyces custersianus] gi|255761582|gb|ACU32819.1| Atp9p [Brettanomyces custersianus] Length = 76 Score = 61.0 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 20/73 (27%), Positives = 40/73 (54%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LA KY+ G+A +G+ + ++ +F ++G RNP ++ ++E+ GL Sbjct: 4 ALAGKYIGAGIATIGLLGAGIGIAIVFAALINGTSRNPGIKDTIFPYAILGFALSEATGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMISFLLLYGV 76 >gi|16124622|ref|NP_419186.1| F0F1 ATP synthase subunit C [Caulobacter crescentus CB15] gi|221233311|ref|YP_002515747.1| F0F1 ATP synthase subunit C [Caulobacter crescentus NA1000] gi|295687787|ref|YP_003591480.1| H+transporting two-sector ATPase C subunit [Caulobacter segnis ATCC 21756] gi|13421522|gb|AAK22354.1| ATP synthase F0, C subunit [Caulobacter crescentus CB15] gi|220962483|gb|ACL93839.1| ATP synthase C chain [Caulobacter crescentus NA1000] gi|295429690|gb|ADG08862.1| H+transporting two-sector ATPase C subunit [Caulobacter segnis ATCC 21756] Length = 74 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 26/71 (36%), Positives = 42/71 (59%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 + AAKY+ G+A LGM + + +F Y GA RNP AA+ + + + + E+LG+ Sbjct: 3 AAAAKYIGAGLAMLGMIGAGVGLGVMFGNYFQGALRNPTAAAQERPMLFLGMALTEALGI 62 Query: 79 FLLLVVMLLLF 89 F L++ L+LF Sbjct: 63 FALVIAFLILF 73 >gi|332188694|ref|ZP_08390408.1| ATP synthase subunit C family protein [Sphingomonas sp. S17] gi|332011258|gb|EGI53349.1| ATP synthase subunit C family protein [Sphingomonas sp. S17] Length = 75 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 44/70 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +GMG+ +L V N+F +L GA RNP AA + + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGMGIASLGVGNVFAKFLEGALRNPGAADSQQGRLFIGFAGAELLGLLA 64 Query: 81 LLVVMLLLFV 90 + +++L+FV Sbjct: 65 FVTMIILVFV 74 >gi|83855053|ref|ZP_00948583.1| ATP synthase subunit C [Sulfitobacter sp. NAS-14.1] gi|83941576|ref|ZP_00954038.1| ATP synthase subunit C [Sulfitobacter sp. EE-36] gi|83842896|gb|EAP82063.1| ATP synthase subunit C [Sulfitobacter sp. NAS-14.1] gi|83847396|gb|EAP85271.1| ATP synthase subunit C [Sulfitobacter sp. EE-36] Length = 78 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 28/76 (36%), Positives = 43/76 (56%) Query: 16 GYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAES 75 G + +++ G+ GMG A+ V N+ YL+GA RNP AA+ + I AE+ Sbjct: 3 GELAQMGQFIGAGLTAFGMGGAAIGVGNVAGNYLAGALRNPSAAAGQTATLFIGIAFAEA 62 Query: 76 LGLFLLLVVMLLLFVI 91 LG+F LV +LL+F + Sbjct: 63 LGIFSFLVALLLMFAV 78 >gi|157803208|ref|YP_001491757.1| F0F1 ATP synthase subunit C [Rickettsia canadensis str. McKiel] gi|254810029|sp|A8EX89|ATPL_RICCK RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|157784471|gb|ABV72972.1| F0F1 ATP synthase subunit C [Rickettsia canadensis str. McKiel] Length = 74 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 46/70 (65%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ VG+ +GM AL VSNIF++ L+ RNP AA + LI A +AE++GLF Sbjct: 4 VSLKFIGVGLMAIGMYGAALGVSNIFSSLLNAIARNPAAAENLQRMALIGAGLAEAIGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 SFVIAMLLIF 73 >gi|4588722|gb|AAD26193.1|AF114952_1 ATP synthase subunit 9 [Naumovia dairenensis] Length = 76 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 39/72 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LLF + Sbjct: 65 CLMISFMLLFAV 76 >gi|12585194|sp|Q9U505|ATP9_MANSE RecName: Full=ATP synthase lipid-binding protein, mitochondrial; AltName: Full=ATPase protein 9; AltName: Full=ATPase subunit c; Flags: Precursor gi|6560655|gb|AAF16705.1|AF117583_1 ATP synthase subunit c [Manduca sexta] Length = 131 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 61 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 120 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 121 LMMAFLLLFA 130 >gi|32441699|ref|NP_861469.1| ATPase subunit 9 [Saccharomyces servazzii] gi|4588729|gb|AAD26195.1|AF114957_1 ATP synthase subunit 9 [Saccharomyces servazzii] gi|32140115|emb|CAD23424.1| ATPase subunit 9 [Saccharomyces servazzii] Length = 76 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 21/72 (29%), Positives = 42/72 (58%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+A +G+ + ++ +F+ ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAGIATIGLLGAGIGIAIVFSALINGVSRNPSLKDQLFSFAILGMALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LLF + Sbjct: 65 CLMISFILLFAV 76 >gi|315498138|ref|YP_004086942.1| ATP synthase f0, c subunit [Asticcacaulis excentricus CB 48] gi|315416150|gb|ADU12791.1| ATP synthase F0, C subunit [Asticcacaulis excentricus CB 48] Length = 74 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 39/68 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K++ G+A LGM + + +F + GA RNP AA + +T + I + E+LG+ Sbjct: 5 AYKFLGAGLAMLGMIGAGIGLGLLFGNFFQGALRNPSAAKSQQTNLFIGMALTEALGILA 64 Query: 81 LLVVMLLL 88 ++ +++L Sbjct: 65 FVIAIMIL 72 >gi|309322026|ref|YP_003935014.1| ATP synthase F0 subunit c [Candida alai] gi|308746503|gb|ADO51038.1| ATP synthase F0 subunit c [Candida alai] Length = 76 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 26/73 (35%), Positives = 45/73 (61%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ +A LG+G A+ ++ +F ++G RNP S ++ ++ ++E+ GL Sbjct: 4 ALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPALRSVLFSQSILGFALSEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F LLV LLL+ + Sbjct: 64 FCLLVSFLLLYAV 76 >gi|302383813|ref|YP_003819636.1| H+transporting two-sector ATPase C subunit [Brevundimonas subvibrioides ATCC 15264] gi|302194441|gb|ADL02013.1| H+transporting two-sector ATPase C subunit [Brevundimonas subvibrioides ATCC 15264] Length = 74 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 39/64 (60%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY +G+A LGM A+ V NIF +L+GA RNP AA+ + + A + E+LG+ + Sbjct: 7 KYFGIGLATLGMLGSAIGVGNIFGNFLAGALRNPSAAAGQVGNLFVGAALVEALGILAFV 66 Query: 83 VVML 86 + +L Sbjct: 67 LGIL 70 >gi|23752286|ref|NP_705624.1| ATP synthase F0 subunit 9 [Schizosaccharomyces japonicus] gi|23506670|gb|AAN37917.1| ATP synthase F0 subunit 9 [Schizosaccharomyces japonicus] Length = 74 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A KYV G+A +G+ + + IF++ ++G RNP + ++ + E+ GLF Sbjct: 4 AMKYVGAGLATIGVSGAGVGIGLIFSSLINGTSRNPSLRPQLFSMAILGFALTEATGLFC 63 Query: 81 LLVVMLLLFV 90 L++ L+++ Sbjct: 64 LMLAFLIIYA 73 >gi|330929319|ref|XP_003302596.1| hypothetical protein PTT_14474 [Pyrenophora teres f. teres 0-1] gi|311321929|gb|EFQ89297.1| hypothetical protein PTT_14474 [Pyrenophora teres f. teres 0-1] Length = 140 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 32/68 (47%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K G+A +G+ + + +F + G RNP ++ AE+ GLF L+ Sbjct: 72 KIQGAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFAFAEATGLFALM 131 Query: 83 VVMLLLFV 90 + LLL+V Sbjct: 132 MSFLLLYV 139 >gi|162951856|ref|YP_001621426.1| ATPase subunit 9 [Debaryomyces hansenii] gi|215275205|sp|A9RAH4|ATP9_DEBHA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|98283737|gb|ABF58075.1| ATPase subunit 9 [Debaryomyces hansenii] Length = 76 Score = 60.2 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 25/73 (34%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ MA LG+G A+ ++ +F ++G RNP + + ++ +AE+ GL Sbjct: 4 ALAAKYIGASMATLGLGGAAIGIALVFVALINGTSRNPSLRATLFPQAILGFALAEACGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ LLL+ + Sbjct: 64 FCLMMSFLLLYAV 76 >gi|313227152|emb|CBY22299.1| unnamed protein product [Oikopleura dioica] gi|313245798|emb|CBY34791.1| unnamed protein product [Oikopleura dioica] Length = 103 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 39/71 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + + ++ ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFALSEAMGLFC 92 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 93 LMVAFLILFAL 103 >gi|51473317|ref|YP_067074.1| F0F1 ATP synthase subunit C [Rickettsia typhi str. Wilmington] gi|81692323|sp|Q68XQ0|ATPL_RICTY RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|51459629|gb|AAU03592.1| ATP synthase [Rickettsia typhi str. Wilmington] Length = 74 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 45/70 (64%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 ++ K++ +G +GM AL VSNIF++ LS RNP AA + LI A +AE++GLF Sbjct: 4 VSLKFIGIGFMAIGMYGAALGVSNIFSSLLSAIARNPSAAENLQRMALIGAGLAEAMGLF 63 Query: 80 LLLVVMLLLF 89 ++ MLL+F Sbjct: 64 AFVIAMLLIF 73 >gi|4588725|gb|AAD26194.1|AF114954_1 ATP synthase subunit 9 [Kazachstania exigua] Length = 76 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 40/71 (56%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+A +G+ + ++ IF ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLF 64 Query: 80 LLLVVMLLLFV 90 L+V +LLF Sbjct: 65 CLMVSFMLLFA 75 >gi|296283434|ref|ZP_06861432.1| F0F1-type ATP synthase subunit c [Citromicrobium bathyomarinum JL354] Length = 75 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G GL AL V N+F ++L GA RNP AA + + I AE LGL Sbjct: 5 AAKLLGAGLAAIGCGLAALGVGNVFASFLDGALRNPGAADGQQGRLFIGFAGAELLGLLA 64 Query: 81 LLVVMLLLFV 90 ++ ++L FV Sbjct: 65 FVIAIILTFV 74 >gi|171681236|ref|XP_001905562.1| hypothetical protein [Podospora anserina S mat+] gi|170940576|emb|CAP65804.1| unnamed protein product [Podospora anserina S mat+] Length = 147 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K G+A +G+ + + +F ++G RNP S + ++ AE+ GLF Sbjct: 77 AGKMQGAGLATIGLSGAGVGIGTVFAALINGTARNPALRSQLFSYAILGFAFAEATGLFA 136 Query: 81 LLVVMLLLFV 90 L+V LLLF Sbjct: 137 LMVAFLLLFA 146 >gi|4588732|gb|AAD26196.1|AF114959_1 ATP synthase subunit 9 [Kazachstania unispora] Length = 80 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G+A +G+ + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAGIATIGLLGAGIGIAIVFAALINGVARNPSLKDQLFSYTILGMALSEATGLF 64 Query: 80 L 80 Sbjct: 65 T 65 >gi|402604|emb|CAA52876.1| ATP synthase subunit 9 [Pichia jadinii] Length = 76 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ ++ +G+ + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAAISTIGLLGAGIGIAIVFAALINGTSRNPSLRNTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LLL+ + Sbjct: 65 CLMVSFLLLYGV 76 >gi|114572371|ref|XP_001167955.1| PREDICTED: similar to P2 gene for c subunit of mitochondrial ATP synthase [Pan troglodytes] Length = 106 Score = 59.9 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 36/72 (50%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAK++ G +G+ + +F + + G RN + ++ + E+LGLF Sbjct: 35 MAAKFIGAGATTVGVAGSGAGIGTVFGSLIIGYARNASLKQQLFSYAILGFALWEALGLF 94 Query: 80 LLLVVMLLLFVI 91 L+V L+LF + Sbjct: 95 CLMVAFLILFAM 106 >gi|313241222|emb|CBY33504.1| unnamed protein product [Oikopleura dioica] Length = 103 Score = 59.5 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 39/71 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + + ++ ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFALSEAMGLFC 92 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 93 LMVAFLILFAL 103 >gi|119629495|gb|EAX09090.1| hCG1639781 [Homo sapiens] Length = 125 Score = 59.5 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAK + G A +G+ + +F + + G RN + + ++E++GLF Sbjct: 65 IAAKLIGAGAATVGVAGSGAGIGKVFGSLIIGYARNLSLKQQLFSYATLGFALSEAMGLF 124 Query: 80 L 80 Sbjct: 125 C 125 >gi|163761008|ref|ZP_02168086.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] gi|162281789|gb|EDQ32082.1| ATP synthase subunit C [Hoeflea phototrophica DFL-43] Length = 75 Score = 59.5 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 38/60 (63%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG + + NIF +YLSGA RNP AA ++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAGIGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 >gi|169620263|ref|XP_001803543.1| hypothetical protein SNOG_13334 [Phaeosphaeria nodorum SN15] gi|160703995|gb|EAT79218.2| hypothetical protein SNOG_13334 [Phaeosphaeria nodorum SN15] Length = 133 Score = 59.5 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 32/68 (47%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K G+A +G+ + + +F + G RNP ++ AE+ GLF L+ Sbjct: 65 KIQGAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFAFAEATGLFALM 124 Query: 83 VVMLLLFV 90 + LLL+V Sbjct: 125 MSFLLLYV 132 >gi|62650657|ref|XP_576027.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] gi|109479355|ref|XP_001078383.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Rattus norvegicus] Length = 132 Score = 59.5 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ A+ +F + G RN + ++ ++E + LF Sbjct: 62 AAKFIDAGAATVGVAGSGAAIGTVFGNLIIGYARNLSLKQQLSSYPILGFALSEVMRLFC 121 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 122 LMVTFLILFTM 132 >gi|262036852|dbj|BAI47567.1| orthodenticle2 [Gryllus bimaculatus] Length = 134 Score = 59.5 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 27/56 (48%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 K++ G A +G+ + +F + + G RNP + ++ ++E++GL Sbjct: 43 KFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGL 98 >gi|301755454|ref|XP_002913588.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] Length = 170 Score = 59.5 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 28/59 (47%) Query: 33 GMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 GM + +F + ++G RN + ++ I+E++GLF L V +LF I Sbjct: 84 GMTGSGAGLGTVFGSLITGYTRNFSLKQQLFSYAILGFSISEAMGLFYLTVAFSILFTI 142 >gi|256427311|ref|YP_003127074.1| Atp9p [Dekkera bruxellensis] gi|255761608|gb|ACU32844.1| Atp9p [Dekkera bruxellensis] Length = 76 Score = 59.5 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 38/72 (52%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA KY+ G+A +G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAGKYIGAGIATVGLLGAGIGIAIVFAALINGTSRNPGIKDTIFPYAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 ++ LLL+ + Sbjct: 65 CMMNAFLLLYGV 76 >gi|291407816|ref|XP_002720243.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2-like, partial [Oryctolagus cuniculus] Length = 154 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 6/71 (8%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+ G A +G+ + +F + + G RNP + ++ +E++GLF Sbjct: 90 AAKFTGAGAATVGVAGSGAGIGTVFGSLIIGYARNPS----LFSYAILGF--SEAMGLFC 143 Query: 81 LLVVMLLLFVI 91 L+V L+L+ + Sbjct: 144 LMVAFLILYSM 154 >gi|45239027|ref|NP_987084.1| AMI007Wp [Ashbya gossypii ATCC 10895] gi|50400377|sp|Q75G38|ATP9_ASHGO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|44978833|gb|AAS50174.1| AMI007Wp [Ashbya gossypii ATCC 10895] Length = 76 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 21/72 (29%), Positives = 39/72 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F + G RNP ++ I+E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMKDTLFQFAILGFAISEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 CLMISFLLLYGV 76 >gi|322708172|gb|EFY99749.1| ATP synthase protein 9 (Lipid-binding protein) [Metarhizium anisopliae ARSEF 23] Length = 157 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 34/68 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 81 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 140 Query: 82 LVVMLLLF 89 +V ++ F Sbjct: 141 MVALMAKF 148 >gi|47230530|emb|CAF99723.1| unnamed protein product [Tetraodon nigroviridis] Length = 89 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 19 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 78 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 79 LMVAFLILFAM 89 >gi|322825963|gb|EFZ30774.1| ATPase subunit 9, putative [Trypanosoma cruzi] Length = 191 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 125 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 184 Query: 84 VMLLLF 89 L+LF Sbjct: 185 AFLMLF 190 >gi|11466062|ref|NP_038221.1| ATPase subunit 9 [Pichia canadensis] gi|1352022|sp|P48881|ATP9_PICCA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|1000985|dbj|BAA06576.1| ATPase subunit 9 [Pichia canadensis] Length = 76 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ +A +G+ + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAAIATIGLLGAGIGIAIVFAALINGTSRNPSLRNTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 CLMISFLLLYGV 76 >gi|189198047|ref|XP_001935361.1| ATP synthase subunit 9 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187981309|gb|EDU47935.1| ATP synthase subunit 9 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 133 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 32/68 (47%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K G+A +G+ + + +F + G RNP ++ AE+ GLF L+ Sbjct: 65 KIQGAGLATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFAFAEATGLFALM 124 Query: 83 VVMLLLFV 90 + LLL+V Sbjct: 125 MSFLLLYV 132 >gi|114650621|ref|XP_522718.2| PREDICTED: similar to P1 gene for c subunit of human mitochondrial ATP synthase isoform 2 [Pan troglodytes] gi|114650623|ref|XP_001135138.1| PREDICTED: similar to P1 gene for c subunit of human mitochondrial ATP synthase isoform 1 [Pan troglodytes] Length = 125 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAK + G A +G+ + +F + + G RN + + ++E++GLF Sbjct: 65 IAAKLIGAGAATVGVAGSGAGIGKVFGSLIIGYARNLSLKQQLFSYATLGFALSEAMGLF 124 Query: 80 L 80 Sbjct: 125 C 125 >gi|315248829|ref|YP_004072416.1| ATP synthase subunit 9 [Pichia angusta] gi|314911726|gb|ADT63563.1| ATP synthase subunit 9 [Pichia angusta] Length = 76 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 39/72 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ +A +G+ + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAAIATIGLTGAGIGIAIVFAALINGTSRNPSLRNTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 ++ LLL+ + Sbjct: 65 CTMISFLLLYGV 76 >gi|3121815|sp|Q36852|ATP9_WILMR RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|402612|emb|CAA52875.1| ATP synthase subunit 9 [Williopsis saturnus var. mrakii] Length = 76 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 37/72 (51%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ ++ +G + ++ +F ++G RNP + + ++E+ GLF Sbjct: 5 LAAKYIGAAISTIGTLGAGIGIAIVFAALINGTSRNPSLRNTLFPFAITGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LL+ + Sbjct: 65 CLMVSFTLLYGV 76 >gi|49147010|ref|YP_025861.1| ATP synthase A chain subunit 9 [Moniliophthora perniciosa] gi|330339454|ref|YP_004376361.1| ATP synthase A chain subunit 9 [Moniliophthora roreri] gi|34538655|gb|AAQ74263.1| ATP synthase A chain subunit 9 [Moniliophthora perniciosa] gi|308912821|gb|ADO51568.1| ATP synthase A chain subunit 9 [Moniliophthora roreri] Length = 73 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 40/70 (57%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAKY+ G+AC G+ + + IF++ +S RNP T ++ +AE+ GLF Sbjct: 3 VAAKYIGAGLACSGLIGAGVGIGVIFSSLISSTARNPQIRGQLFTYAILGFALAEATGLF 62 Query: 80 LLLVVMLLLF 89 L+V LLL+ Sbjct: 63 ALMVAFLLLY 72 >gi|58584716|ref|YP_198289.1| F0F1 ATP synthase subunit C [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|75507970|sp|Q5GSH7|ATPL_WOLTR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|58419032|gb|AAW71047.1| F0F1-type ATP synthase, subunit c [Wolbachia endosymbiont strain TRS of Brugia malayi] Length = 75 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 29/71 (40%), Positives = 44/71 (61%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +A K++A+G++ LG+ L V+NIF+T LSG RNP + K V + A + E GL Sbjct: 4 VALKFIAIGLSVLGILGAGLGVANIFSTMLSGLARNPESEGKMKIYVYVGAGMVEFTGLL 63 Query: 80 LLLVVMLLLFV 90 ++ MLL+FV Sbjct: 64 AFVLAMLLMFV 74 >gi|1753202|dbj|BAA13165.1| ATP synthase subunit [Caenorhabditis elegans] gi|2340836|dbj|BAA21841.1| ATP synthase subunit [Caenorhabditis elegans] Length = 92 Score = 58.7 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G+ + N+F + G RNP + ++ ++E++GLF Sbjct: 22 AAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFC 81 Query: 81 LLVVMLLLFVI 91 L + ++LF + Sbjct: 82 LTMGFMILFAL 92 >gi|109098527|ref|XP_001098184.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] Length = 136 Score = 58.7 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V VG A +G+ + +F + + G RN + ++E +GLF Sbjct: 66 AAKFVGVGAATVGVRGSGAGIGMVFGSLIIGYARNLSLKQQLFFCAIRGFALSEVMGLFC 125 Query: 81 LLVVMLLLFVI 91 L+V L++F + Sbjct: 126 LMVSFLIVFAM 136 >gi|313233400|emb|CBY24515.1| unnamed protein product [Oikopleura dioica] gi|313246959|emb|CBY35805.1| unnamed protein product [Oikopleura dioica] Length = 103 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 39/71 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + + ++ ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFALSEAMGLFC 92 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 93 LMVAFLILFAL 103 >gi|509361|emb|CAA54456.1| ATP synthase subunit 9 [Williopsis saturnus var. suaveolens] Length = 76 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 38/72 (52%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ ++ +G + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAAISTIGTLGAGIGIAIVFAALINGVSRNPSLRNTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LL+ + Sbjct: 65 CLMVSFTLLYGV 76 >gi|42520302|ref|NP_966217.1| F0F1 ATP synthase subunit C [Wolbachia endosymbiont of Drosophila melanogaster] gi|58698347|ref|ZP_00373262.1| ATP synthase F0, C subunit-related protein [Wolbachia endosymbiont of Drosophila ananassae] gi|99034173|ref|ZP_01314258.1| hypothetical protein Wendoof_01000947 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] gi|190571030|ref|YP_001975388.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|213019551|ref|ZP_03335357.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|225630134|ref|YP_002726925.1| ATP synthase F0, C subunit [Wolbachia sp. wRi] gi|81652673|sp|Q73HW2|ATPL_WOLPM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810074|sp|B3CLG2|ATPL_WOLPP RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810075|sp|C0R5U2|ATPL_WOLWR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|42410040|gb|AAS14151.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Drosophila melanogaster] gi|58535137|gb|EAL59221.1| ATP synthase F0, C subunit-related protein [Wolbachia endosymbiont of Drosophila ananassae] gi|190357302|emb|CAQ54730.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|212994973|gb|EEB55615.1| ATP synthase F0, C subunit [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|225592115|gb|ACN95134.1| ATP synthase F0, C subunit [Wolbachia sp. wRi] Length = 75 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 27/71 (38%), Positives = 43/71 (60%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +A K++A+G+A GM L ++NIF+ L+G RNP + K+ V I A + E +GL Sbjct: 4 VALKFIAIGLAVFGMLGAGLGIANIFSAMLNGIARNPESEGKMKSYVYIGAAMVEIMGLL 63 Query: 80 LLLVVMLLLFV 90 ++ MLL+F Sbjct: 64 AFVLAMLLIFA 74 >gi|21263118|ref|NP_644685.1| ATP synthase subunit 9 [Saccharomyces castellii] gi|4588717|gb|AAD26191.1|AF114949_1 ATP synthase subunit 9 [Naumovia castellii] gi|4588719|gb|AAD26192.1|AF114950_1 ATP synthase subunit 9 [Naumovia castellii] gi|21105291|gb|AAM34594.1|AF437291_7 ATP synthase subunit 9 [Naumovia castellii] Length = 77 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 38/70 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLF 89 L++ +L+F Sbjct: 65 CLMISFMLMF 74 >gi|242800683|ref|XP_002483638.1| ATP synthase subunit ATP9, putative [Talaromyces stipitatus ATCC 10500] gi|218716983|gb|EED16404.1| ATP synthase subunit ATP9, putative [Talaromyces stipitatus ATCC 10500] Length = 182 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G A +G+ + +F L RNP ++ E++GLF L++ Sbjct: 91 IGMGSAAIGLAGAGTGIGLVFAALLHSVARNPSLRGQLFAYAILGFAFVEAIGLFDLMIA 150 Query: 85 MLLLF 89 M+ F Sbjct: 151 MMAKF 155 >gi|329888299|ref|ZP_08266897.1| ATP synthase C chain [Brevundimonas diminuta ATCC 11568] gi|328846855|gb|EGF96417.1| ATP synthase C chain [Brevundimonas diminuta ATCC 11568] Length = 74 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 31/70 (44%), Positives = 47/70 (67%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LGM ALAV NIF +L+GA RNP AA++ + + A +AE+LG+ Sbjct: 5 AAKYIGAGLATLGMIGSALAVGNIFGNFLAGALRNPAAAASQVGNLFVGAALAEALGILA 64 Query: 81 LLVVMLLLFV 90 ++ +L+ F+ Sbjct: 65 FVLGILMFFL 74 >gi|310792002|gb|EFQ27529.1| ATP synthase subunit C [Glomerella graminicola M1.001] Length = 147 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 79 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 138 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 139 MVALMAKFT 147 >gi|187127212|ref|NP_001119658.1| ATP synthase c-subunit-like [Acyrthosiphon pisum] gi|89473744|gb|ABD72684.1| ATP synthase c-subunit-like [Acyrthosiphon pisum] gi|239793583|dbj|BAH72902.1| ACYPI000030 [Acyrthosiphon pisum] Length = 142 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 72 AAKFIGAGAATVGIAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 131 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 132 LMMAFLLLFA 141 >gi|86990311|ref|YP_492534.1| ATP synthase F0 subunit 9 [Hanseniaspora uvarum] gi|66473328|gb|AAY46309.1| ATP synthase F0 subunit 9 [Hanseniaspora uvarum] Length = 76 Score = 58.3 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 38/72 (52%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L AKY+ G+A +G+ + ++ +F ++ RNP ++ ++ES GLF Sbjct: 5 LGAKYIGAGIAAVGLIGAGIGIAIVFAALINAVSRNPSMTKTLFPYAILGFSLSESTGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LL+ + Sbjct: 65 CLMISFILLYAV 76 >gi|84684304|ref|ZP_01012206.1| FoF1 ATP synthase, subunit C [Maritimibacter alkaliphilus HTCC2654] gi|84668057|gb|EAQ14525.1| FoF1 ATP synthase, subunit C [Rhodobacterales bacterium HTCC2654] Length = 78 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA + I AE+LG+F Sbjct: 9 GQFIGAGLAGIGSGAAAIGVGHVAGNFLAGALRNPSAAGGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|302850096|ref|XP_002956576.1| hypothetical protein VOLCADRAFT_83693 [Volvox carteri f. nagariensis] gi|300258103|gb|EFJ42343.1| hypothetical protein VOLCADRAFT_83693 [Volvox carteri f. nagariensis] Length = 169 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 100 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 159 Query: 81 LLVVMLLLFV 90 LLVV L+LF Sbjct: 160 LLVVFLILFA 169 >gi|85094506|ref|XP_959894.1| ATP synthase protein 9, mitochondrial precursor [Neurospora crassa OR74A] gi|114671|sp|P00842|ATP9_NEUCR RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein; Flags: Precursor gi|28921351|gb|EAA30658.1| ATP synthase protein 9, mitochondrial precursor [Neurospora crassa OR74A] gi|40804639|emb|CAF05899.1| H+-transporting two-sector ATPase lipid-binding protein precursor [Neurospora crassa] Length = 147 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 79 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 138 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 139 MVALMAKFT 147 >gi|114570752|ref|YP_757432.1| H+-transporting two-sector ATPase subunit C [Maricaulis maris MCS10] gi|114341214|gb|ABI66494.1| ATP synthase F0 subcomplex C subunit [Maricaulis maris MCS10] Length = 74 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 33/56 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 KY+ G+ACLGM A+ V NIF +L GA RNP AA A ++ + E+LG Sbjct: 5 GKYIGAGLACLGMLGAAVGVGNIFAAFLQGAMRNPSAAQAQFGTLIFGFAVTEALG 60 >gi|328672363|ref|YP_004362952.1| F-type H+-transporting ATPase subunit c [Pichia pastoris CBS 7435] gi|328354782|emb|CCA41178.1| F-type H+-transporting ATPase subunit c [Pichia pastoris CBS 7435] Length = 76 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ +A +G+ + ++ +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAAIATIGLTGAGIGIAIVFAALINGTSRNPGLRNTLFPFAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 CLMISFLLLYGV 76 >gi|327271728|ref|XP_003220639.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Anolis carolinensis] Length = 130 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 17/73 (23%), Positives = 34/73 (46%), Gaps = 2/73 (2%) Query: 21 AAKYVAVG--MACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK++ G A +G+ +F + + +NP ++ ++E++GL Sbjct: 58 AAKFIGAGAGTATVGVADSGAGTGTVFGSLIISYAKNPSLNQQLFFYAILGFALSETMGL 117 Query: 79 FLLLVVMLLLFVI 91 F L+V L+ F + Sbjct: 118 FCLMVAFLIFFTM 130 >gi|13476164|ref|NP_107734.1| F0F1 ATP synthase subunit C [Mesorhizobium loti MAFF303099] gi|14026924|dbj|BAB53520.1| Fo ATP synthase subunit C [Mesorhizobium loti MAFF303099] Length = 74 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 27/59 (45%), Positives = 38/59 (64%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 CLGMG + + NIF +YLSGA RNP AA ++ + E+LG+F LL+ +LL+F Sbjct: 15 CLGMGGAGIGLGNIFGSYLSGALRNPSAADGQFGRLIFGFAVTEALGIFSLLIALLLVF 73 >gi|171679571|ref|XP_001904732.1| hypothetical protein [Podospora anserina S mat+] gi|461561|sp|Q03672|ATP9_PODAN RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein; Flags: Precursor gi|3096|emb|CAA42471.1| ATP synthase subunit 9 [Podospora anserina] gi|238609|gb|AAA05756.1| ATP synthase subunit 9 [Podospora anserina, Peptide, 144 aa] gi|170939411|emb|CAP64639.1| unnamed protein product [Podospora anserina S mat+] Length = 144 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 76 SKNLGMGTAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 135 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 136 MVALMAKFT 144 >gi|241709086|ref|XP_002403359.1| ATP synthase C subunit, putative [Ixodes scapularis] gi|215505057|gb|EEC14551.1| ATP synthase C subunit, putative [Ixodes scapularis] Length = 152 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 18/79 (22%), Positives = 36/79 (45%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 +A N A+ V + + + ++F + + G RNP + ++ Sbjct: 73 SAQNREIKGGARVVTAKRDTVKVTFSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFA 132 Query: 72 IAESLGLFLLLVVMLLLFV 90 ++E++GLF L++ LLLF Sbjct: 133 LSEAMGLFCLMMAFLLLFA 151 >gi|313230598|emb|CBY18814.1| unnamed protein product [Oikopleura dioica] Length = 120 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 34/65 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + + ++ ++E++GLF Sbjct: 33 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKAQLFSYAILGFALSEAMGLFC 92 Query: 81 LLVVM 85 L+V Sbjct: 93 LMVAF 97 >gi|159486952|ref|XP_001701500.1| F1F0 ATP synthase subunit 9, isoform B [Chlamydomonas reinhardtii] gi|158271561|gb|EDO97377.1| F1F0 ATP synthase subunit 9, isoform B [Chlamydomonas reinhardtii] Length = 157 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 88 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 147 Query: 81 LLVVMLLLFV 90 LLVV L+LF Sbjct: 148 LLVVFLILFA 157 >gi|89069740|ref|ZP_01157076.1| ATP synthase subunit C [Oceanicola granulosus HTCC2516] gi|89044686|gb|EAR50797.1| ATP synthase subunit C [Oceanicola granulosus HTCC2516] Length = 78 Score = 57.2 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 43/70 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA++ + I AE+LG+F Sbjct: 9 GQFIGAGLAGIGSGAAAIGVGHVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|167648333|ref|YP_001685996.1| H+transporting two-sector ATPase subunit C [Caulobacter sp. K31] gi|167350763|gb|ABZ73498.1| H+transporting two-sector ATPase C subunit [Caulobacter sp. K31] Length = 74 Score = 57.2 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 26/69 (37%), Positives = 44/69 (63%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 + AAK + G+A LGM + V NIF ++L+GA RNP AA++ + + A +AE+LG+ Sbjct: 3 AAAAKLIGAGLATLGMIGAGIGVGNIFGSFLTGALRNPSAAASQIGNLFVGAALAEALGI 62 Query: 79 FLLLVVMLL 87 ++ +L+ Sbjct: 63 LAFVLGILI 71 >gi|85706761|ref|ZP_01037853.1| ATP synthase subunit C [Roseovarius sp. 217] gi|85668819|gb|EAQ23688.1| ATP synthase subunit C [Roseovarius sp. 217] Length = 78 Score = 57.2 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 24/70 (34%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA+ + I AE+LG+F Sbjct: 9 GQFIGAGLAGIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 L+ +LL+F + Sbjct: 69 LIALLLMFAV 78 >gi|254471735|ref|ZP_05085136.1| ATP synthase subunit C, putative [Pseudovibrio sp. JE062] gi|211958937|gb|EEA94136.1| ATP synthase subunit C, putative [Pseudovibrio sp. JE062] Length = 75 Score = 57.2 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 28/60 (46%), Positives = 39/60 (65%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+ACLGMG AL + NIF +L+GA RNP AA +++ + E+LG+F Sbjct: 5 AAKYIGAGIACLGMGGAALGLGNIFGNFLAGALRNPSAADGQFGRLILGFAVTEALGIFS 64 >gi|325302926|tpg|DAA34494.1| TPA_inf: ATP synthase c-subunit [Amblyomma variegatum] Length = 133 Score = 57.2 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK++ G A +G+ + ++F + + G RNP + ++ ++E++GL Sbjct: 76 AAKFIGAGAATVGVAGSGAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGL 133 >gi|89266423|gb|ABD65503.1| ATP synthase H+ transporting mitochondrial F0 complex-like [Ictalurus punctatus] Length = 75 Score = 56.8 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 5 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 64 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 65 LMVAFLILFAM 75 >gi|110633054|ref|YP_673262.1| F0F1 ATP synthase subunit C [Mesorhizobium sp. BNC1] gi|110284038|gb|ABG62097.1| ATP synthase F0 subcomplex C subunit [Chelativorans sp. BNC1] Length = 75 Score = 56.8 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 25/60 (41%), Positives = 37/60 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGMG + + +IF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGIACLGMGGAGIGLGHIFGNYLAGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 >gi|2982|emb|CAA24230.1| unnamed protein product [Neurospora crassa] Length = 147 Score = 56.8 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 35/69 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ + E++GLF L Sbjct: 79 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGSAFVEAIGLFDL 138 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 139 MVALMAKFT 147 >gi|114769965|ref|ZP_01447575.1| F0F1 ATP synthase subunit C [alpha proteobacterium HTCC2255] gi|114549670|gb|EAU52552.1| F0F1 ATP synthase subunit C [alpha proteobacterium HTCC2255] Length = 78 Score = 56.8 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC GMG A+ V ++ +LSGA RNP AA+ + I AE+LG+F Sbjct: 9 GAYIGAGLACTGMGGAAVGVGHVVGNFLSGALRNPSAATGQTATMFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|209883849|ref|YP_002287706.1| hypothetical protein OCAR_4699 [Oligotropha carboxidovorans OM5] gi|299134067|ref|ZP_07027260.1| H+transporting two-sector ATPase C subunit [Afipia sp. 1NLS2] gi|209872045|gb|ACI91841.1| conserved domain protein [Oligotropha carboxidovorans OM5] gi|298590814|gb|EFI51016.1| H+transporting two-sector ATPase C subunit [Afipia sp. 1NLS2] Length = 75 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 37/62 (59%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+A +GMG + V IF+ +L+GA RNP A+ ++ + E+LG+ Sbjct: 3 PIAAKYIGAGLATIGMGGAGVGVGMIFSQFLNGALRNPSASQGQFANLIFGFAVTEALGI 62 Query: 79 FL 80 F Sbjct: 63 FS 64 >gi|109122853|ref|XP_001098906.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial [Macaca mulatta] Length = 136 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 32/71 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G A +G+ + + + + G RN ++ +++ +GLF Sbjct: 66 AAKLIGAGAARVGVAGSGAGIGMVLGSLIIGYARNLSVKQQLFFCAILGFALSDVVGLFC 125 Query: 81 LLVVMLLLFVI 91 L V L+LF + Sbjct: 126 LTVAFLILFTM 136 >gi|322700218|gb|EFY91974.1| ATP synthase protein 9 precursor (Lipid-binding protein) [Metarhizium acridum CQMa 102] Length = 149 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 81 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 140 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 141 MVALMAKFT 149 >gi|77556486|gb|ABA99282.1| ATP synthase subunit C family protein [Oryza sativa Japonica Group] Length = 354 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 25/52 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N+ ++ + RNP A ++ + E++ LF ++ L+ FV Sbjct: 166 VGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFAPMMAFLISFV 217 >gi|189095566|ref|YP_001936272.1| ATP synthase F0 subunit 9 [Aphrocallistes vastus] gi|150024084|gb|ABR58845.1| ATP synthase F0 subunit 9 [Aphrocallistes vastus] Length = 78 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 35/70 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 AK + G A +G+ + +F + G RNP T ++ I+E++GLF L Sbjct: 9 AKLIGAGAATIGVAGRGAGIGTVFGNLIIGYARNPKLKQQLFTYAILGFAISEAMGLFCL 68 Query: 82 LVVMLLLFVI 91 ++ L+L+ I Sbjct: 69 MMAFLILYGI 78 >gi|296004810|ref|XP_002808757.1| ATP synthase subunit C, putative [Plasmodium falciparum 3D7] gi|225632141|emb|CAX64030.1| ATP synthase subunit C, putative [Plasmodium falciparum 3D7] Length = 166 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + N+F+ + G RNP T LI E LG+ +L+ Sbjct: 101 LSAAIALMSVGGVAQGIGNLFSALVLGTSRNPSIKDELFTYTLIGMGFLEFLGIICVLMS 160 Query: 85 MLLLF 89 +LL+ Sbjct: 161 AVLLY 165 >gi|84515976|ref|ZP_01003337.1| ATP synthase subunit C [Loktanella vestfoldensis SKA53] gi|84510418|gb|EAQ06874.1| ATP synthase subunit C [Loktanella vestfoldensis SKA53] Length = 74 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 27/68 (39%), Positives = 41/68 (60%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A +G G A+ V N+ YL+GA RNP AA+ + I AE+LG+F LV Sbjct: 7 HIGAGLAAIGSGFAAIGVGNVAGNYLAGALRNPSAAAGQTATLFIGLAFAEALGIFAFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 SLLLMFAV 74 >gi|163744749|ref|ZP_02152109.1| F0F1 ATP synthase subunit C [Oceanibulbus indolifex HEL-45] gi|161381567|gb|EDQ05976.1| F0F1 ATP synthase subunit C [Oceanibulbus indolifex HEL-45] Length = 74 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 29/68 (42%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A LG G+ AL V N+ +LSGA RNP AA++ + I AE+LG+F LV Sbjct: 7 HIGAGIAGLGTGIAALGVGNVAANFLSGALRNPSAAASQTATLFIGIAFAEALGIFSFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 ALLLMFAV 74 >gi|164421217|ref|YP_001648670.1| ATP synthase F0 subunit 9 [Igernella notabilis] gi|158939029|gb|ABW83950.1| ATP synthase F0 subunit 9 [Igernella notabilis] Length = 78 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K++ G A +G+ + +F + G RNP T ++ I+E++GLF Sbjct: 8 ASKFIGAGAATIGVAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|146189579|emb|CAM91791.1| hypothetical protein [Platynereis dumerilii] Length = 99 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAES 75 AAKY+ G A +G+ + ++F + + G RNP + ++ ++E+ Sbjct: 45 AAKYIGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEA 99 >gi|39973923|ref|XP_368352.1| hypothetical protein MGG_00892 [Magnaporthe oryzae 70-15] gi|145018159|gb|EDK02438.1| hypothetical protein MGG_00892 [Magnaporthe oryzae 70-15] Length = 144 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 33/69 (47%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+ RNP + ++ E++GLF L Sbjct: 76 SKNIGMGSAAIGLTGAGIGIGLVFAALLNSVARNPALRGQLFSYAILGFAFVEAIGLFDL 135 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 136 MVALMAKFT 144 >gi|306991573|pdb|2XND|J Chain J, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991574|pdb|2XND|K Chain K, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991575|pdb|2XND|L Chain L, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991576|pdb|2XND|M Chain M, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991577|pdb|2XND|N Chain N, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991578|pdb|2XND|O Chain O, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991579|pdb|2XND|P Chain P, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase gi|306991580|pdb|2XND|Q Chain Q, Crystal Structure Of Bovine F1-C8 Sub-Complex Of Atp Synthase Length = 72 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ + +F + + G RNP + ++ ++E++GLF Sbjct: 4 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 63 Query: 81 LLVVMLLLF 89 L+V L+LF Sbjct: 64 LMVAFLILF 72 >gi|302915639|ref|XP_003051630.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256732569|gb|EEU45917.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 147 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 79 SKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 138 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 139 MVALMAKFT 147 >gi|157816268|ref|YP_001492839.1| ATP synthase F0 subunit 9 [Tilletia indica] gi|115361461|gb|ABI95827.1| ATP synthase F0 subunit 9 [Tilletia indica] Length = 73 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 24/69 (34%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LG+ + V +F + G+ RNP A T ++ ++E+ GLF Sbjct: 4 AAKYIGSGIATLGLTGAGIGVGIVFAALIQGSSRNPSLRGALFTYRILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMSFLLLY 72 >gi|187373146|ref|YP_001876489.1| ATP9 [Tilletia walkeri] gi|144926001|gb|ABP03935.1| ATP9 [Tilletia walkeri] Length = 74 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 24/71 (33%), Positives = 40/71 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LG+ + V +F + G+ RNP A T ++ ++E+ GLF Sbjct: 4 AAKYIGSGIATLGLTGAGIGVGIVFAALIQGSSRNPSLRGALFTYRILGFALSEATGLFA 63 Query: 81 LLVVMLLLFVI 91 L++ LLL+ + Sbjct: 64 LMMSFLLLYSL 74 >gi|99082433|ref|YP_614587.1| F0F1 ATP synthase subunit C [Ruegeria sp. TM1040] gi|259417991|ref|ZP_05741910.1| conserved domain protein [Silicibacter sp. TrichCH4B] gi|123252123|sp|Q1GDE1|ATPL_SILST RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|99038713|gb|ABF65325.1| H+-transporting two-sector ATPase C subunit [Ruegeria sp. TM1040] gi|259346897|gb|EEW58711.1| conserved domain protein [Silicibacter sp. TrichCH4B] Length = 74 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 28/68 (41%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+A +G G+ AL V N+ +L+GA RNP AA++ + I AE+LG+F LV Sbjct: 7 YIGAGLAGMGTGIAALGVGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALGIFSFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 ALLLMFAV 74 >gi|312114301|ref|YP_004011897.1| ATP synthase F0 C subunit [Rhodomicrobium vannielii ATCC 17100] gi|311219430|gb|ADP70798.1| ATP synthase F0, C subunit [Rhodomicrobium vannielii ATCC 17100] Length = 75 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 28/72 (38%), Positives = 42/72 (58%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK + G+AC + + + +IF +L GA RNP AA +L+ +AE+ GL Sbjct: 3 PAAAKLIGAGLACSALIGAGIGIGSIFGNFLQGALRNPSAAPGQFPNLLLGFALAEATGL 62 Query: 79 FLLLVVMLLLFV 90 F L+V ++LLFV Sbjct: 63 FGLVVALILLFV 74 >gi|146221444|gb|ABQ11843.1| ATP synthase F0 subunit 9 [Sympagella nux] Length = 80 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G A +G+ + +F + RNP T ++ I+E++GLF Sbjct: 10 SAKIIGAGTATIGVAGSGAGIGTVFGNLMIAYARNPELKQQLFTYAILGFAISEAMGLFC 69 Query: 81 LLVVMLLLFVI 91 L++ LLL+ I Sbjct: 70 LMMAFLLLYGI 80 >gi|12718935|ref|NP_075437.1| ATP synthetase subunit 9 [Yarrowia lipolytica] gi|51701316|sp|Q37695|ATP9_YARLI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|473692|gb|AAA78262.1| ATP synthase 9 [Yarrowia lipolytica] gi|12666830|emb|CAC28104.1| ATP9 protein [Yarrowia lipolytica] Length = 76 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 21/72 (29%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA KY+ G+A +G+ + ++ +F ++G RNP T ++ ++E+ GLF Sbjct: 5 LAGKYIGAGLASIGLVGAGIGIAIVFAALINGVSRNPALKGQLFTYSILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LLL+ + Sbjct: 65 ALMIAFLLLYAV 76 >gi|310814621|ref|YP_003962585.1| ATP synthase subunit C [Ketogulonicigenium vulgare Y25] gi|308753356|gb|ADO41285.1| ATP synthase subunit C [Ketogulonicigenium vulgare Y25] Length = 76 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 34/59 (57%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +Y+ G+AC+GM A+ V N+ YL+GA RNP AA + I AE+LG+F Sbjct: 7 GQYIGAGLACIGMAGAAIGVGNVAGNYLAGALRNPSAAGGQTAMLFIGMAFAEALGIFS 65 >gi|320588330|gb|EFX00799.1| ATP synthase subunit [Grosmannia clavigera kw1407] Length = 147 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 32/69 (46%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F + G RNP ++ E++GLF L Sbjct: 79 SKNIGMGSAAIGLTGAGIGIGLVFAALIQGVARNPALRGQLFQYAILGFAFVEAIGLFDL 138 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 139 MVALMAKFT 147 >gi|259019204|ref|YP_003204921.1| ATP synthase subunit 9 [Millerozyma farinosa] gi|257143765|emb|CAY39291.1| ATP synthase, subunit 9 [Millerozyma farinosa] Length = 76 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 24/72 (33%), Positives = 42/72 (58%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ MA LG+G A+ ++ +F ++G RNP + + ++ AE+ GLF Sbjct: 5 LAAKYMGAAMATLGLGGAAMGIALVFVALMNGTTRNPSIRATIFPQAMLGFATAEACGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ LL++ + Sbjct: 65 CLMMSFLLIYAV 76 >gi|119385603|ref|YP_916658.1| F0F1 ATP synthase subunit C [Paracoccus denitrificans PD1222] gi|119376198|gb|ABL70962.1| ATP synthase F0 subcomplex C subunit [Paracoccus denitrificans PD1222] Length = 77 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 36/59 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +Y+ G+AC+GM A+ V N+ YL+GA RNP AA++ + I AE+LG+F Sbjct: 8 GQYLGAGLACVGMAGAAMGVGNVAGNYLAGALRNPSAAASQTATLFIGMAFAEALGIFS 66 >gi|326632062|gb|ADZ99033.1| ATP synthase subunit 9 [Physarum polycephalum] Length = 83 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 33/69 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 + K + G+A +G+ V +F + + G RNP ++ + E++GL Sbjct: 14 SGKSIGAGLATIGLAGAGTGVGIVFGSLVFGLSRNPAEEQRLFKYAMLGFAVTEAVGLLA 73 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 74 LMMAFLILF 82 >gi|156088373|ref|XP_001611593.1| ATP synthase subunit C family protein [Babesia bovis] gi|154798847|gb|EDO08025.1| ATP synthase subunit C family protein [Babesia bovis] Length = 156 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 32/65 (49%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +A + +G VA + N+F +SG RNP T LI E LG+ +L+ Sbjct: 91 LGAAVALMSVGGVAQGIGNLFAALVSGTARNPSIKDDLFTYTLIGMGFLEFLGIICVLMS 150 Query: 85 MLLLF 89 ++++ Sbjct: 151 AIMMY 155 >gi|299830439|ref|YP_003734810.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|299830500|ref|YP_003734871.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269810816|gb|ACZ43845.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269810877|gb|ACZ43906.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269812129|gb|ACZ44427.1| ATP synthase F0 subunit 9 [Pythium ultimum] gi|269812190|gb|ACZ44488.1| ATP synthase F0 subunit 9 [Pythium ultimum] Length = 75 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 ++K++ G+A +G+ + + ++F + + G RNP ++ + E++ LF Sbjct: 5 SSKFIGAGLATIGLAGAGVGIGSVFGSLVLGISRNPSLQQELTRTAILGFALTEAIALFC 64 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 65 LMMAFLILFA 74 >gi|115304398|ref|YP_762703.1| ATP synthase subunit 9 [Ustilago maydis] gi|121934265|sp|Q0H8W9|ATP9_USTMA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|72256228|gb|AAZ67018.1| ATP synthase subunit 9 [Ustilago maydis] gi|315465334|emb|CBQ72569.1| ATP synthase subunit 9 [Sporisorium reilianum] Length = 73 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 24/69 (34%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A LG+ + V +F + G RNP T ++ ++E+ GLF Sbjct: 4 AAKYIGSGVAALGLIGAGIGVGIVFAALIQGVSRNPSLRGQLFTYAILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L+V LLL+ Sbjct: 64 LMVSFLLLY 72 >gi|46123341|ref|XP_386224.1| ATP9_NEUCR ATP synthase protein 9, mitochondrial precursor (Lipid-binding protein) [Gibberella zeae PH-1] Length = 146 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+G RNP + ++ E++GLF L Sbjct: 78 SKNLGMGAAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDL 137 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 138 MVALMAKFT 146 >gi|294676299|ref|YP_003576914.1| ATP synthase F0 subunit C [Rhodobacter capsulatus SB 1003] gi|75340080|sp|O05331|ATPL_RHOCA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|1934976|emb|CAA72982.1| FoF1 ATP synthase, subunit C [Rhodobacter capsulatus] gi|294475119|gb|ADE84507.1| ATP synthase F0, C subunit [Rhodobacter capsulatus SB 1003] Length = 78 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 28/70 (40%), Positives = 43/70 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC GMG A+ V ++ ++SGA RNP AA++ + I AE+LG+F Sbjct: 9 GAYIGAGLACTGMGGAAVGVGHVVGNFISGALRNPSAAASQTATMFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|302850172|ref|XP_002956614.1| F1F0 ATP synthase, subunit C, mitochondrial [Volvox carteri f. nagariensis] gi|300258141|gb|EFJ42381.1| F1F0 ATP synthase, subunit C, mitochondrial [Volvox carteri f. nagariensis] Length = 168 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 99 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 158 Query: 81 LLVVMLLLFV 90 LLVV L+LF Sbjct: 159 LLVVFLILFA 168 >gi|221051926|ref|XP_002257539.1| ATPase subunit 9 [Plasmodium knowlesi strain H] gi|193807369|emb|CAQ37874.1| ATPase subunit 9, putative [Plasmodium knowlesi strain H] Length = 166 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + N+F+ + G RNP T LI E LG+ +L+ Sbjct: 101 LSAAIALMSVGGVAQGIGNLFSALVLGTSRNPSIKDELFTYTLIGMGFLEFLGIICVLMS 160 Query: 85 MLLLF 89 +LL+ Sbjct: 161 AVLLY 165 >gi|164421159|ref|YP_001648643.1| ATP synthase F0 subunit 9 [Hippospongia lachne] gi|164421189|ref|YP_001648686.1| ATP synthase F0 subunit 9 [Vaceletia sp. GW948] gi|281428831|ref|YP_003355008.1| ATP synthase F0 subunit 9 [Ircinia strobilina] gi|158939001|gb|ABW83923.1| ATP synthase F0 subunit 9 [Hippospongia lachne] gi|158939047|gb|ABW83966.1| ATP synthase F0 subunit 9 [Vaceletia sp. GW948] gi|251765331|gb|ACT15483.1| ATP synthase F0 subunit 9 [Ircinia strobilina] Length = 77 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+Y+ G A +G+ + +F + + G RNP T ++ I+E++GLF Sbjct: 7 AARYIGAGAATIGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 66 Query: 81 LLVVMLLLFVI 91 L++ LLLF + Sbjct: 67 LMMAFLLLFAL 77 >gi|328847399|gb|EGF96908.1| hypothetical protein MELLADRAFT_91983 [Melampsora larici-populina 98AG31] Length = 73 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F ++G RNP + + ++ ++E+ GLF Sbjct: 4 AAKIIGSGLATIGLTGAGVGIGVVFQGLITGTARNPAIRNQLFSYAILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMISFLLLY 72 >gi|321268746|gb|ADW79195.1| ATP synthase F0 subunit c [Cyanophora paradoxa] Length = 74 Score = 54.9 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A + + + + N+F++ ++ RNP ++ + E++ LF Sbjct: 4 SAKLIGAGLATIALAGAGIGIGNVFSSLINSVARNPSLTKDLFKYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFVI 91 L++V L+LF + Sbjct: 64 LMIVFLILFAM 74 >gi|148284441|ref|YP_001248531.1| F0F1 ATP synthase subunit C [Orientia tsutsugamushi str. Boryong] gi|189183294|ref|YP_001937079.1| F0F1 ATP synthase subunit C [Orientia tsutsugamushi str. Ikeda] gi|254810019|sp|A5CDC6|ATPL_ORITB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810020|sp|B3CQT8|ATPL_ORITI RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|146739880|emb|CAM79838.1| ATP synthase subunit C [Orientia tsutsugamushi str. Boryong] gi|189180065|dbj|BAG39845.1| ATP synthase C chain [Orientia tsutsugamushi str. Ikeda] Length = 74 Score = 54.9 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 25/72 (34%), Positives = 41/72 (56%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 ++ KY+A+ GM AL V++IF ++ RNP A + LI A +AE++GL Sbjct: 3 PISFKYIAIAFMAFGMAGAALGVASIFNALMNSIARNPSAIEDLQKAALIGAGLAEAMGL 62 Query: 79 FLLLVVMLLLFV 90 F ++ +LL+F Sbjct: 63 FSFILAILLMFT 74 >gi|255261393|ref|ZP_05340735.1| conserved domain protein [Thalassiobium sp. R2A62] gi|255103728|gb|EET46402.1| conserved domain protein [Thalassiobium sp. R2A62] Length = 78 Score = 54.9 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 43/70 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC+GMG A+ V N+ +LSGA RNP AA+ + I AE+LG+F Sbjct: 9 GAYIGAGLACMGMGGAAVGVGNVAGNFLSGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|322492115|emb|CBZ27389.1| putative ATPase subunit 9 [Leishmania mexicana MHOM/GT/2001/U1103] gi|322492592|emb|CBZ27869.1| putative ATPase subunit 9 [Leishmania mexicana MHOM/GT/2001/U1103] Length = 106 Score = 54.9 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 Y+ G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 40 YIGTGLAAIALGGVGLGIGTIFGCLLMGCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|114705289|ref|ZP_01438197.1| F0F1 ATP synthase subunit C [Fulvimarina pelagi HTCC2506] gi|114540074|gb|EAU43194.1| F0F1 ATP synthase subunit C [Fulvimarina pelagi HTCC2506] Length = 75 Score = 54.9 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 25/60 (41%), Positives = 36/60 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+ACLGMG + + IF YL+GA RNP AA ++ + E+LG+F Sbjct: 5 AAKFIGAGLACLGMGGAGIGLGTIFGQYLAGALRNPSAADGQFGRLIFGFAVTEALGIFS 64 >gi|261329194|emb|CBH12173.1| ATPase subunit 9, putative [Trypanosoma brucei gambiense DAL972] Length = 117 Score = 54.9 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 51 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 110 Query: 84 VMLLLF 89 L+LF Sbjct: 111 AFLMLF 116 >gi|158301205|ref|XP_001689305.1| AGAP002105-PA [Anopheles gambiae str. PEST] gi|157012358|gb|EDO63210.1| AGAP002105-PA [Anopheles gambiae str. PEST] Length = 100 Score = 54.9 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V +A +G+G L + +F + G RNP + ++ ++E++GLF Sbjct: 30 AAKFVGASLATIGVGGSGLGIGTVFGALIIGYARNPTLKQQIFSYAILGFALSEAMGLFS 89 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 90 LMMAFLMLFA 99 >gi|163738204|ref|ZP_02145620.1| H+-transporting two-sector ATPase, C subunit [Phaeobacter gallaeciensis BS107] gi|163743798|ref|ZP_02151171.1| F0F1 ATP synthase subunit C [Phaeobacter gallaeciensis 2.10] gi|254477158|ref|ZP_05090544.1| ATP synthase subunit C, putative [Ruegeria sp. R11] gi|161382947|gb|EDQ07343.1| F0F1 ATP synthase subunit C [Phaeobacter gallaeciensis 2.10] gi|161388820|gb|EDQ13173.1| H+-transporting two-sector ATPase, C subunit [Phaeobacter gallaeciensis BS107] gi|214031401|gb|EEB72236.1| ATP synthase subunit C, putative [Ruegeria sp. R11] Length = 74 Score = 54.9 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 27/68 (39%), Positives = 43/68 (63%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A +G G+ AL V N+ +L+GA RNP AA++ + I AE+LG+F LV Sbjct: 7 HIGAGLAGMGTGIAALGVGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALGIFSFLV 66 Query: 84 VMLLLFVI 91 +LL+F + Sbjct: 67 ALLLMFAV 74 >gi|293336925|ref|NP_001169057.1| hypothetical protein LOC100382897 [Zea mays] gi|223974711|gb|ACN31543.1| unknown [Zea mays] Length = 152 Score = 54.5 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 29/66 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G A +G+ + +F L RNP ++ E++GLF L++ Sbjct: 87 IGMGSAAIGLAGAGTGIGLVFAALLHSVARNPSLRGQLFAYAILGFAFVEAIGLFDLMIA 146 Query: 85 MLLLFV 90 M+ F+ Sbjct: 147 MMAKFL 152 >gi|71746718|ref|XP_822414.1| ATPase subunit 9 [Trypanosoma brucei TREU927] gi|70832082|gb|EAN77586.1| ATPase subunit 9, putative [Trypanosoma brucei] gi|261332112|emb|CBH15105.1| ATPase subunit 9, putative [Trypanosoma brucei gambiense DAL972] Length = 118 Score = 54.5 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 52 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 111 Query: 84 VMLLLF 89 L+LF Sbjct: 112 AFLMLF 117 >gi|4877689|gb|AAD31414.1|AF119068_1 ATPase subunit 9 [Saccharomyces spencerorum] gi|4877691|gb|AAD31415.1|AF119069_1 ATPase subunit 9 [Saccharomyces spencerorum] Length = 66 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 34/63 (53%) Query: 27 VGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 G+A +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V + Sbjct: 1 AGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFM 60 Query: 87 LLF 89 LLF Sbjct: 61 LLF 63 >gi|288957580|ref|YP_003447921.1| ATPase F0 complex subunit C [Azospirillum sp. B510] gi|288909888|dbj|BAI71377.1| ATPase F0 complex subunit C [Azospirillum sp. B510] Length = 74 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 37/72 (51%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK++ G+A + + V L + NIF+T + RNP ++ + E++ L Sbjct: 3 PQAAKFIGAGLAVIALAGVGLGIGNIFSTLIGSIARNPAVQPKVFPIGILGFALTEAVAL 62 Query: 79 FLLLVVMLLLFV 90 F LL+ L+LF Sbjct: 63 FALLIAFLILFA 74 >gi|281428814|ref|YP_003354993.1| ATP synthase subunit 9 [Pneumocystis carinii] gi|270486331|gb|ACZ82954.1| ATP synthase subunit 9 [Pneumocystis carinii] Length = 74 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F L RNP T ++ +AE+ GLF Sbjct: 4 AAKIIGSGLATIGLAGAGVGIGLVFGNLLVATSRNPSLKGQLFTYAILGFALAEATGLFC 63 Query: 81 LLVVMLLLFV 90 L++ LLL+ Sbjct: 64 LMMAFLLLYA 73 >gi|77464618|ref|YP_354122.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides 2.4.1] gi|146276247|ref|YP_001166406.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides ATCC 17025] gi|221640530|ref|YP_002526792.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides KD131] gi|332559511|ref|ZP_08413833.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides WS8N] gi|123590919|sp|Q3IZ13|ATPL_RHOS4 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487663|sp|A4WNY7|ATPL_RHOS5 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|77389036|gb|ABA80221.1| FoF1 ATP synthase, subunit C [Rhodobacter sphaeroides 2.4.1] gi|145554488|gb|ABP69101.1| H+-transporting two-sector ATPase, C subunit [Rhodobacter sphaeroides ATCC 17025] gi|221161311|gb|ACM02291.1| H+-transporting two-sector ATPase, C subunit [Rhodobacter sphaeroides KD131] gi|332277223|gb|EGJ22538.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides WS8N] Length = 78 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K++ G+A +G+G + V ++ +L+GA RNP AA + + AE+LG+F Sbjct: 9 GKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 L+ +LL+F + Sbjct: 69 LIALLLMFAV 78 >gi|324309747|gb|ADY18528.1| ATPase subunit 9 [Phaeodactylum tricornutum] Length = 75 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 5 AAKYIGAGLATIGLAGAGVGIGTVFGALVLGISRNPSLKDELFKMAILGFALTEAIALFA 64 Query: 81 LLVVMLLLFVI 91 L++V LLLF + Sbjct: 65 LMIVFLLLFAL 75 >gi|156094784|ref|XP_001613428.1| ATP synthase lipid-binding protein, mitochondrial precursor [Plasmodium vivax SaI-1] gi|148802302|gb|EDL43701.1| ATP synthase lipid-binding protein, mitochondrial precursor, putative [Plasmodium vivax] Length = 165 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + N+F+ + G RNP T LI E LG+ +L+ Sbjct: 100 LSAAIALMSVGGVAQGIGNLFSALVLGTSRNPSIKDELFTYTLIGMGFLEFLGIICVLMS 159 Query: 85 MLLLF 89 +LL+ Sbjct: 160 AVLLY 164 >gi|71755377|ref|XP_828603.1| ATPase subunit 9 [Trypanosoma brucei TREU927] gi|2654782|gb|AAC48310.1| ATPase subunit 9 homolog [Trypanosoma brucei brucei] gi|70833989|gb|EAN79491.1| ATPase subunit 9, putative [Trypanosoma brucei] Length = 118 Score = 54.5 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 52 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 111 Query: 84 VMLLLF 89 L+LF Sbjct: 112 AFLMLF 117 >gi|148557378|ref|YP_001264960.1| H+-transporting two-sector ATPase C [Sphingomonas wittichii RW1] gi|148502568|gb|ABQ70822.1| H+-transporting two-sector ATPase, C subunit [Sphingomonas wittichii RW1] Length = 75 Score = 54.1 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 31/70 (44%), Positives = 43/70 (61%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+G+ AL V N+F ++L A RNP AA + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGVGMAALGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFV 90 +V M+LLFV Sbjct: 65 FVVAMILLFV 74 >gi|302415661|ref|XP_003005662.1| ATP synthase protein [Verticillium albo-atrum VaMs.102] gi|261355078|gb|EEY17506.1| ATP synthase protein [Verticillium albo-atrum VaMs.102] Length = 145 Score = 54.1 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 33/69 (47%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+ + + +F L+ RNP + ++ E++GLF L Sbjct: 77 SKNIGMGSAAIGLTGAGIGIGLVFAALLNSVARNPALRGQLFSYAILGFAFVEAIGLFDL 136 Query: 82 LVVMLLLFV 90 +V ++ F Sbjct: 137 MVALMAKFT 145 >gi|83951210|ref|ZP_00959943.1| FoF1 ATP synthase, subunit C [Roseovarius nubinhibens ISM] gi|254487394|ref|ZP_05100599.1| ATP synthase subunit C, putative [Roseobacter sp. GAI101] gi|83839109|gb|EAP78405.1| FoF1 ATP synthase, subunit C [Roseovarius nubinhibens ISM] gi|214044263|gb|EEB84901.1| ATP synthase subunit C, putative [Roseobacter sp. GAI101] Length = 78 Score = 54.1 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 43/70 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC+GMG A+ V N+ YL+GA RNP AA+ + I AE+LG+F Sbjct: 9 GAYIGAGLACMGMGGAAVGVGNVAGNYLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|72390954|ref|XP_845771.1| ATPase subunit 9 [Trypanosoma brucei TREU927] gi|62175812|gb|AAX69939.1| ATPase subunit 9, putative [Trypanosoma brucei] gi|70802307|gb|AAZ12212.1| ATPase subunit 9, putative [Trypanosoma brucei brucei strain 927/4 GUTat10.1] Length = 117 Score = 54.1 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 51 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 110 Query: 84 VMLLLF 89 L+LF Sbjct: 111 AFLMLF 116 >gi|57239564|ref|YP_180700.1| F0F1 ATP synthase subunit C [Ehrlichia ruminantium str. Welgevonden] gi|58579552|ref|YP_197764.1| F0F1 ATP synthase subunit C [Ehrlichia ruminantium str. Welgevonden] gi|58617606|ref|YP_196805.1| F0F1 ATP synthase subunit C [Ehrlichia ruminantium str. Gardel] gi|15811140|gb|AAL08820.1|AF308665_3 hypothetical ATP synthase C chain [Ehrlichia ruminantium] gi|57161643|emb|CAH58572.1| ATP synthase C subunit [Ehrlichia ruminantium str. Welgevonden] gi|58417218|emb|CAI28331.1| ATP synthase C chain [Ehrlichia ruminantium str. Gardel] gi|58418178|emb|CAI27382.1| ATP synthase C chain [Ehrlichia ruminantium str. Welgevonden] Length = 73 Score = 54.1 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 34/57 (59%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + K++AVG++ GM AL V+NIF+T L+G RNP K V A + E++G Sbjct: 3 SLKFIAVGLSVFGMVASALGVANIFSTMLNGLARNPETEDKLKKYVYTGAALVEAMG 59 >gi|159487014|ref|XP_001701531.1| F1F0 ATP synthase subunit 9, isoform A [Chlamydomonas reinhardtii] gi|158271592|gb|EDO97408.1| F1F0 ATP synthase subunit 9, isoform A [Chlamydomonas reinhardtii] Length = 159 Score = 54.1 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 90 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 149 Query: 81 LLVVMLLLFV 90 LLVV L+LF Sbjct: 150 LLVVFLILFA 159 >gi|322491552|emb|CBZ26823.1| putative ATPase subunit 9 [Leishmania mexicana MHOM/GT/2001/U1103] Length = 106 Score = 54.1 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALGGVGLGIGTIFGCLLMGCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|126724948|ref|ZP_01740791.1| F0F1 ATP synthase subunit C [Rhodobacterales bacterium HTCC2150] gi|126706112|gb|EBA05202.1| F0F1 ATP synthase subunit C [Rhodobacterales bacterium HTCC2150] Length = 78 Score = 54.1 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 28/70 (40%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC GMG A+ V + ++SGA RNP AA++ + I AE+LG+F Sbjct: 9 GAYIGAGLACTGMGGAAVGVGTVVGNFISGALRNPSAAASQTATMFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|110816060|ref|YP_684392.1| ATP synthase F0 subunit 9 [Oltmannsiellopsis viridis] gi|86450271|gb|ABC96350.1| ATP synthase F0 subunit 9 [Oltmannsiellopsis viridis] Length = 74 Score = 53.7 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F ++ + RNP V++ + + E++ LF Sbjct: 5 AAKLIGAGIATIGVLGSGIGIGFLFGSFFNAVARNPSVNKQLFPSVILGSALTEAIALFA 64 Query: 81 LLVVMLLLF 89 L++ ++L F Sbjct: 65 LMIALVLKF 73 >gi|23016148|ref|ZP_00055907.1| COG0636: F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Magnetospirillum magnetotacticum MS-1] gi|83313093|ref|YP_423357.1| ATP synthase C chain [Magnetospirillum magneticum AMB-1] gi|123754046|sp|Q2W027|ATPL_MAGMM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|82947934|dbj|BAE52798.1| ATP synthase C chain [Magnetospirillum magneticum AMB-1] Length = 74 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +GM + V NI+ ++ RNP A + + I + E++ LF Sbjct: 5 AAKFIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPSAKANVELYGWIGFAVTEAIALFA 64 Query: 81 LLVVMLLLFV 90 L+V +++LF Sbjct: 65 LVVALMVLFA 74 >gi|218461929|ref|ZP_03502020.1| F0F1 ATP synthase subunit C [Rhizobium etli Kim 5] Length = 58 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 27/47 (57%) Query: 34 MGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 M AL + NIF YLSGA RNP AA + ++ + E+LG+F Sbjct: 1 MAGTALGLGNIFGNYLSGALRNPSAADSQFGRLVFGFAVTEALGIFS 47 >gi|157814421|ref|YP_052723.2| ATP synthase F0 subunit 9 [Candida zemplinina] gi|157824560|gb|AAR10344.2| ATP synthase F0 subunit 9 [Candida zemplinina] Length = 76 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 41/72 (56%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA KY+ GMA +G+ + ++ +F ++G RNP S+ T ++ + E+ GLF Sbjct: 5 LAGKYMGAGMATIGLLGAGMGMAIVFAALMNGTARNPSLRSSLFTYAMLGFGLVEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L++ +LL+ + Sbjct: 65 CLMMSFMLLYAV 76 >gi|217979918|ref|YP_002364065.1| H+transporting two-sector ATPase C subunit [Methylocella silvestris BL2] gi|217505294|gb|ACK52703.1| H+transporting two-sector ATPase C subunit [Methylocella silvestris BL2] Length = 75 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 35/73 (47%), Positives = 46/73 (63%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK++ G+A +GMG A+ V IF +LSGA RNP A+ A I A +AE LG+ Sbjct: 3 PAAAKFIGAGLAAIGMGAAAIGVGLIFGNFLSGALRNPTASDAQFGRAFIGAALAEGLGI 62 Query: 79 FLLLVVMLLLFVI 91 F LV +LLLFV+ Sbjct: 63 FAFLVAILLLFVL 75 >gi|71648878|ref|XP_813219.1| ATPase subunit 9 [Trypanosoma cruzi strain CL Brener] gi|71653801|ref|XP_815532.1| ATPase subunit 9 [Trypanosoma cruzi strain CL Brener] gi|70878083|gb|EAN91368.1| ATPase subunit 9, putative [Trypanosoma cruzi] gi|70880593|gb|EAN93681.1| ATPase subunit 9, putative [Trypanosoma cruzi] Length = 108 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 42 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 101 Query: 84 VMLLLF 89 L+LF Sbjct: 102 AFLMLF 107 >gi|13579|emb|CAA28962.1| unnamed protein product [Saccharomyces cerevisiae] Length = 76 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 40/72 (55%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + ++ +F ++G RNP ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLLGGGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLF 64 Query: 80 LLLVVMLLLFVI 91 L+V LLLF + Sbjct: 65 CLMVSFLLLFGV 76 >gi|146343458|ref|YP_001208506.1| F0F1 ATP synthase subunit C [Bradyrhizobium sp. ORS278] gi|148252428|ref|YP_001237013.1| F0F1 ATP synthase subunit C [Bradyrhizobium sp. BTAi1] gi|146196264|emb|CAL80291.1| ATP synthase subunit C, membrane-bound, F0 sector; DCCD-binding [Bradyrhizobium sp. ORS278] gi|146404601|gb|ABQ33107.1| ATP synthase subunit C, membrane-bound, F0 sector [Bradyrhizobium sp. BTAi1] Length = 75 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 30/73 (41%), Positives = 44/73 (60%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AAKY+ G+AC+GMG + IF YLS A RNP AA ++ + E+LG+ Sbjct: 3 PVAAKYIGAGIACIGMGGAGAGIGIIFGNYLSAALRNPSAAQGQFGNLIFGFAVTEALGI 62 Query: 79 FLLLVVMLLLFVI 91 F LL+ +LLL+ + Sbjct: 63 FSLLIALLLLYAV 75 >gi|68171932|ref|ZP_00545248.1| H+-transporting two-sector ATPase, C subunit [Ehrlichia chaffeensis str. Sapulpa] gi|73667486|ref|YP_303502.1| F0F1 ATP synthase subunit C [Ehrlichia canis str. Jake] gi|88658098|ref|YP_507872.1| F0F1 ATP synthase subunit C [Ehrlichia chaffeensis str. Arkansas] gi|67998642|gb|EAM85379.1| H+-transporting two-sector ATPase, C subunit [Ehrlichia chaffeensis str. Sapulpa] gi|72394627|gb|AAZ68904.1| H+-transporting two-sector ATPase, C subunit [Ehrlichia canis str. Jake] gi|88599555|gb|ABD45024.1| ATP synthase F0, C chain [Ehrlichia chaffeensis str. Arkansas] Length = 73 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 34/57 (59%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + K++AVG++ GM AL V+NIF+T L+G RNP K V A + E++G Sbjct: 3 SLKFIAVGLSVFGMVASALGVANIFSTMLNGLARNPETEDKLKKYVYTGAALVEAMG 59 >gi|58578580|ref|YP_203326.1| ATP synthase F0 subunit 9 [Smittium culisetae] gi|57339024|gb|AAW49493.1| ATP synthase F0 subunit 9 [Smittium culisetae] Length = 73 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK +A G+A L + ++ + N+F++ L+ RNP T ++ + E++GLF Sbjct: 4 SAKLIAAGLAVLSLAGTSIGIGNVFSSLLNSYSRNPSLRGQLFTYSILGFALVEAMGLFA 63 Query: 81 LLVVMLLLF 89 L++ L L+ Sbjct: 64 LMMSFLFLY 72 >gi|71082825|ref|YP_265544.1| F0F1 ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1062] gi|91762752|ref|ZP_01264717.1| ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1002] gi|254455257|ref|ZP_05068686.1| ATP synthase subunit C, putative [Candidatus Pelagibacter sp. HTCC7211] gi|123761708|sp|Q4FPE8|ATPL_PELUB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|71061938|gb|AAZ20941.1| H+-transporting two-sector ATPase (subunit C) [Candidatus Pelagibacter ubique HTCC1062] gi|91718554|gb|EAS85204.1| ATP synthase subunit C [Candidatus Pelagibacter ubique HTCC1002] gi|207082259|gb|EDZ59685.1| ATP synthase subunit C, putative [Candidatus Pelagibacter sp. HTCC7211] Length = 75 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 27/70 (38%), Positives = 41/70 (58%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A + + + + IF YLSGA RNP AA +L+ +AE+ GLF Sbjct: 5 AAKMIGAGLAAIALAGAGVGIGIIFGNYLSGAMRNPSAAQKQFPNLLLGFALAEATGLFG 64 Query: 81 LLVVMLLLFV 90 L+V +++LF Sbjct: 65 LVVALIILFA 74 >gi|239811651|gb|ACS27138.1| ATP synthase F0 subunit 9 [Heterosigma akashiwo] gi|239811691|gb|ACS27177.1| ATP synthase F0 subunit 9 [Heterosigma akashiwo] gi|288871947|dbj|BAI70633.1| ATP synthase F0 subunit 9 [Heterosigma akashiwo] Length = 75 Score = 53.3 bits (127), Expect = 9e-06, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G+A +G+ + + +F+ + G RNP ++ + E+ LF Sbjct: 5 AAKFVGAGLATIGLAGAGVGIGTVFSALVLGTSRNPSIKDDLFRFAILGFALTEATALFA 64 Query: 81 LLVVMLLLFV 90 L+V L+LF Sbjct: 65 LMVAFLILFA 74 >gi|22653456|gb|AAN04072.1| ATP synthase F0 subunit 9 [Amoebidium parasiticum] Length = 74 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 K+V G+A +G+ + + +F+ L+ RNP + ++ + E++ LF Sbjct: 4 GLKFVGAGLATIGLTGAGIGIGMVFSALLNATSRNPSLKQQLFSNAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 64 LMIAFLILFA 73 >gi|121543775|gb|ABM55557.1| ATP synthase c subunit-like protein [Maconellicoccus hirsutus] Length = 144 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G +G+ + ++F + + G RNP + + ++ ++E++GLF Sbjct: 74 AAKFIGAGACTVGIAGSGAGIGSVFGSLIIGYARNPSLKAQLFSYAILGFALSEAMGLFC 133 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 134 LMMAFLILYA 143 >gi|301353302|ref|YP_003795374.1| ATP9 [Phakopsora pachyrhizi] gi|301353463|ref|YP_003795684.1| ATP synthase subunit 9 [Phakopsora meibomiae] gi|251765315|gb|ACT15468.1| ATP9 [Phakopsora pachyrhizi] gi|253807587|gb|ACT36166.1| ATP synthase subunit 9 [Phakopsora meibomiae] Length = 73 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F ++G RNP + + ++ ++E+ GLF Sbjct: 4 AAKIIGSGLATIGLAGAGVGIGIVFQGLITGTARNPAIRNQLFSYAILGFALSEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMSFLLLY 72 >gi|74272627|gb|ABA01109.1| mitochondrial ATP synthase F0 subunit 9 [Chlamydomonas incerta] Length = 159 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K V G A + + V + +F + ++GA RNP A L+ + ES+ LF Sbjct: 90 ASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIALFS 149 Query: 81 LLVVMLLLFV 90 LLVV L+LF Sbjct: 150 LLVVFLILFA 159 >gi|87199338|ref|YP_496595.1| H+-transporting two-sector ATPase, C subunit [Novosphingobium aromaticivorans DSM 12444] gi|87135019|gb|ABD25761.1| ATP synthase F0 subcomplex C subunit [Novosphingobium aromaticivorans DSM 12444] Length = 75 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G GL +L V N+F +L GA RNP AA + + I AE LGL Sbjct: 5 SAKLLGAGLAAVGAGLASLGVGNVFAKFLEGALRNPGAADGQQGRLFIGFAAAELLGLLS 64 Query: 81 LLVVMLLLFV 90 +V M+L+FV Sbjct: 65 FVVAMILIFV 74 >gi|296419564|ref|XP_002839372.1| hypothetical protein [Tuber melanosporum Mel28] gi|295635512|emb|CAZ83563.1| unnamed protein product [Tuber melanosporum] Length = 74 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K + G+A G+ + + +F + G RNP + + ++ E+ GLF Sbjct: 4 ASKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRAQLFSYAILGFAFCEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMIAFLLLYV 73 >gi|4588703|gb|AAD26184.1|AF114942_1 ATP synthase subunit 9 [Kazachstania barnettii] gi|4588705|gb|AAD26185.1|AF114943_1 ATP synthase subunit 9 [Kazachstania barnettii] Length = 64 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 34/64 (53%) Query: 27 VGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 G+A +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V + Sbjct: 1 AGIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFM 60 Query: 87 LLFV 90 L+F Sbjct: 61 LMFT 64 >gi|212540790|ref|XP_002150550.1| ATP synthase subunit ATP9, putative [Penicillium marneffei ATCC 18224] gi|210067849|gb|EEA21941.1| ATP synthase subunit ATP9, putative [Penicillium marneffei ATCC 18224] Length = 148 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 29/66 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G A +G+ + +F L RNP ++ E++GLF L++ Sbjct: 83 IGMGSAAIGLAGAGTGIGLVFAALLHSVARNPSLRGQLFAYAILGFAFVEAIGLFDLMIA 142 Query: 85 MLLLFV 90 M+ F+ Sbjct: 143 MMAKFL 148 >gi|4877685|gb|AAD31412.1|AF119066_1 ATPase subunit 9 [Saccharomyces kunashirensis] Length = 63 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 34/63 (53%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G+A +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V +L Sbjct: 1 GIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFML 60 Query: 88 LFV 90 +F Sbjct: 61 MFT 63 >gi|71418244|ref|XP_810789.1| ATPase subunit 9 [Trypanosoma cruzi strain CL Brener] gi|70875377|gb|EAN88938.1| ATPase subunit 9, putative [Trypanosoma cruzi] Length = 109 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 43 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 102 Query: 84 VMLLLF 89 L+LF Sbjct: 103 AFLMLF 108 >gi|260816529|ref|XP_002603023.1| hypothetical protein BRAFLDRAFT_123990 [Branchiostoma floridae] gi|229288338|gb|EEN59035.1| hypothetical protein BRAFLDRAFT_123990 [Branchiostoma floridae] Length = 191 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 20/88 (22%), Positives = 42/88 (47%) Query: 4 QMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHK 63 Q++ +A + AAK++ G A +G + +F + G RNP Sbjct: 104 QIVRGFQTSAVSRDIDTAAKFIGAGAATVGAAGSGAGIGTVFGSLCIGYARNPSLKQQLF 163 Query: 64 TEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + ++ ++E++GLF L++ ++LF + Sbjct: 164 SYAILGFALSEAMGLFCLMMAFVILFAM 191 >gi|7327287|gb|AAB29031.2| ATP synthase proteolipid subunit [Physarum polycephalum] Length = 83 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 32/69 (46%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 + K + G+A +G+ V +F + + G RNP ++ + E++ L Sbjct: 14 SGKSIGAGLATIGLAGAGTGVGIVFGSLVFGLSRNPAEEQRLFKYAMLGFAVTEAVALLA 73 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 74 LMMAFLILF 82 >gi|228015410|ref|YP_002836198.1| ATP synthase subunit 9 [Nakaseomyces delphensis] gi|227806670|emb|CAX36928.1| ATP synthase subunit 9 [Nakaseomyces delphensis] Length = 76 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 39/71 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAAKY+ G++ +G+ + + +F ++G RNP + ++ ++E+ GLF Sbjct: 5 LAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEATGLF 64 Query: 80 LLLVVMLLLFV 90 L+V ++LF Sbjct: 65 CLMVSFIILFT 75 >gi|83594575|ref|YP_428327.1| H+-transporting two-sector ATPase, subunit C [Rhodospirillum rubrum ATCC 11170] gi|114673|sp|P15014|ATPL_RHORU RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123725849|sp|Q2RPA5|ATPL_RHORT RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|46372|emb|CAA31247.1| ATPase F-0-subunit c (AA 1 - 75) [Rhodospirillum rubrum] gi|152600|gb|AAA26456.1| ATP synthase F-0 sector, c subunit [Rhodospirillum rubrum] gi|83577489|gb|ABC24040.1| H+-transporting two-sector ATPase, C subunit [Rhodospirillum rubrum ATCC 11170] Length = 75 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 24/70 (34%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +GM + V NI+ ++ RNP A S + I + E++ LF Sbjct: 5 AAKMIGAGLAAIGMIGSGIGVGNIWANLIATVGRNPAAKSTVELYGWIGFAVTEAIALFA 64 Query: 81 LLVVMLLLFV 90 L+V ++LLF Sbjct: 65 LVVALILLFA 74 >gi|326387164|ref|ZP_08208774.1| H+-transporting two-sector ATPase, C subunit [Novosphingobium nitrogenifigens DSM 19370] gi|326208345|gb|EGD59152.1| H+-transporting two-sector ATPase, C subunit [Novosphingobium nitrogenifigens DSM 19370] Length = 74 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 28/69 (40%), Positives = 40/69 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G GL ++ V N+F +L GA RNP AA + + I AE LGL Sbjct: 5 AAKLLGAGLAAIGAGLASIGVGNVFAKFLEGALRNPGAADGQQGRLFIGFAGAELLGLLS 64 Query: 81 LLVVMLLLF 89 ++ LL+F Sbjct: 65 FVIAALLIF 73 >gi|154337112|ref|XP_001564789.1| ATPase subunit 9 [Leishmania braziliensis MHOM/BR/75/M2904] gi|134061827|emb|CAM38862.1| putative ATPase subunit 9 [Leishmania braziliensis MHOM/BR/75/M2904] Length = 106 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 32/66 (48%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V + + IF + L R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALAGVGMGIGTIFGSLLMSCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|84508525|ref|YP_448689.1| ATP synthase F0 subunit c [Dictyota dichotoma] gi|45925693|gb|AAS79074.1| ATPase subunit 9 [Dictyota dichotoma] Length = 75 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 5 AAKILGAGLATIGLAGAGVGIGTVFGALVLGTSRNPSLKDELFRYAILGFALTEAIALFA 64 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 65 LMMAFLILFAV 75 >gi|154339177|ref|XP_001562280.1| ATPase subunit 9 [Leishmania braziliensis MHOM/BR/75/M2904] gi|134062863|emb|CAM39310.1| putative ATPase subunit 9 [Leishmania braziliensis MHOM/BR/75/M2904] Length = 106 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 32/66 (48%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V + + IF + L R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALAGVGMGIGTIFGSLLMSCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|146221428|gb|ABQ11828.1| ATP synthase F0 subunit 9 [Iphiteon panicea] Length = 80 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G A +G+ + +F + + RNP T ++ I+E++GLF Sbjct: 10 SAKLIGAGAATVGVAGSGAGIGTVFGSLVIAYARNPKLKQQLFTYAILGFAISEAMGLFC 69 Query: 81 LLVVMLLLFVI 91 L++ L+L+ I Sbjct: 70 LMMAFLILYGI 80 >gi|15147257|ref|NP_150330.1| ATP synthase F0 subunit 9 [Rhizophydium sp. 136] gi|15100099|gb|AAK84260.1|AF404306_2 ATP synthase F0 subunit 9 [Rhizophydium sp. 136] Length = 79 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 35/69 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K + G+A G+ A V +F Y+SG RNP + ++ + E+LGLF L Sbjct: 10 GKLIGGGLATFGLAGAATGVGIVFAAYISGVSRNPSLKAELFNITILGFALVEALGLFSL 69 Query: 82 LVVMLLLFV 90 + +++LF Sbjct: 70 MKSLMILFA 78 >gi|4877663|gb|AAD31401.1|AF119055_1 ATPase subunit 9 [Naumovia dairenensis] Length = 64 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 36/64 (56%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G+A +G+ + ++ +F+ ++G RNP + ++ ++E+ GLF L++ +L Sbjct: 1 GIATIGLLGAGIGIAIVFSALINGVSRNPSLKDQLFSFAILGMALSEATGLFCLMISFIL 60 Query: 88 LFVI 91 LF + Sbjct: 61 LFAV 64 >gi|157868914|ref|XP_001683009.1| ATPase subunit 9 [Leishmania major strain Friedlin] gi|68223892|emb|CAJ04246.1| putative ATPase subunit 9 [Leishmania major strain Friedlin] Length = 106 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|294494193|gb|ADE92942.1| mitochondrial ATP synthase subunit c [Polytomella sp. Pringsheim 198.80] Length = 127 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 27/87 (31%), Positives = 40/87 (45%) Query: 4 QMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHK 63 Q A + A+K V G A + + V + +F + ++GA RNP A Sbjct: 41 QAAPAEVAQVRSMSVLAASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLV 100 Query: 64 TEVLIFAVIAESLGLFLLLVVMLLLFV 90 L+ + ES+ LF LLVV L+LF Sbjct: 101 GYALLGFALTESIALFSLLVVFLILFA 127 >gi|10802940|gb|AAG23688.1|AF288091_33 ATP synthase F0 subunit 9 [Thraustochytrium aureum] Length = 75 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F ++ G RNP L+ + E++ LF+ Sbjct: 5 AAKLIGAGVATVGLTGAGIGIGTVFGAFIVGMSRNPSMEQKMFKFCLMGFALTEAIALFV 64 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 65 LMMAFLILFT 74 >gi|310756728|gb|ADP20505.1| mitochondrial ATP synthase lipid-binding protein isoform A precursor [Fukomys anselli] Length = 141 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 31/71 (43%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ NP + ++ ++E++GLF Sbjct: 71 AAKFIGAGAATVGVAGXXXXXXXXXXXXXXXXXXNPSLKQQLFSYAILGFALSEAMGLFC 130 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 131 LMVAFLILFAM 141 >gi|50261312|ref|YP_052921.1| ATP synthase F0 subunit 9 [Saprolegnia ferax] gi|48237625|gb|AAT40674.1| ATP synthase F0 subunit 9 [Saprolegnia ferax] Length = 75 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +G+ + + N+F + + G RNP ++ + E++ LF Sbjct: 5 AAKFLGAGLATIGLAGAGVGIGNVFGSLILGISRNPSLQQELMRAAILGFALTEAIALFS 64 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 65 LMIAFLILFA 74 >gi|296217809|ref|XP_002755200.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like, partial [Callithrix jacchus] Length = 77 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 28/57 (49%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + +F + + G RNP + ++ ++E++GLF L+V L+LF + Sbjct: 21 IGAGAGIGTVFGSLIIGYARNPSLKQQLFSYTILGFALSEAMGLFCLMVAFLILFAM 77 >gi|144898766|emb|CAM75630.1| ATP synthase C chain [Magnetospirillum gryphiswaldense MSR-1] Length = 74 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 41/70 (58%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +GM + V NI+++ ++ RNP A + + I + E++ LF Sbjct: 5 AAKFIGAGLAAIGMIGSGIGVGNIWSSLIATVGRNPAAKANVELYGWIGFAVTEAIALFA 64 Query: 81 LLVVMLLLFV 90 L+V +++LF Sbjct: 65 LVVALMVLFA 74 >gi|71421727|ref|XP_811884.1| ATPase subunit 9 [Trypanosoma cruzi strain CL Brener] gi|70876597|gb|EAN90033.1| ATPase subunit 9, putative [Trypanosoma cruzi] gi|322830633|gb|EFZ33592.1| ATPase subunit 9, putative [Trypanosoma cruzi] Length = 105 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 39 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 98 Query: 84 VMLLLF 89 L+LF Sbjct: 99 AFLMLF 104 >gi|27728698|gb|AAO18671.1| ATP synthase c-subunit precursor [Branchiostoma belcheri tsingtauense] gi|134048896|dbj|BAF49514.1| ATP synthase c-subunit [Branchiostoma belcheri] Length = 148 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/88 (22%), Positives = 42/88 (47%) Query: 4 QMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHK 63 Q++ +A + AAK++ G A +G + +F + G RNP Sbjct: 61 QIVRGFQTSAVSRDIDTAAKFIGAGAATVGAAGSGAGIGTVFGSLCIGYARNPSLKQQLF 120 Query: 64 TEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + ++ ++E++GLF L++ ++LF + Sbjct: 121 SYAILGFALSEAMGLFCLMMAFVILFAM 148 >gi|322498821|emb|CBZ33893.1| unnamed protein product [Leishmania donovani BPK282A1] Length = 106 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|329113594|ref|ZP_08242374.1| ATP synthase subunit c [Acetobacter pomorum DM001] gi|326697116|gb|EGE48777.1| ATP synthase subunit c [Acetobacter pomorum DM001] Length = 77 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+ + G+A + + V + + NIF+T +S RNP + ++ + E++ LF Sbjct: 8 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNPASRPHVFGLGMLGFALTEAIALFA 67 Query: 81 LLVVMLLLFV 90 LL+ L+LFV Sbjct: 68 LLIAFLILFV 77 >gi|4877687|gb|AAD31413.1|AF119067_1 ATPase subunit 9 [Saccharomyces martiniae] Length = 64 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 35/64 (54%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G+A +G+ + ++ +F ++G RNP + ++ ++E+ GLF L++ +L Sbjct: 1 GIATIGLLGAGIGIAVVFAALINGVSRNPSMKDTLFSYTILGMALSEATGLFCLMISFML 60 Query: 88 LFVI 91 LF + Sbjct: 61 LFAV 64 >gi|110578642|ref|YP_667831.1| ATP synthase F0 subunit 9 [Verticillium dahliae] gi|84682169|gb|ABC60428.1| ATP synthase F0 subunit 9 [Verticillium dahliae] Length = 74 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + G RNP + ++ +E+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFSEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|29570610|ref|NP_818784.1| ATP synthase protein 9 [Candida glabrata CBS138] gi|51315959|sp|Q85Q98|ATP9_CANGA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|29500875|emb|CAD54425.1| ATP synthase protein 9 [Candida glabrata] Length = 76 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 20/73 (27%), Positives = 41/73 (56%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +LAAKY+ G++ +G+ + + +F ++G RNP + ++ ++E+ GL Sbjct: 4 ALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSYSILGMALSEATGL 63 Query: 79 FLLLVVMLLLFVI 91 F L++ +LLF + Sbjct: 64 FCLMISFMLLFAV 76 >gi|119502377|ref|XP_001267677.1| ATP synthase subunit ATP9, putative [Neosartorya fischeri NRRL 181] gi|119416379|gb|EAW25780.1| ATP synthase subunit ATP9, putative [Neosartorya fischeri NRRL 181] Length = 73 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + G RNP + ++ AE+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|74325193|ref|YP_316613.1| ATPase subunit 9 [Thalassiosira pseudonana] gi|74100259|gb|AAZ99420.1| ATPase subunit 9 [Thalassiosira pseudonana] Length = 75 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 5 AAKFVGAGLATIGLAGAGVGIGTVFGALVIGVSRNPSLKDELFKLAILGFALTEAIALFS 64 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 65 LMMAFLILFAL 75 >gi|323398680|ref|YP_004222755.1| ATP synthase F0 subunit c [Glaucocystis nostochinearum] gi|321401373|gb|ADW83127.1| ATP synthase F0 subunit c [Glaucocystis nostochinearum] Length = 74 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK V G+A + + + + +F + ++ RNP ++ + E++ LF Sbjct: 4 SAKLVGAGLATIALAGAGVGIGVVFGSLINSVARNPSLNDQLFKYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 64 LMMAFLILFT 73 >gi|11467060|ref|NP_042536.1| H(+)-transporting ATPase, subunit 9 [Acanthamoeba castellanii] gi|6647459|sp|Q37377|ATP9_ACACA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|562041|gb|AAD11829.1| H(+)-transporting ATPase, subunit 9 [Acanthamoeba castellanii] Length = 79 Score = 52.2 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 ++K + G+A G+ V +F + RNP + LI + E++GL Sbjct: 10 SSKMIGSGLATSGLIGAGAGVGIVFGCLILAFSRNPNLQKELFSYALIGFALTEAIGLLA 69 Query: 81 LLVVMLLLFV 90 L++ L+LF+ Sbjct: 70 LVMAFLILFI 79 >gi|289065194|ref|YP_003434246.1| ATP synthase F0 subunit 9 [Chattonella marina] gi|288871906|dbj|BAI70593.1| ATP synthase F0 subunit 9 [Chattonella marina] Length = 75 Score = 52.2 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 AK+V G+A +G+ + + +F + G RNP ++ + E++ LF L Sbjct: 6 AKFVGAGLATIGLAGAGVGIGTVFGALVLGTSRNPSLKDELFRIAILGFALTEAIALFAL 65 Query: 82 LVVMLLLFVI 91 ++ L+LF + Sbjct: 66 MMAFLILFAL 75 >gi|4877665|gb|AAD31402.1|AF119056_1 ATPase subunit 9 [Kazachstania exigua] gi|17232873|gb|AAD31409.2|AF119063_1 ATPase subunit 9 [Kazachstania exigua] Length = 64 Score = 52.2 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 34/63 (53%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G+A +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V +L Sbjct: 1 GIATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFML 60 Query: 88 LFV 90 LF Sbjct: 61 LFA 63 >gi|84994376|ref|XP_951910.1| ATP synthase subunit C, mitochondrial [Theileria annulata strain Ankara] gi|65302071|emb|CAI74178.1| ATP synthase subunit C, mitochondrial, putative [Theileria annulata] Length = 163 Score = 52.2 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 32/72 (44%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 Y + +A + +G VA + N+F +SG RNP T LI E L Sbjct: 91 YDGGVATLGAAVALMSVGGVAQGIGNLFAALVSGTARNPSIKEDLFTYTLIGMGFLEFLA 150 Query: 78 LFLLLVVMLLLF 89 + +L+ ++L+ Sbjct: 151 IVCILMGAIMLY 162 >gi|265141236|gb|ACY74438.1| ATP synthase H+ transporting-like protein [Carukia barnesi] Length = 150 Score = 52.2 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G + +F + + G RNP + ++ ++E++GLF Sbjct: 80 AAKFIGAGAATVGAAGSGAGIGTVFGSLVMGYARNPSLKQQLFSYAILGFALSEAMGLFC 139 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 140 LMMAFLILFAL 150 >gi|146085898|ref|XP_001465387.1| ATPase subunit 9 [Leishmania infantum JPCM5] gi|134069485|emb|CAM67808.1| putative ATPase subunit 9 [Leishmania infantum JPCM5] Length = 106 Score = 52.2 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|310789322|gb|EFQ24855.1| ATP synthase subunit 9 [Glomerella graminicola M1.001] Length = 74 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 AK + G+A G+ + + +F + G RNP + ++ +E+ GLF L Sbjct: 5 AKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSMRGQLFSYAILGFAFSEATGLFAL 64 Query: 82 LVVMLLLFV 90 ++ LLL+V Sbjct: 65 MMAFLLLYV 73 >gi|13508342|ref|NP_110292.1| F0F1 ATP synthase subunit C [Mycoplasma pneumoniae M129] gi|2493074|sp|Q59550|ATPL_MYCPN RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|1209761|gb|AAC43654.1| ATP synthase c chain [Mycoplasma pneumoniae] gi|1673907|gb|AAB95887.1| ATP synthase C chain [Mycoplasma pneumoniae M129] Length = 105 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 21/77 (27%), Positives = 33/77 (42%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 AN Y+ G+ +G V L IF + RNP + I + I+ Sbjct: 26 ANKSTERLGAYIGAGITMVGGATVGLGQGYIFGKAVEAVARNPEVEKQVFKLIFIGSAIS 85 Query: 74 ESLGLFLLLVVMLLLFV 90 ES ++ LL+ +L+FV Sbjct: 86 ESSSIYSLLIAFILIFV 102 >gi|13205|emb|CAA34810.1| unnamed protein product [Oryza sativa Indica Group] Length = 87 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGRAVGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|11465630|ref|NP_049301.1| ATP synthase F0 subunit 9 [Porphyra purpurea] gi|4106937|gb|AAD03104.1| ATP synthase F0 subunit 9 [Porphyra purpurea] Length = 76 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ V V +F + + RNP + ++ + E++ LF Sbjct: 7 SAKMIGAGLATIGLTGVGAGVGIVFGSLVIAYSRNPSLKNELFGYTILGFALTEAIALFA 66 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 67 LMMAFLILFT 76 >gi|13723|emb|CAA34172.1| unnamed protein product [Triticum aestivum] Length = 80 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIVLAGAAVGIGNVLSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|296114244|ref|ZP_06832899.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter hansenii ATCC 23769] gi|330991387|ref|ZP_08315338.1| ATP synthase subunit c [Gluconacetobacter sp. SXCC-1] gi|295979320|gb|EFG86043.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter hansenii ATCC 23769] gi|329761406|gb|EGG77899.1| ATP synthase subunit c [Gluconacetobacter sp. SXCC-1] Length = 74 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+ + G+A + + V + + NIF+T +S RNP A ++ + E++ L+ Sbjct: 5 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNPSARPHVFGLGMLGFALTEAVALYA 64 Query: 81 LLVVMLLLFV 90 LL+ L+LFV Sbjct: 65 LLIAFLILFV 74 >gi|126463458|ref|YP_001044572.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides ATCC 17029] gi|224487616|sp|A3PN84|ATPL1_RHOS1 RecName: Full=ATP synthase subunit c 1; AltName: Full=ATP synthase F(0) sector subunit c 1; AltName: Full=F-type ATPase subunit c 1; Short=F-ATPase subunit c 1; AltName: Full=Lipid-binding protein 1 gi|126105122|gb|ABN77800.1| H+-transporting two-sector ATPase, C subunit [Rhodobacter sphaeroides ATCC 17029] Length = 71 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 41/70 (58%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K++ G+A +G+G + V ++ +L+GA RNP AA + + AE+LG+F Sbjct: 2 GKFIGAGLATIGLGGAGIGVGHVAGNFLAGALRNPSAAPGQMANLFVGIAFAEALGIFSF 61 Query: 82 LVVMLLLFVI 91 L+ +LL+F + Sbjct: 62 LIALLLMFAV 71 >gi|15088736|ref|NP_150106.1| ATP synthase F0 subunit 9 [Hyaloraphidium curvatum] gi|15077943|gb|AAK83428.1|AF402142_12 ATP synthase F0 subunit 9 [Hyaloraphidium curvatum] Length = 74 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 36/71 (50%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L K + G+A + + + + IF + +SG RNP ++ + E++GLF Sbjct: 3 LVGKLIGAGLATIALAGAGVGIGLIFASLISGISRNPSVRRELFNMAILGFALTEAIGLF 62 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 63 ALMMALILLYA 73 >gi|222475510|ref|YP_002563927.1| ATP synthase C chain (atpE) [Anaplasma marginale str. Florida] gi|56388377|gb|AAV86964.1| ATP synthase C chain [Anaplasma marginale str. St. Maries] gi|222419648|gb|ACM49671.1| ATP synthase C chain (atpE) [Anaplasma marginale str. Florida] Length = 80 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 34/61 (55%) Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 ++ + ++VAVG++ LGM A V+ +F+ L+G RNP K V A + E++ Sbjct: 5 WFMDSLRFVAVGLSVLGMVASAFGVAAVFSAMLNGIARNPETEDKLKKYVYTGAALVEAM 64 Query: 77 G 77 G Sbjct: 65 G 65 >gi|23464607|ref|NP_696975.1| ATP synthase F0 subunit 9 [Monosiga brevicollis ATCC 50154] gi|23344070|gb|AAN28346.1| ATP synthase F0 subunit 9 [Monosiga brevicollis] Length = 73 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +G+ + +F + ++G RNP T ++ ++E++ LF Sbjct: 4 AAKFIGGGLAAIGVAGSGAGIGTVFGSLITGYARNPSLKQGMFTYAILGFALSEAVALFA 63 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 64 LMISFLILF 72 >gi|11466567|ref|NP_066457.1| ATP synthase F0 subunit 9 [Rhodomonas salina] gi|10444154|gb|AAG17728.1|AF288090_4 ATP synthase F0 subunit 9 [Rhodomonas salina] Length = 77 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ V + +F ++ RNP ++ + E++GLF Sbjct: 8 SAKQIGAGLATIGLAGVGAGIGIVFAALVNSFARNPSLRQQLFGFTILGFALTEAIGLFA 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMMAFLILF 76 >gi|164422138|ref|YP_001648752.1| ATP synthase subunit 9 [Mycosphaerella graminicola] gi|155964401|gb|ABU40268.1| ATP synthase subunit 9 [Mycosphaerella graminicola] Length = 74 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + G RNP + ++ AE+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|38639901|ref|NP_943712.1| ATP synthase subunit 9 [Penicillium marneffei] gi|33860255|gb|AAQ54913.1| ATP synthase subunit 9 [Penicillium marneffei] Length = 74 Score = 51.8 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +++ +A G+A G+ + + +F + G RNP ++ +E+ GLF Sbjct: 4 SSRLIATGLATTGLIGAGVGIGIVFGALILGVSRNPSLRGQLFNYAILGFAFSEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|146087746|ref|XP_001465892.1| ATPase subunit 9 [Leishmania infantum JPCM5] gi|157870055|ref|XP_001683578.1| ATPase subunit 9 [Leishmania major strain Friedlin] gi|68126644|emb|CAJ04348.1| putative ATPase subunit 9 [Leishmania major strain Friedlin] gi|134069993|emb|CAM68323.1| putative ATPase subunit 9 [Leishmania infantum JPCM5] gi|322499379|emb|CBZ34452.1| unnamed protein product [Leishmania donovani BPK282A1] Length = 106 Score = 51.8 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 33/66 (50%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + +G V L + IF L G R P ++ + E++GLF L++ Sbjct: 40 YVGTGLAAIALGGVGLGIGAIFGCLLIGCARQPNLTKMLFNYAILGFALTEAIGLFALML 99 Query: 84 VMLLLF 89 L+LF Sbjct: 100 AFLMLF 105 >gi|2118197|pir||S59550 H+-transporting two-sector ATPase (EC 3.6.3.14) chain 9.1 - radish mitochondrion Length = 85 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 15 GAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 74 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 75 LMMAFLILFV 84 >gi|196018978|ref|XP_002118905.1| hypothetical protein TRIADDRAFT_34930 [Trichoplax adhaerens] gi|190577795|gb|EDV18611.1| hypothetical protein TRIADDRAFT_34930 [Trichoplax adhaerens] Length = 75 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 32/57 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 A KY+ VG++ + M A+ + NIF+ L+G RNP A I A +AE++G Sbjct: 5 ALKYIGVGLSSIAMFGAAVGIGNIFSALLNGIARNPSAEEKLMKGAFIGAGLAEAMG 61 >gi|325120605|emb|CBZ56159.1| putative ATP synthase lipid-binding protein [Neospora caninum Liverpool] Length = 170 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + ++F +SG RNP T LI E LG+ +L+ Sbjct: 105 LSAAIALMSVGGVAQGIGSLFAALVSGTARNPSIKEDLFTYTLIGMGFLEFLGIICVLMS 164 Query: 85 MLLLF 89 +LL+ Sbjct: 165 AVLLY 169 >gi|71423300|ref|XP_812413.1| ATPase subunit 9 [Trypanosoma cruzi strain CL Brener] gi|70877190|gb|EAN90562.1| ATPase subunit 9, putative [Trypanosoma cruzi] Length = 109 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 YV G+A + + V L + IF L R P ++ + E++GLF L++ Sbjct: 43 YVGTGLAAIALAGVGLGIGTIFGNLLVACARQPNLTKMLFNYAILGFALTEAIGLFALML 102 Query: 84 VMLLLF 89 L+LF Sbjct: 103 AFLMLF 108 >gi|58578625|ref|YP_203345.1| ATP synthase F0 subunit 9 [Mortierella verticillata] gi|57545558|gb|AAW51682.1| ATP synthase F0 subunit 9 [Mortierella verticillata] Length = 73 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 37/69 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ + + +F ++ RNP + + ++ + E++GLF Sbjct: 4 SAKIIGAGLATIGLAGAGVGIGTVFAALVNSTARNPSIKAQLFSYTILGFALTEAIGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMAFLLLY 72 >gi|11466219|ref|NP_066542.1| ATP synthase F0 subunit 9 [Naegleria gruberi] gi|10444254|gb|AAG17820.1|AF288092_45 ATP synthase F0 subunit 9 [Naegleria gruberi] Length = 72 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 32/66 (48%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K + G+A + + V + + IF L RNP A ++ + E++ LF ++ Sbjct: 6 KQIGAGLATIALSGVGVGIGIIFGNLLDSVSRNPSIAKLLFNYAILGFALTEAIALFTIM 65 Query: 83 VVMLLL 88 +V LL+ Sbjct: 66 IVFLLM 71 >gi|114152776|sp|P60112|ATP9_ARATH RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein Length = 85 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 15 GAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 74 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 75 LMMAFLILFV 84 >gi|297692801|ref|XP_002823723.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Pongo abelii] Length = 136 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ V A +G+G + +F + + G RN ++ ++E +GLF Sbjct: 66 AAKFIGVWAATVGVGGSGAGIGTVFGSLIIGCARNLSLKQQLFFYAILGFALSEVMGLFC 125 Query: 81 LLVVMLLLFV 90 L+V L+LF Sbjct: 126 LMVAFLILFT 135 >gi|312219415|emb|CBX99359.1| similar to ATP synthase F0 subunit 9 [Leptosphaeria maculans] Length = 74 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK GMA +G+ + + +F + G RNP ++ AE+ GLF Sbjct: 4 AAKIQGAGMATIGLAGAGVGIGTVFGGLIQGVARNPSLRGQLFQYAVLGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMSFLLLYV 73 >gi|4877661|gb|AAD31400.1|AF119054_1 ATPase subunit 9 [Naumovia dairenensis] Length = 60 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 31/60 (51%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ + ++ +F ++G RNP + ++ ++E+ GLF L+V +L+F Sbjct: 1 TIGLLGAGIGIAIVFAALINGVSRNPSLKNQLFQYCILGMALSEATGLFCLMVSFILMFT 60 >gi|38638274|ref|NP_943666.1| ATP synthase F0 subunit 9 [Chara vulgaris] gi|32966588|gb|AAP92171.1| ATP synthase F0 subunit 9 [Chara vulgaris] Length = 76 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 6 GAKLIGAGCATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 65 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 66 LMMAFLILFV 75 >gi|9653244|ref|NP_062490.1| ATP synthase F0 subunit 9 [Chondrus crispus] gi|313768499|ref|YP_004062175.1| ATP synthase F0 subunit 9 [Gracilariophila oryzoides] gi|313768524|ref|YP_004062199.1| ATP synthase F0 subunit 9 [Gracilariopsis andersonii] gi|313768552|ref|YP_004062226.1| ATP synthase F0 subunit 9 [Plocamiocolax pulvinata] gi|1352021|sp|P48880|ATP9_CHOCR RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|1334491|emb|CAA87613.1| ATP synthetase, subunit 9 [Chondrus crispus] gi|312844626|gb|ADR03191.1| ATP synthase F0 subunit 9 [Gracilariophila oryzoides] gi|312844651|gb|ADR03215.1| ATP synthase F0 subunit 9 [Gracilariopsis andersonii] gi|312844679|gb|ADR03242.1| ATP synthase F0 subunit 9 [Plocamiocolax pulvinata] Length = 76 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ V V +F + + RNP ++ + E++ LF Sbjct: 7 SAKMIGAGLATIGLTGVGAGVGIVFGSLVMAYARNPSLKQQLFGYTILGFALTEAVALFA 66 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 67 LMMAFLILFT 76 >gi|4877681|gb|AAD31410.1|AF119064_1 ATPase subunit 9 [Kazachstania exigua] Length = 63 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 33/62 (53%) Query: 29 MACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 +A +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V +LL Sbjct: 1 IATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLL 60 Query: 89 FV 90 F Sbjct: 61 FA 62 >gi|258543514|ref|YP_003188947.1| ATP synthase F0 subunit chi [Acetobacter pasteurianus IFO 3283-01] gi|256634592|dbj|BAI00568.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-01] gi|256637648|dbj|BAI03617.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-03] gi|256640702|dbj|BAI06664.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-07] gi|256643757|dbj|BAI09712.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-22] gi|256646812|dbj|BAI12760.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-26] gi|256649865|dbj|BAI15806.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-32] gi|256652855|dbj|BAI18789.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655909|dbj|BAI21836.1| ATP synthase F0 C chain [Acetobacter pasteurianus IFO 3283-12] Length = 74 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+ + G+A + + V + + NIF+T +S RNP + ++ + E++ LF Sbjct: 5 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNPASRPHVFGLGMLGFALTEAIALFA 64 Query: 81 LLVVMLLLFV 90 LL+ L+LFV Sbjct: 65 LLIAFLILFV 74 >gi|262276823|ref|ZP_06054616.1| conserved domain protein [alpha proteobacterium HIMB114] gi|262223926|gb|EEY74385.1| conserved domain protein [alpha proteobacterium HIMB114] Length = 75 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 26/70 (37%), Positives = 40/70 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A + + + + IF YLS A RNP AA +L+ +AE+ GLF Sbjct: 5 AAKLIGAGLAAIALAGAGVGIGTIFGNYLSAAIRNPSAAQKQFPNLLLGFALAEATGLFG 64 Query: 81 LLVVMLLLFV 90 L+V +++LF Sbjct: 65 LVVALIILFA 74 >gi|209966766|ref|YP_002299681.1| ATP synthase F0, C subunit [Rhodospirillum centenum SW] gi|209960232|gb|ACJ00869.1| ATP synthase F0, C subunit [Rhodospirillum centenum SW] Length = 74 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+Y+ G+A + V + ++NIF+ ++ RNP A + ++ + E++ LF Sbjct: 5 AARYIGAGLAMFALAGVGIGIANIFSNLIASVARNPAARNQVFPIGILGFALTEAVALFA 64 Query: 81 LLVVMLLLFV 90 LL+ L+LF Sbjct: 65 LLIAFLILFA 74 >gi|56567124|gb|AAV98567.1| mitochondrial F0 complex H+-transporting ATP synthase subunit c isoform 1 [Macaca mulatta] Length = 68 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 35/68 (51%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G A +G+ + +F + + G RNP + ++ ++E++GLF L+V Sbjct: 1 FIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMV 60 Query: 84 VMLLLFVI 91 L+LF + Sbjct: 61 AFLILFAM 68 >gi|292559469|ref|YP_003540837.1| ATP synthase F0 subunit c [Hartmannella vermiformis] gi|290775722|gb|ADD62221.1| ATP synthase F0 subunit c [Hartmannella vermiformis] Length = 82 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 15/69 (21%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK++ G+A +G+ + + +F+ Y++ A RN + ++ + E++GL Sbjct: 13 SAKFIGAGLATIGVAGAGMGIGVVFSGYMNAAARNEMIRAELFRYAILGFALTEAMGLLA 72 Query: 81 LLVVMLLLF 89 +++ L+L+ Sbjct: 73 IMIAFLILY 81 >gi|163794976|ref|ZP_02188945.1| ATP synthase C chain [alpha proteobacterium BAL199] gi|159179795|gb|EDP64322.1| ATP synthase C chain [alpha proteobacterium BAL199] Length = 74 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A + + V + + NIF+T +S RNP A + ++ + E++ LF Sbjct: 5 SAKMIGAGIAVIALMGVGVGIGNIFSTLISSIARNPAARNEVFGIGILGFALTEAVALFA 64 Query: 81 LLVVMLLLFV 90 LL+ L+LF Sbjct: 65 LLIAFLILFT 74 >gi|71031458|ref|XP_765371.1| ATP synthase F0 subunit C [Theileria parva strain Muguga] gi|68352327|gb|EAN33088.1| ATP synthase F0, subunit C, putative [Theileria parva] Length = 163 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 31/65 (47%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +A + +G VA + N+F +SG RNP T LI E L + +L+ Sbjct: 98 LGAAVALMSVGGVAQGIGNLFAALVSGTARNPSIKEDLFTYTLIGMGFLEFLAIVCILMG 157 Query: 85 MLLLF 89 ++L+ Sbjct: 158 AIMLY 162 >gi|237836015|ref|XP_002367305.1| ATP synthase lipid-binding protein, putative [Toxoplasma gondii ME49] gi|211964969|gb|EEB00165.1| ATP synthase lipid-binding protein, putative [Toxoplasma gondii ME49] gi|221484929|gb|EEE23219.1| conserved hypothetical protein [Toxoplasma gondii GT1] gi|221506014|gb|EEE31649.1| conserved hypothetical protein [Toxoplasma gondii VEG] Length = 166 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + ++F +SG RNP T LI E LG+ +L+ Sbjct: 101 LSAAIALMSVGGVAQGIGSLFAALVSGTARNPSIKEDLFTYTLIGMGFLEFLGIICVLMS 160 Query: 85 MLLLF 89 +LL+ Sbjct: 161 AVLLY 165 >gi|24080112|ref|NP_705911.1| ATP synthase F0 subunit 9 [Cryptococcus neoformans var. grubii] gi|23630291|gb|AAN37581.1| ATP synthase subunit 9 [Cryptococcus neoformans var. grubii] gi|48526541|gb|AAT45469.1| ATP synthase subunit 9 [Cryptococcus neoformans var. neoformans] gi|48526545|gb|AAT45472.1| ATP synthase subunit 9 [Cryptococcus neoformans var. grubii] Length = 72 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 40/69 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A +G+ + + +IF++ ++ RNP T ++ +AE+ GLF Sbjct: 3 AAKFIGAGLAAIGLSGAGVGIGSIFSSLIASVARNPALRGQLFTYAILGFALAEATGLFA 62 Query: 81 LLVVMLLLF 89 L++ L+L+ Sbjct: 63 LMISFLVLY 71 >gi|326910770|gb|AEA11203.1| ATP synthase subunit 9 [Selaginella moellendorffii] Length = 69 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 18/68 (26%), Positives = 36/68 (52%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K + G+A + + A+ + N+F++ + RNP A ++ + E++ LF L+ Sbjct: 1 KLIGAGVATIALAGAAVGIGNVFSSLIHSVGRNPSLAKQLFGYAILGFALTEAIALFALM 60 Query: 83 VVMLLLFV 90 + L+LFV Sbjct: 61 MAFLILFV 68 >gi|543870|sp|Q01554|ATP9_TRIRU RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|13869|emb|CAA46326.1| ATPase 9 [Trichophyton rubrum] Length = 74 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + G RNP + ++ +E+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGLLFSYAILGFAFSEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|4588711|gb|AAD26188.1|AF114946_1 ATP synthase subunit 9 [Naumovia castellii] Length = 66 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 32/63 (50%) Query: 27 VGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 G++ G+ + ++ +F ++G RNP ++ ++E+ GLF L++ + Sbjct: 1 AGISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLFCLMISFM 60 Query: 87 LLF 89 L+F Sbjct: 61 LMF 63 >gi|4588713|gb|AAD26189.1|AF114947_1 ATP synthase subunit 9 [Naumovia castellii] gi|4588715|gb|AAD26190.1|AF114948_1 ATP synthase subunit 9 [Naumovia castellii] Length = 65 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G++ G+ + ++ +F ++G RNP ++ ++E+ GLF L++ +L Sbjct: 1 GISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLFCLMISFML 60 Query: 88 LF 89 +F Sbjct: 61 MF 62 >gi|294889189|ref|XP_002772709.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] gi|239877215|gb|EER04525.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] Length = 186 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 29/65 (44%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +A + +G A + +F + G RNP T LI E L + ++L+ Sbjct: 120 LGAAIAVVAVGGCAQGIGQLFAALVVGIARNPSMKEDLFTYTLIGMGFLEFLAILVILIA 179 Query: 85 MLLLF 89 +LL+ Sbjct: 180 GVLLY 184 >gi|4877669|gb|AAD31404.1|AF119058_1 ATPase subunit 9 [Kazachstania exigua] gi|4877673|gb|AAD31406.1|AF119060_1 ATPase subunit 9 [Kazachstania exigua] Length = 62 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 32/61 (52%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 A +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V +LLF Sbjct: 1 ATIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLF 60 Query: 90 V 90 Sbjct: 61 A 61 >gi|149201374|ref|ZP_01878349.1| F0F1 ATP synthase subunit C [Roseovarius sp. TM1035] gi|149145707|gb|EDM33733.1| F0F1 ATP synthase subunit C [Roseovarius sp. TM1035] Length = 78 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 43/70 (61%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+AC+GMG A+ V N+ +L+GA RNP AA+ + I AE+LG+F Sbjct: 9 GAYIGAGLACMGMGGAAMGVGNVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|58039572|ref|YP_191536.1| ATP synthase C chain [Gluconobacter oxydans 621H] gi|81352056|sp|Q5FRW6|ATPL_GLUOX RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|58001986|gb|AAW60880.1| ATP synthase C chain [Gluconobacter oxydans 621H] Length = 85 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 22/85 (25%), Positives = 40/85 (47%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 M+ + AA+ + G+A + V + + NIF+T +S RNP + Sbjct: 1 MDVQAAHEFGISIAQAARDLGAGIAVFALAGVGMGLGNIFSTLISSVARNPASRPHVFGI 60 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFV 90 ++ + E++ LF LL+ L+LF Sbjct: 61 GMLGFALTEAVALFALLIAFLILFA 85 >gi|49147211|ref|YP_025804.1| ATP synthase F0 subunit 9 [Pseudendoclonium akinetum] gi|33439226|gb|AAQ18763.1| ATP synthase F0 subunit 9 [Pseudendoclonium akinetum] Length = 74 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G A + + + +F + +S RNP + ++ + E++ LF Sbjct: 4 SAKVIGAGAATIALAGCGTGIGIVFGSLISAVARNPSLTKQLFSYSILGFALTEAIALFT 63 Query: 81 LLVVMLLLFVI 91 L+VV L+LF + Sbjct: 64 LMVVFLILFAL 74 >gi|70953665|ref|XP_745919.1| hypothetical protein [Plasmodium chabaudi chabaudi] gi|56526389|emb|CAH77968.1| hypothetical protein PC104318.00.0 [Plasmodium chabaudi chabaudi] Length = 181 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 33/65 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + ++F+ + G RNP T LI E L LF ++ + Sbjct: 105 LSAAIALMSVGGVAQGIGSLFSALVLGTSRNPSIKDELFTYTLIGMGFLEFLVLFNIIYI 164 Query: 85 MLLLF 89 ++ +F Sbjct: 165 LIDIF 169 >gi|261187226|ref|XP_002620063.1| ATP synthase subunit C [Ajellomyces dermatitidis SLH14081] gi|239586531|gb|EEQ69174.1| ATP synthase subunit C [Ajellomyces dermatitidis SLH14081] Length = 74 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + G RNP ++ AE+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLKGQLFAYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|17232865|gb|AAD31403.2|AF119057_1 ATPase subunit 9 [Kazachstania exigua] gi|17232867|gb|AAD31407.2|AF119061_1 ATPase subunit 9 [Kazachstania exigua] gi|17232869|gb|AAD31405.2|AF119059_1 ATPase subunit 9 [Kazachstania exigua] gi|17232871|gb|AAD31408.2|AF119062_1 ATPase subunit 9 [Kazachstania exigua] Length = 61 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 31/60 (51%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ + ++ IF ++G RNP + ++ ++E+ GLF L+V +LLF Sbjct: 1 TIGLLGAGIGIAIIFAALINGVSRNPSLKDQLFSYTILGMALSEATGLFCLMVSFMLLFA 60 >gi|77020005|ref|YP_337886.1| ATP synthase subunit 9 [Aspergillus niger] gi|81230400|ref|YP_398777.1| ATP synthase subunit 9 [Aspergillus tubingensis] gi|75486578|gb|ABA19207.1| ATP synthase subunit 9 [Aspergillus niger] gi|75486806|gb|ABA19208.1| ATP synthase subunit 9 [Aspergillus tubingensis] gi|75993225|gb|ABA33730.1| ATP synthase subunit 9 [Aspergillus niger] gi|77157988|gb|ABA62016.1| ATP synthase subunit 9 [Aspergillus tubingensis] Length = 74 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + GMA G+ + + +F + G RNP + ++ AE+ GLF Sbjct: 4 AAKILGTGMATTGLIGAGVGIGIVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|228015427|ref|YP_002836213.1| ATP synthase subunit 9 [Nakaseomyces bacillisporus] gi|227806687|emb|CAX36943.1| ATP synthase subunit 9 [Nakaseomyces bacillisporus] Length = 75 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAKY+ G+A +G+ + ++ +F ++G RNP ++ I E+ GLF Sbjct: 5 MAAKYIGAGIAPIGLIGAGIGIAIVFAALINGVSRNPSLKDQLFNYTILGMAITEATGLF 64 Query: 80 LLLVVMLLLFV 90 L++ +LL+ Sbjct: 65 ALMISFILLYA 75 >gi|162146974|ref|YP_001601435.1| ATP synthase [Gluconacetobacter diazotrophicus PAl 5] gi|209544038|ref|YP_002276267.1| H+transporting two-sector ATPase subunit C [Gluconacetobacter diazotrophicus PAl 5] gi|224487650|sp|A9HDM8|ATPL_GLUDA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|161785551|emb|CAP55122.1| putative ATP synthase [Gluconacetobacter diazotrophicus PAl 5] gi|209531715|gb|ACI51652.1| H+transporting two-sector ATPase C subunit [Gluconacetobacter diazotrophicus PAl 5] Length = 74 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+ + G+A + + V + + NIF+T +S RNP A ++ + E++ L+ Sbjct: 5 AAREIGAGIAVIALAGVGIGLGNIFSTLVSSIARNPAARPHVFGLGMLGFALTEAVALYA 64 Query: 81 LLVVMLLLFV 90 LL+ L+LFV Sbjct: 65 LLIAFLILFV 74 >gi|20198301|gb|AAM15515.1| hypothetical protein [Arabidopsis thaliana] Length = 255 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 7/38 (18%), Positives = 18/38 (47%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 + + N+F++ + RNP A ++ + E++ Sbjct: 33 IGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAI 70 >gi|30315628|ref|NP_847979.1| ATP synthase F0 subunit 9 [Harpochytrium sp. JEL94] gi|30230281|gb|AAO62891.1| ATP synthase F0 subunit 9 [Harpochytrium sp. JEL94] Length = 74 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + K + G A + +G A+ + IF + L G RNP ++ + E++GLF Sbjct: 3 MVGKLIGAGAASIALGGAAVGIGVIFGSLLVGISRNPSLRRELFQMAILGFALTEAMGLF 62 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 63 ALMMALILLYA 73 >gi|26557003|ref|NP_085561.2| ATPase subunit 9 [Arabidopsis thaliana] gi|42568983|ref|NP_178769.2| H+-transporting two-sector ATPase, C subunit family protein [Arabidopsis thaliana] gi|15215920|emb|CAA69793.3| ATPase subunit 9 [Arabidopsis thaliana] gi|330250969|gb|AEC06063.1| ATP synthase subunit 9 [Arabidopsis thaliana] Length = 85 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 15 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFA 74 Query: 81 LLVVMLLLFV 90 ++ L+LFV Sbjct: 75 PMMAFLILFV 84 >gi|15187310|ref|NP_150642.1| ATP synthase F0 subunit 9 [Spizellomyces punctatus] gi|15100095|gb|AAK84258.1|AF404304_1 ATP synthase F0 subunit 9 [Spizellomyces punctatus] Length = 74 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAK + G+A + + A+ V IF + G RNP ++ + E+LGLF Sbjct: 3 MAAKLIGAGLATIALAGAAVGVGLIFAALIQGTSRNPSLRKELFNTAILGFALTEALGLF 62 Query: 80 LLLVVMLLLFV 90 L++ ++ L+ Sbjct: 63 ALMMALIFLYA 73 >gi|328725271|ref|XP_003248408.1| PREDICTED: ATP synthase subunit 9, mitochondrial-like [Acyrthosiphon pisum] Length = 74 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+ + + +F + G RNP + ++ +E+ GLF Sbjct: 4 AAKIIGTGLTNPAPIWAGVGIGVVFGALILGVARNPSLKGQLFSYAILGFAFSEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|209877619|ref|XP_002140251.1| ATP synthase lipid-binding protein [Cryptosporidium muris RN66] gi|209555857|gb|EEA05902.1| ATP synthase lipid-binding protein, putative [Cryptosporidium muris RN66] Length = 165 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 G VA + +F+ + G RNP T L+ E G+ +L+ +LL+ Sbjct: 110 GGVAKGIGTLFSALVMGTARNPSIKDTIFTYTLMGMGFMELFGIICVLMSAVLLY 164 >gi|290967663|ref|YP_003495097.1| ATP synthase subunit 9 [Trametes cingulata] gi|289832507|gb|ADD21043.1| ATP synthase subunit 9 [Trametes cingulata] Length = 86 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + IF+ ++ RNP ++ +AE+ GLF Sbjct: 17 AAKYIGAGLACSGLIGAGAGIGLIFSALIASTARNPQIRGQLFGYAILGFALAEATGLFS 76 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 77 LMIAFLLLY 85 >gi|255588941|ref|XP_002534772.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] gi|223524593|gb|EEF27607.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] Length = 101 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|317905604|emb|CBX33218.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148041|emb|CBX33248.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 111 Score = 49.5 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 9 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 68 Query: 81 LLVVMLLLFV 90 L++ L+ FV Sbjct: 69 LMMAFLISFV 78 >gi|29126633|ref|NP_803495.1| ATP synthase F0 subunit 9 [Harpochytrium sp. JEL105] gi|29029489|gb|AAO64940.1| ATP synthase F0 subunit 9 [Harpochytrium sp. JEL105] Length = 74 Score = 49.5 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + K + G A + +G A+ + IF + L G RNP ++ + E++GLF Sbjct: 3 MVGKLIGAGAASIALGGAAVGIGVIFGSLLIGISRNPSLRRELFQMAILGFALTEAMGLF 62 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 63 ALMMALILLYA 73 >gi|15150714|ref|NP_150380.1| ATP synthase F0 subunit c [Pylaiella littoralis] gi|21449987|ref|NP_659249.1| ATP synthase F0 subunit c [Laminaria digitata] gi|84508552|ref|YP_448599.1| ATP synthase F0 subunit c [Fucus vesiculosus] gi|84508592|ref|YP_448638.1| ATP synthase F0 subunit c [Desmarestia viridis] gi|268053529|ref|YP_003288888.1| ATPase subunit 9 [Saccharina japonica] gi|268053568|ref|YP_003288926.1| ATPase subunit 9 [Saccharina religiosa] gi|268053607|ref|YP_003288964.1| ATPase subunit 9 [Saccharina ochotensis] gi|268053646|ref|YP_003289041.1| ATPase subunit 9 [Saccharina diabolica] gi|268053685|ref|YP_003289092.1| ATPase subunit 9 [Saccharina longipedalis] gi|268164034|ref|YP_003288799.1| ATPase subunit 9 [Saccharina angustata] gi|268164073|ref|YP_003288850.1| ATPase subunit 9 [Saccharina coriacea] gi|15147720|emb|CAC50821.1| ATPase subunit 9 [Pylaiella littoralis] gi|21425312|emb|CAC87945.1| ATPase subunit 9 [Laminaria digitata] gi|39653275|gb|AAR29294.1| ATPase subunit 9 [Fucus vesiculosus] gi|45925624|gb|AAS79025.1| ATPase subunit 9 [Desmarestia viridis] gi|262318149|dbj|BAI48474.1| ATPase subunit 9 [Saccharina japonica] gi|262318188|dbj|BAI48512.1| ATPase subunit 9 [Saccharina religiosa] gi|262318227|dbj|BAI48550.1| ATPase subunit 9 [Saccharina ochotensis] gi|262318266|dbj|BAI48588.1| ATPase subunit 9 [Saccharina diabolica] gi|262318305|dbj|BAI48626.1| ATPase subunit 9 [Saccharina longipedalis] gi|262318344|dbj|BAI48664.1| ATPase subunit 9 [Saccharina angustata] gi|262318383|dbj|BAI48702.1| ATPase subunit 9 [Saccharina coriacea] gi|319738218|emb|CBJ17994.1| ATPase subunit 9 [Ectocarpus siliculosus] Length = 75 Score = 49.5 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 5 AAKLLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKDELFRIAILGFALTEAIALFA 64 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 65 LMMAFLILFAL 75 >gi|226477200|emb|CAX78253.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477212|emb|CAX78259.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477214|emb|CAX78260.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477218|emb|CAX78262.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477220|emb|CAX78263.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477226|emb|CAX78266.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477230|emb|CAX78268.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477234|emb|CAX78270.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477238|emb|CAX78272.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477242|emb|CAX78274.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477244|emb|CAX78275.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] Length = 122 Score = 49.5 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 112 LMMAFLILYA 121 >gi|11466325|ref|NP_051153.1| ATP synthase F0 subunit 9 [Cafeteria roenbergensis] gi|6180107|gb|AAF05804.1|AF193903_27 ATP synthase F0 subunit 9 [Cafeteria roenbergensis] Length = 75 Score = 49.5 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G A +G+ + + ++F + G RNP L+ + E++ L Sbjct: 5 AAKLIGAGAATIGLSGAGVGIGSVFGALILGVARNPNEKDELFRYALLGFALVEAIALLA 64 Query: 81 LLVVMLLLFV 90 +++V+L+LF Sbjct: 65 MMIVLLILFT 74 >gi|226475138|emb|CAX71857.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] Length = 121 Score = 49.5 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 51 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 110 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 111 LMMAFLILYA 120 >gi|150406460|ref|YP_001315109.1| ATP synthase F0 subunit 9 [Chlorokybus atmophyticus] gi|126507697|gb|ABO15094.1| ATP synthase F0 subunit 9 [Chlorokybus atmophyticus] Length = 73 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + NP A ++ + E++ LF Sbjct: 3 GAKLIGAGCATIALAGAAIGIGNVFSSLIKSVADNPFQAKKLFGYAILGFALTEAIALFA 62 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 63 LMMAFLILFV 72 >gi|28916485|gb|AAO59411.1| ATP synthase lipid-binding protein-like protein [Schistosoma japonicum] Length = 122 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 112 LMMAFLILYA 121 >gi|228015415|ref|YP_002836202.1| ATP synthase subunit 9 [Candida castellii] gi|227806675|emb|CAX36932.1| ATP synthase subunit 9 [Candida castellii] Length = 75 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +AAKY+ G+A +G+ + ++ +F ++G RNP ++ I E+ GLF Sbjct: 5 MAAKYIGAGIAPIGLIGAGIGIAVVFAALINGVSRNPSLKDQLFNYAILGMAITEATGLF 64 Query: 80 LLLVVMLLLFV 90 L++ +LL+ Sbjct: 65 ALMISFILLYA 75 >gi|27376298|ref|NP_767827.1| F0F1 ATP synthase subunit C [Bradyrhizobium japonicum USDA 110] gi|27349438|dbj|BAC46452.1| FoF1 ATP synthase C chain [Bradyrhizobium japonicum USDA 110] Length = 76 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 31/72 (43%), Positives = 43/72 (59%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK + G+AC+GMG + V IF YL+ A RNP AA ++ + E+LG+ Sbjct: 3 PAAAKLIGAGIACIGMGGAGVGVGVIFGNYLAAAVRNPSAAQGQFGNLIFGFAVTEALGI 62 Query: 79 FLLLVVMLLLFV 90 F LL+ +LLLFV Sbjct: 63 FSLLIALLLLFV 74 >gi|4588707|gb|AAD26186.1|AF114944_1 ATP synthase subunit 9 [Naumovia castellii] gi|4588709|gb|AAD26187.1|AF114945_1 ATP synthase subunit 9 [Naumovia castellii] gi|4768631|gb|AAD29585.1|AF113207_1 ATPase subunit 9 [Naumovia castellii] gi|4877657|gb|AAD31398.1|AF119052_1 ATPase subunit 9 [Naumovia castellii] Length = 64 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 31/61 (50%) Query: 29 MACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 ++ G+ + ++ +F ++G RNP ++ ++E+ GLF L++ +L+ Sbjct: 1 ISATGLIGAGIGIAIVFAALINGVSRNPSLRDTLFPMAILGFALSEATGLFCLMISFMLM 60 Query: 89 F 89 F Sbjct: 61 F 61 >gi|336896|gb|AAA31736.1| ATPase subunit 9 [Emericella nidulans] Length = 74 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +A+ + G+A G+ + + +F + G RNP + ++ AE+ GLF Sbjct: 4 SARIIGTGLATTGLIGAGVGIGVVFGALILGVARNPALRGQLFSYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|189502948|gb|ACE06855.1| unknown [Schistosoma japonicum] gi|226475134|emb|CAX71855.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226475136|emb|CAX71856.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477204|emb|CAX78255.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477206|emb|CAX78256.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477208|emb|CAX78257.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477224|emb|CAX78265.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477232|emb|CAX78269.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477236|emb|CAX78271.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] Length = 122 Score = 49.5 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 112 LMMAFLILYA 121 >gi|254509491|ref|ZP_05121558.1| ATP synthase F0, C subunit [Rhodobacteraceae bacterium KLH11] gi|221533202|gb|EEE36190.1| ATP synthase F0, C subunit [Rhodobacteraceae bacterium KLH11] Length = 74 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +LSGA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLSGALRNPSAAASQTATLFIGIAFAEALGIFAFLVSLLLMFAV 74 >gi|149915443|ref|ZP_01903970.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. AzwK-3b] gi|149810732|gb|EDM70573.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. AzwK-3b] Length = 74 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +LSGA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLSGALRNPSAAAGQTATLFIGIAFAEALGIFSFLVALLLMFAV 74 >gi|309322049|ref|YP_003935036.1| ATP synthase F0 subunit c [Candida salmanticensis] gi|308746526|gb|ADO51060.1| ATP synthase F0 subunit c [Candida salmanticensis] Length = 76 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/72 (23%), Positives = 38/72 (52%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L KY+ G+A + + + ++ +F +SG RNP + T ++ + E++ LF Sbjct: 5 LLGKYLGAGLAAIALSGPGIGIAIVFAALISGIARNPSVRATLFTYAILGFALTEAIALF 64 Query: 80 LLLVVMLLLFVI 91 L++ +L++ + Sbjct: 65 ALMISFMLIYAV 76 >gi|225554153|gb|EEH02518.1| ATP synthase subunit 9 [Ajellomyces capsulatus G186AR] gi|240272791|gb|EER36342.1| ATP synthase subunit 9 [Ajellomyces capsulatus H143] gi|325087319|gb|EGC40629.1| ATP synthase subunit 9 [Ajellomyces capsulatus H88] Length = 74 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + RNP T ++ AE+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFAALIIAVSRNPSLKGQLFTYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|84500353|ref|ZP_00998602.1| ATP synthase F0, C subunit [Oceanicola batsensis HTCC2597] gi|84391306|gb|EAQ03638.1| ATP synthase F0, C subunit [Oceanicola batsensis HTCC2597] Length = 74 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 30/51 (58%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +LSGA RNP AA + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLSGALRNPSAAGGQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|226477202|emb|CAX78254.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477210|emb|CAX78258.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477228|emb|CAX78267.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477240|emb|CAX78273.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] gi|226477246|emb|CAX78276.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] Length = 122 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 112 LMMAFLILYA 121 >gi|3617809|emb|CAA08795.1| F0-F1 ATPase subunit 9 [Daucus carota] gi|15705135|gb|AAK00525.1| ATPase9 [Daucus carota] Length = 89 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+L V Sbjct: 64 LMMAFLILSV 73 >gi|156389322|ref|XP_001634940.1| predicted protein [Nematostella vectensis] gi|156222029|gb|EDO42877.1| predicted protein [Nematostella vectensis] Length = 135 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G + +F + + G RNP + ++ ++E++GLF Sbjct: 65 AAKFIGAGAATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 124 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 125 LMMAFLILFAL 135 >gi|91992506|gb|ABE72969.1| ATPase [Camellia sinensis] Length = 85 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 28/52 (53%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N+F++ + RNP A ++ + E++ LF L++ L+LFV Sbjct: 33 VGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFV 84 >gi|86137235|ref|ZP_01055813.1| ATP synthase subunit C [Roseobacter sp. MED193] gi|126738039|ref|ZP_01753760.1| F0F1 ATP synthase subunit C [Roseobacter sp. SK209-2-6] gi|85826559|gb|EAQ46756.1| ATP synthase subunit C [Roseobacter sp. MED193] gi|126720536|gb|EBA17241.1| F0F1 ATP synthase subunit C [Roseobacter sp. SK209-2-6] Length = 78 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA+ + I AE+LG+F Sbjct: 9 GQFIGAGLAAIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|402626|emb|CAA52407.1| ATP synthase subunit 9 [Hordeum vulgare subsp. vulgare] Length = 80 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|29126609|ref|NP_803512.1| ATP synthase F0 subunit 9 [Monoblepharella sp. JEL15] gi|29029507|gb|AAO64957.1| ATP synthase F0 subunit 9 [Monoblepharella sp. JEL15] Length = 74 Score = 49.1 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 37/69 (53%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K + G+A + +G A+ + IF+ ++G RNP ++ + E++GLF L Sbjct: 5 GKLIGAGIAAVALGGAAMGIGTIFSALIAGTSRNPSLRRELFQMAILGFALTEAMGLFAL 64 Query: 82 LVVMLLLFV 90 ++ +++L+ Sbjct: 65 MMALIILYA 73 >gi|226477216|emb|CAX78261.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] Length = 122 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 112 LMMAFLILYA 121 >gi|82539230|ref|XP_724019.1| ATPase subunit 9 [Plasmodium yoelii yoelii str. 17XNL] gi|23478520|gb|EAA15584.1| ATPase subunit 9, putative [Plasmodium yoelii yoelii] Length = 189 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ +A + +G VA + ++F+ + G RNP T LI E LG+ +L+ Sbjct: 100 LSAAIALMSVGGVAQGIGSLFSALVLGTSRNPSIKDELFTYTLIGMGFLEFLGIICVLMS 159 >gi|224162737|ref|XP_002338481.1| predicted protein [Populus trichocarpa] gi|222872404|gb|EEF09535.1| predicted protein [Populus trichocarpa] Length = 73 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 39/69 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + IF++ ++ RNP S + ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGIIFSSLIASTARNPQIKSQLFSYAILGFALAEATGLFS 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMIAFLLLY 72 >gi|114328532|ref|YP_745689.1| ATP synthase C chain [Granulibacter bethesdensis CGDNIH1] gi|122326514|sp|Q0BQY6|ATPL_GRABC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|114316706|gb|ABI62766.1| ATP synthase C chain [Granulibacter bethesdensis CGDNIH1] Length = 74 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G++ + + V L + NIF + ++ RNP + + ++ + E++ LF Sbjct: 5 AAKALGAGISVIALAGVGLGIGNIFASLIASVARNPSSRDQVFSIGILGFALTEAVALFA 64 Query: 81 LLVVMLLLFV 90 LL+ L+LF Sbjct: 65 LLIAFLILFA 74 >gi|209427654|ref|YP_002274328.1| ATP synthase F0 subunit 9 [Blastocladiella emersonii] gi|82492282|gb|ABB78021.1| ATP synthase F0 subunit 9 [Blastocladiella emersonii] Length = 74 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+ +G+ + V +F ++ RNP S + ++ + E+LGLF Sbjct: 4 SAKIIGAGLTTMGLAGAGVGVGIVFAALINSTSRNPSIKSDLFSYAILGFALTEALGLFS 63 Query: 81 LLVVMLLLFVI 91 L++ LLL+ + Sbjct: 64 LMMAFLLLYAV 74 >gi|226477222|emb|CAX78264.1| putative ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c isoform 2a precursor [Schistosoma japonicum] Length = 122 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G A +G + ++F + RNP T ++ ++E++GLF Sbjct: 52 AAKYIGAGAATVGAAGSGAGIGSVFGSLTIAYARNPGLKQQLFTYAILGFALSEAMGLFC 111 Query: 81 LLVVMLLLFV 90 L++ L+L+ Sbjct: 112 LMMTFLILYA 121 >gi|301763266|ref|XP_002917053.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] Length = 139 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + VG+A +G+ + + +F + G RNP +++ + ++ ++ S GL Sbjct: 71 AAKLIGVGVAMIGVAVSRARIGTVFGSLXIGYARNPLXSNS--SYAMLGFALSRSRGLLC 128 Query: 81 LLVVMLLLFVI 91 L+V +LF + Sbjct: 129 LMVAFPILFAM 139 >gi|254464174|ref|ZP_05077585.1| ATP synthase subunit C, putative [Rhodobacterales bacterium Y4I] gi|206685082|gb|EDZ45564.1| ATP synthase subunit C, putative [Rhodobacterales bacterium Y4I] Length = 78 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 26/70 (37%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 ++V G+A +G G A+ V ++ +L+GA RNP AA+ + I AE+LG+F Sbjct: 9 GQFVGAGLAAIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|327176876|gb|AEA29882.1| ATP synthase F0 subunit 9 [Selaginella moellendorffii] Length = 67 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 35/66 (53%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A + + A+ + N+F++ + RNP A ++ + E++ LF L++ Sbjct: 1 IGAGVATIALAGAAVGIGNVFSSLIHSVGRNPSLAKQLFGYAILGFALTEAIALFALMMA 60 Query: 85 MLLLFV 90 L+LFV Sbjct: 61 FLILFV 66 >gi|71893403|ref|YP_278849.1| F0F1 ATP synthase subunit C [Mycoplasma hyopneumoniae J] gi|123734353|sp|Q4AAW2|ATPL_MYCHJ RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|71851530|gb|AAZ44138.1| ATP synthase C chain [Mycoplasma hyopneumoniae J] gi|312601015|gb|ADQ90270.1| ATP synthase subunit c [Mycoplasma hyopneumoniae 168] Length = 101 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 22/88 (25%), Positives = 38/88 (43%) Query: 3 KQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH 62 + E + AA+ A Y+ G+A +G+ V RNP A Sbjct: 13 QNFQEVSQRTAADSSNLKAFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQV 72 Query: 63 KTEVLIFAVIAESLGLFLLLVVMLLLFV 90 ++I I+E+ ++ LLV ++L+FV Sbjct: 73 FRVLVIGTAISETSSIYALLVALILIFV 100 >gi|158263223|gb|ABW24368.1| ATP synthase F0 complex c subunit [Riftia pachyptila] Length = 67 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 34/66 (51%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G A +G+ + ++F + + G RNP + ++ ++E++GLF L++ Sbjct: 1 IGAGAATVGVAGSGAGIGSVFGSLVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMA 60 Query: 85 MLLLFV 90 L+LF Sbjct: 61 FLILFA 66 >gi|54020001|ref|YP_115565.1| F0F1 ATP synthase subunit C [Mycoplasma hyopneumoniae 232] gi|81378799|sp|Q602A0|ATPL_MYCH2 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|53987174|gb|AAV27375.1| ATP synthase C chain [Mycoplasma hyopneumoniae 232] Length = 101 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 22/88 (25%), Positives = 38/88 (43%) Query: 3 KQMMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAH 62 + E + AA+ A Y+ G+A +G+ V RNP A Sbjct: 13 QNFQEVSQKTAADSSNLKAFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQV 72 Query: 63 KTEVLIFAVIAESLGLFLLLVVMLLLFV 90 ++I I+E+ ++ LLV ++L+FV Sbjct: 73 FRVLVIGTAISETSSIYALLVALILIFV 100 >gi|294882865|ref|XP_002769859.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] gi|294940506|ref|XP_002782804.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] gi|239873672|gb|EER02577.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] gi|239894809|gb|EER14600.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] Length = 104 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 29/65 (44%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +A + +G A + +F + G RNP T LI E L + ++L+ Sbjct: 38 LGAAIAVVAVGGCAQGIGQLFAALVVGIARNPSMKEDLFTYTLIGMGFLEFLAILVILIA 97 Query: 85 MLLLF 89 +LL+ Sbjct: 98 GVLLY 102 >gi|72080390|ref|YP_287448.1| F0F1 ATP synthase subunit C [Mycoplasma hyopneumoniae 7448] gi|123734314|sp|Q4A8W4|ATPL_MYCH7 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|71913514|gb|AAZ53425.1| ATP synthase C chain [Mycoplasma hyopneumoniae 7448] Length = 101 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A Y+ G+A +G+ V RNP A ++I I+E+ ++ Sbjct: 31 AFAYLGAGLAMIGVIGVGAGQGYAAGKACDAIARNPEAQKQVFRVLVIGTAISETSSIYA 90 Query: 81 LLVVMLLLFV 90 LLV ++L+FV Sbjct: 91 LLVALILIFV 100 >gi|902019|gb|AAA70035.1| ATP synthase subunit 9 [Pythium oligandrum] gi|902021|gb|AAA70037.1| ATP synthase subunit 9 [Pythium oligandrum] Length = 75 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK++ G+A +G+ + + ++F++ + G RNP ++ + ES+ LF Sbjct: 5 SAKFIGAGLATIGLAGAGIGIGSVFSSLVLGISRNPSLQQDLTRTAILGFALTESIALFC 64 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 65 LMIAFLILFA 74 >gi|63025147|ref|YP_232812.1| ATP synthase F0 subunit 9 [Tethya actinia] gi|37961481|gb|AAP59071.1| ATP synthase F0 subunit A6L [Tethya actinia] Length = 78 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +K++ G AC+G + + +F + G RNP T ++ I+E++GLF Sbjct: 8 GSKFIGAGAACIGAAGSGVGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMITFLILF 76 >gi|289065039|ref|YP_003433850.1| ATP synthase F0 subunit 9 [Oryza rufipogon] gi|285026121|dbj|BAI67954.1| ATP synthase F0 subunit 9 [Oryza rufipogon] Length = 127 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|148358091|ref|YP_001249306.1| ATP synthase subunit 9 [Gibberella zeae] gi|86142490|gb|ABC86605.1| ATP synthase subunit 9 [Gibberella zeae] Length = 74 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K + G+A +G+ + + +F + G RNP + + ++ +E+ LF Sbjct: 4 ASKLIGAGLATIGLAGAGVGIGVVFGCLIIGVARNPSLKNQLFSYSILGFAFSEATALFA 63 Query: 81 LLVVMLLLFVI 91 L++ +LLL+V+ Sbjct: 64 LMMALLLLYVV 74 >gi|240266524|ref|YP_002970864.1| ATP synthase F0 subunit 9 [Arthroderma obtusum] gi|237781126|gb|ACR19617.1| ATP synthase F0 subunit 9 [Arthroderma obtusum] Length = 63 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 26/58 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK + G+A G+ + + +F + G RNP + ++ +E+ GL Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFSEATGL 61 >gi|74310543|ref|YP_313627.1| ATP synthase F0 subunit 9 [Epidermophyton floccosum] gi|240266456|ref|YP_002970808.1| ATP synthase F0 subunit 9 [Trichophyton mentagrophytes] gi|240266493|ref|YP_002970836.1| ATP synthase F0 subunit 9 [Arthroderma uncinatum] gi|240266705|ref|YP_002970780.1| ATP synthase F0 subunit 9 [Trichophyton rubrum] gi|240266728|ref|YP_002970892.1| ATP synthase F0 subunit 9 [Microsporum canis] gi|58429671|gb|AAW78233.1| ATP synthase F0 subunit 9 [Epidermophyton floccosum] gi|237781073|gb|ACR19567.1| ATP synthase F0 subunit 9 [Trichophyton rubrum] gi|237781086|gb|ACR19579.1| ATP synthase F0 subunit 9 [Trichophyton mentagrophytes] gi|237781109|gb|ACR19601.1| ATP synthase F0 subunit 9 [Arthroderma uncinatum] gi|237781144|gb|ACR19634.1| ATP synthase F0 subunit 9 [Arthroderma otae] Length = 63 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 26/58 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK + G+A G+ + + +F + G RNP + ++ +E+ GL Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFGALILGVARNPSLRGQLFSYAILGFAFSEATGL 61 >gi|110225679|ref|YP_665684.1| ATP synthase F0 subunit 9 [Mesostigma viride] gi|17222550|gb|AAL36723.1|AF353999_3 ATP synthase F0 subunit 9 [Mesostigma viride] Length = 73 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 38/70 (54%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ +S +NP A+ ++ + E++ LF Sbjct: 3 GAKLIGAGCATIALAGAAVGIGNVFSSLISAVAQNPFQANKLFGYAILGFALTEAIALFA 62 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 63 LMMAFLILFV 72 >gi|321401338|gb|ADW83093.1| ATP synthase F0 subunit c [Pavlova lutheri] Length = 75 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/72 (22%), Positives = 36/72 (50%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AK + G++ + + V + + +F + ++ RNP A ++ + E++ L Sbjct: 3 PQSAKLIGAGLSTIALAGVGVGIGTVFASLVTATARNPNLAKQLFAYAILGFALTEAIAL 62 Query: 79 FLLLVVMLLLFV 90 F L++ L+LF Sbjct: 63 FALMMGFLILFA 74 >gi|269958453|ref|YP_003328240.1| ATP synthase subunit C [Anaplasma centrale str. Israel] gi|269848282|gb|ACZ48926.1| ATP synthase subunit C [Anaplasma centrale str. Israel] Length = 74 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 33/57 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + ++VAVG++ LGM AL V+ +F+ L+G RNP K V A + E++G Sbjct: 3 SLRFVAVGLSVLGMVASALGVAAVFSAMLNGIARNPETEDKLKKYVYTGAALVEAMG 59 >gi|302875875|ref|YP_003844508.1| ATP synthase F0, C subunit [Clostridium cellulovorans 743B] gi|307689308|ref|ZP_07631754.1| ATP synthase F0, C subunit [Clostridium cellulovorans 743B] gi|302578732|gb|ADL52744.1| ATP synthase F0, C subunit [Clostridium cellulovorans 743B] Length = 78 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 39/76 (51%) Query: 15 NGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAE 74 N + K +A G+A LG+ + N+ + G R P A+S +++ V +E Sbjct: 2 NESFVNGMKVLAAGLAALGVVGAGIGCGNVAAKAVEGVSRQPEASSDITRTMILGIVFSE 61 Query: 75 SLGLFLLLVVMLLLFV 90 + ++ L++ +LL+FV Sbjct: 62 ATAIYALIIAILLIFV 77 >gi|58219943|gb|AAW67484.1| ATP synthase subunit 9 [Fusarium oxysporum] gi|60499203|gb|AAX21826.1| ATP synthase F0 subunit 9 [Fusarium oxysporum] Length = 74 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 38/71 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 ++K + G+A +G+ + + +F + G RNP + + ++ +E+ LF Sbjct: 4 SSKLIGAGLATIGLAGAGVGIGVVFGCLIIGVARNPSLKNQLFSYSILGFAFSEATALFA 63 Query: 81 LLVVMLLLFVI 91 L++ +LLL+V+ Sbjct: 64 LMMALLLLYVV 74 >gi|18640462|ref|NP_570151.1| ATP synthase protein 9 [Hypocrea jecorina] gi|18496643|gb|AAL74176.1|AF447590_13 ATP synthase protein 9 [Hypocrea jecorina] Length = 67 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 27/58 (46%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 A+K + G+A +G+ + + +F + G RNP + + ++ +E+ L Sbjct: 7 ASKIIGAGLATVGVLGAGVGIGVVFGALILGVARNPSLKNQLFSYSILGFAFSEATAL 64 >gi|89053259|ref|YP_508710.1| F0F1 ATP synthase subunit C [Jannaschia sp. CCS1] gi|123401377|sp|Q28UC7|ATPL_JANSC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|88862808|gb|ABD53685.1| ATP synthase F0 subcomplex C subunit [Jannaschia sp. CCS1] Length = 78 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 42/70 (60%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +++ G+A +G G A+ V ++ +L+GA RNP AA+ + I AE+LG+F Sbjct: 9 GQFIGAGLAAIGSGAAAIGVGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFAF 68 Query: 82 LVVMLLLFVI 91 LV +LL+F + Sbjct: 69 LVALLLMFAV 78 >gi|4877695|gb|AAD31417.1|AF119071_1 ATPase subunit 9 [Saccharomyces transvaalensis] Length = 65 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 34/63 (53%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G+A +G+ + ++ +F ++G RNP + T ++ ++E+ GLF L++ + Sbjct: 2 GIATIGLLGAGIGIAIVFAALITGVSRNPSMKNQLFTMAILGMALSEATGLFCLMISFSI 61 Query: 88 LFV 90 LF Sbjct: 62 LFA 64 >gi|4877693|gb|AAD31416.1|AF119070_1 ATPase subunit 9 [Saccharomyces transvaalensis] Length = 64 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 35/63 (55%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 G+A +G+ + ++ +F ++G RNP + T ++ ++E+ GLF L++ ++ Sbjct: 1 GIATIGLLGAGIGIAIVFAALITGVSRNPSMKNQLFTMAILGMALSEATGLFCLMISFMI 60 Query: 88 LFV 90 LF Sbjct: 61 LFA 63 >gi|166831554|gb|ABY89815.1| ATPase subunit 9 [Boehmeria nivea] gi|166831558|gb|ABY89817.1| ATPase subunit 9 [Boehmeria nivea] Length = 81 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIQSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|254461936|ref|ZP_05075352.1| ATP synthase F0, C subunit [Rhodobacterales bacterium HTCC2083] gi|260432716|ref|ZP_05786687.1| ATP synthase F0, C subunit [Silicibacter lacuscaerulensis ITI-1157] gi|206678525|gb|EDZ43012.1| ATP synthase F0, C subunit [Rhodobacteraceae bacterium HTCC2083] gi|260416544|gb|EEX09803.1| ATP synthase F0, C subunit [Silicibacter lacuscaerulensis ITI-1157] Length = 74 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVSLLLMFAV 74 >gi|297818680|ref|XP_002877223.1| ATPase subunit 9 [Arabidopsis lyrata subsp. lyrata] gi|297323061|gb|EFH53482.1| ATPase subunit 9 [Arabidopsis lyrata subsp. lyrata] Length = 79 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 9 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFA 68 Query: 81 LLVVMLLLFV 90 ++ L+LFV Sbjct: 69 PMMAFLILFV 78 >gi|12045266|ref|NP_073077.1| F0F1 ATP synthase subunit C [Mycoplasma genitalium G37] gi|255660083|ref|ZP_05405492.1| F0F1 ATP synthase subunit C [Mycoplasma genitalium G37] gi|1352047|sp|P47644|ATPL_MYCGE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|3844996|gb|AAC71632.1| ATP synthase F0, C subunit [Mycoplasma genitalium G37] gi|166079033|gb|ABY79651.1| ATP synthase F0, C subunit [synthetic Mycoplasma genitalium JCVI-1.0] Length = 102 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 30/69 (43%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 Y+ G+ + V + IF + RNP + I + ++ES ++ L Sbjct: 31 GAYIGAGVTMIAGSTVGIGQGYIFGKAVEAIARNPEVEKQVFKLIFIGSAVSESTAIYGL 90 Query: 82 LVVMLLLFV 90 L+ +L+FV Sbjct: 91 LISFILIFV 99 >gi|111283601|gb|ABH09172.1| ATP synthase subunit 9 [Silene uniflora] Length = 70 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGSAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLL 87 L++ L+ Sbjct: 64 LMMAFLI 70 >gi|254439212|ref|ZP_05052706.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 307] gi|254454270|ref|ZP_05067707.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 238] gi|198254658|gb|EDY78972.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 307] gi|198268676|gb|EDY92946.1| ATP synthase subunit C, putative [Octadecabacter antarcticus 238] Length = 74 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFSFLVALLLMFAV 74 >gi|110678645|ref|YP_681652.1| F0F1 ATP synthase subunit C [Roseobacter denitrificans OCh 114] gi|163733903|ref|ZP_02141345.1| F0F1 ATP synthase subunit C [Roseobacter litoralis Och 149] gi|123362143|sp|Q16AM7|ATPL_ROSDO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|109454761|gb|ABG30966.1| ATP synthase F0, C subunit-related protein [Roseobacter denitrificans OCh 114] gi|161393014|gb|EDQ17341.1| F0F1 ATP synthase subunit C [Roseobacter litoralis Och 149] Length = 74 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 22/51 (43%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ YL+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNYLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|22550334|ref|NP_689389.1| ATP synthase F0 subunit 9 [Chaetosphaeridium globosum] gi|22417000|gb|AAM96599.1|AF494279_4 ATP synthase F0 subunit 9 [Chaetosphaeridium globosum] Length = 84 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 14 GAKLIGAGAATIALAGAAIGIGNVFSSLIQAVARNPSLAKQLFGYAILGFALTEAIALFA 73 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 74 LMMGFLILFV 83 >gi|116203493|ref|XP_001227557.1| hypothetical protein CHGG_09630 [Chaetomium globosum CBS 148.51] gi|88175758|gb|EAQ83226.1| hypothetical protein CHGG_09630 [Chaetomium globosum CBS 148.51] Length = 141 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 22/51 (43%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI 72 +K + +G A +G+ + + +F L+G RNP + ++ Sbjct: 84 SKNLGMGAAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAF 134 >gi|161544981|ref|YP_154219.2| F0F1 ATP synthase subunit C [Anaplasma marginale str. St. Maries] gi|254995315|ref|ZP_05277505.1| F0F1 ATP synthase subunit C [Anaplasma marginale str. Mississippi] gi|255003497|ref|ZP_05278461.1| F0F1 ATP synthase subunit C [Anaplasma marginale str. Puerto Rico] gi|255004619|ref|ZP_05279420.1| F0F1 ATP synthase subunit C [Anaplasma marginale str. Virginia] Length = 74 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + ++VAVG++ LGM A V+ +F+ L+G RNP K V A + E++G Sbjct: 3 SLRFVAVGLSVLGMVASAFGVAAVFSAMLNGIARNPETEDKLKKYVYTGAALVEAMG 59 >gi|296081468|emb|CBI19991.3| unnamed protein product [Vitis vinifera] Length = 78 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 30/67 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G + A+++ N+F++ + RNP A ++ + E++ F Sbjct: 4 GAKSMGAGATTIASAGAAISIGNVFSSLIHFVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLL 87 ++ L+ Sbjct: 64 PMMAFLI 70 >gi|126732373|ref|ZP_01748173.1| F0F1 ATP synthase subunit C [Sagittula stellata E-37] gi|126707242|gb|EBA06308.1| F0F1 ATP synthase subunit C [Sagittula stellata E-37] Length = 73 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 26/71 (36%), Positives = 43/71 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +++ G+A +G G A+ V N+ +L+GA RNP AA++ + I AE+LG+F Sbjct: 3 GLQFIGAGLAAIGSGAAAIGVGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFA 62 Query: 81 LLVVMLLLFVI 91 LV +LL+F + Sbjct: 63 FLVSLLLMFAV 73 >gi|56698067|ref|YP_168438.1| F0F1 ATP synthase subunit C [Ruegeria pomeroyi DSS-3] gi|81349058|sp|Q5LNH0|ATPL_SILPO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|56679804|gb|AAV96470.1| ATP synthase F0, C subunit [Ruegeria pomeroyi DSS-3] Length = 74 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAGNFLAGALRNPSAAASQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|225554139|gb|EEH02505.1| ATPase subunit 9 [Ajellomyces capsulatus G186AR] Length = 74 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A G+ + + +F + +NP T ++ AE+ GLF Sbjct: 4 AAKIIGTGLATTGLIGAGVGIGVVFAALIIAVSKNPSLKGQLFTYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+ Sbjct: 64 LMMAFLLLYA 73 >gi|158251733|ref|YP_001504347.1| ATP synthase A chain subunit 9 [Pleurotus ostreatus] gi|122893334|gb|ABM67606.1| ATP synthase A chain subunit 9 [Pleurotus ostreatus] Length = 73 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + IF++ ++ RNP + ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGLIFSSLIASTARNPQIRGQLFSYAILGFALAEATGLFS 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMIAFLLLY 72 >gi|39933922|ref|NP_946198.1| F0F1 ATP synthase subunit C [Rhodopseudomonas palustris CGA009] gi|75674436|ref|YP_316857.1| F0F1 ATP synthase subunit C [Nitrobacter winogradskyi Nb-255] gi|85713867|ref|ZP_01044856.1| ATP synthase subunit C [Nitrobacter sp. Nb-311A] gi|86751670|ref|YP_488166.1| F0F1 ATP synthase subunit C [Rhodopseudomonas palustris HaA2] gi|90426286|ref|YP_534656.1| F0F1 ATP synthase subunit C [Rhodopseudomonas palustris BisB18] gi|91975309|ref|YP_567968.1| F0F1 ATP synthase subunit C [Rhodopseudomonas palustris BisB5] gi|115526766|ref|YP_783677.1| F0F1 ATP synthase subunit C [Rhodopseudomonas palustris BisA53] gi|192289341|ref|YP_001989946.1| F0F1 ATP synthase subunit C [Rhodopseudomonas palustris TIE-1] gi|316932389|ref|YP_004107371.1| H+transporting two-sector ATPase subunit C [Rhodopseudomonas palustris DX-1] gi|39647769|emb|CAE26289.1| probable ATP synthase subunit C TRANSMEMBRANE protein [Rhodopseudomonas palustris CGA009] gi|74419306|gb|ABA03505.1| ATP synthase F0 subcomplex C subunit [Nitrobacter winogradskyi Nb-255] gi|85698993|gb|EAQ36861.1| ATP synthase subunit C [Nitrobacter sp. Nb-311A] gi|86574698|gb|ABD09255.1| H+-transporting two-sector ATPase, C subunit [Rhodopseudomonas palustris HaA2] gi|90108300|gb|ABD90337.1| H+-transporting two-sector ATPase, C subunit [Rhodopseudomonas palustris BisB18] gi|91681765|gb|ABE38067.1| H+-transporting two-sector ATPase, C subunit [Rhodopseudomonas palustris BisB5] gi|115520713|gb|ABJ08697.1| H+-transporting two-sector ATPase, C subunit [Rhodopseudomonas palustris BisA53] gi|192283090|gb|ACE99470.1| H+transporting two-sector ATPase C subunit [Rhodopseudomonas palustris TIE-1] gi|315600103|gb|ADU42638.1| H+transporting two-sector ATPase C subunit [Rhodopseudomonas palustris DX-1] Length = 75 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 33/59 (55%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +AAKY+ G+AC+GMG V IF YL+ A RNP AA ++ + E+LG Sbjct: 3 PIAAKYIGAGIACIGMGGAGAGVGIIFGNYLAAAVRNPSAAQGQFGNLIFGFAVTEALG 61 >gi|325677881|ref|ZP_08157523.1| ATP synthase F0, C subunit [Ruminococcus albus 8] gi|324110435|gb|EGC04609.1| ATP synthase F0, C subunit [Ruminococcus albus 8] Length = 86 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/72 (20%), Positives = 28/72 (38%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + L V G+A + + + R P A + I +AES G Sbjct: 7 FVLGCSAVGAGLAMIAGIGPGIGEGYAVGKTIESIARQPEAQGDCTRTMFIGVAMAESTG 66 Query: 78 LFLLLVVMLLLF 89 ++ +V ++L+F Sbjct: 67 IYSFVVALILMF 78 >gi|92115899|ref|YP_575628.1| F0F1 ATP synthase subunit C [Nitrobacter hamburgensis X14] gi|91798793|gb|ABE61168.1| ATP synthase F0 subcomplex C subunit [Nitrobacter hamburgensis X14] Length = 75 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 33/59 (55%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 LAAKY+ G+AC+GMG V IF YL+ A RNP AA ++ + E+LG Sbjct: 3 PLAAKYIGAGIACIGMGGAGAGVGIIFGNYLAAAVRNPSAAQGQFGNLIFGFAVTEALG 61 >gi|321309643|ref|YP_004191972.1| ATP synthase F0 subunit C [Mycoplasma haemofelis str. Langford 1] gi|319801487|emb|CBY92133.1| ATP synthase F0, C subunit [Mycoplasma haemofelis str. Langford 1] Length = 93 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 34/70 (48%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 KY+ G++ + A+ I + RNP + + ++ A + ES+ ++ L Sbjct: 24 GKYIGAGVSLVAGLGAAIGQGYIGGKAVEALARNPEVEALIFRQYIVGAAVCESVAIYGL 83 Query: 82 LVVMLLLFVI 91 +V +LL+F + Sbjct: 84 IVALLLMFGV 93 >gi|224020985|ref|YP_002608218.1| ATPase subunit 9 [Carica papaya] Length = 85 Score = 46.8 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/49 (20%), Positives = 24/49 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 + + N+F++ + RNP A ++ + E++ LF ++ L+ Sbjct: 33 VGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMAFLI 81 >gi|296446971|ref|ZP_06888906.1| H+transporting two-sector ATPase C subunit [Methylosinus trichosporium OB3b] gi|296255538|gb|EFH02630.1| H+transporting two-sector ATPase C subunit [Methylosinus trichosporium OB3b] Length = 75 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 21/47 (44%), Positives = 30/47 (63%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 V IF +++GA RNP AA+ T +I A +AE LG+F L+ +LL Sbjct: 26 VGIIFGNFVNGALRNPSAAAGQFTNAIIGAALAEGLGIFAFLIAILL 72 >gi|88607588|ref|YP_505725.1| F0F1 ATP synthase subunit C [Anaplasma phagocytophilum HZ] gi|88598651|gb|ABD44121.1| ATP synthase F0, C chain [Anaplasma phagocytophilum HZ] Length = 74 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 33/57 (57%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + +++AVG++ LGM AL V+ +F+ L+G RNP K V A + E++G Sbjct: 3 SLRFLAVGLSVLGMVASALGVAAVFSAMLNGIARNPETEEKLKKYVYTGAALVEAMG 59 >gi|319412278|gb|ADV41815.1| ATP synthase F0 subunit c [Bigelowiella natans] Length = 76 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 33/69 (47%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 AK + G+A + + + + +F + G RNP ++ ++E++ LF L Sbjct: 7 AKLIGGGLATISIAGSGVGIGVVFGALILGMARNPSVKQQIFVYAILGFALSEAVALFGL 66 Query: 82 LVVMLLLFV 90 ++ L+LF Sbjct: 67 MMAFLILFA 75 >gi|316979791|gb|EFV62529.1| putative ATP synthase subunit C [Trichinella spiralis] Length = 139 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+Y+ G A GM + IF + + RNP + + ++ ++E++GLF Sbjct: 69 AARYIGAGAATAGMAGSGAGIGTIFGSLVIAYARNPALKNNLFSYAILGFALSEAIGLFA 128 Query: 81 LLVVMLLLFV 90 +L+ +LL+ Sbjct: 129 MLIAFMLLYA 138 >gi|167843289|gb|ACA03547.1| ATPase subunit 9 [Dictyostelium purpureum] Length = 88 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 30/68 (44%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K V G+A +G+ V +F ++ NP ++ + E++GL L Sbjct: 20 GKKVGAGLAAIGLAGAGTGVGIVFAAFILAVSMNPNVRGELFKLAMLGFALTEAVGLLAL 79 Query: 82 LVVMLLLF 89 ++ L+L+ Sbjct: 80 MMSFLILY 87 >gi|11467599|ref|NP_043745.1| H(+)-transporting ATPase, F0 subunit 9 [Allomyces macrogynus] gi|1236429|gb|AAC49246.1| H(+)-transporting ATPase, F0 subunit 9 [Allomyces macrogynus] Length = 74 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+ +G+ + V +F + + G RNP + ++ + E+LGLF Sbjct: 4 SAKIIGAGLTTMGLAGAGVGVGIVFASLIQGTSRNPAVKGDLFSYAILGFALTEALGLFS 63 Query: 81 LLVVMLLLFVI 91 L++ LLL+ + Sbjct: 64 LMMAFLLLYAV 74 >gi|9695379|ref|NP_037601.1| ATP synthase F0 subunit 9 [Phytophthora infestans] gi|145932339|ref|YP_001165387.1| ATP synthase F0 subunit 9 [Phytophthora sojae] gi|145932433|ref|YP_001165344.1| ATP synthase F0 subunit 9 [Phytophthora ramorum] gi|6692632|gb|AAF24775.1|U17009_7 ATP synthase F0 subunit 9 [Phytophthora infestans] gi|7545238|gb|AAA32024.2| ATP synthase subunit 9 [Phytophthora megasperma] gi|58012137|gb|AAW62545.1| ATP synthase F0 subunit 9 [Phytophthora infestans] gi|58201976|gb|AAW67031.1| ATP synthase F0 subunit 9 [Phytophthora infestans] gi|58202023|gb|AAW67077.1| ATP synthase F0 subunit 9 [Phytophthora infestans] gi|110169582|gb|ABG54048.1| ATP synthase F0 subunit 9 [Phytophthora sojae] gi|110169631|gb|ABG54096.1| ATP synthase F0 subunit 9 [Phytophthora ramorum] gi|188037995|gb|ACD46613.1| ATP synthase F0 subunit 9 [Phytophthora ramorum] Length = 75 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+K++ G+A LG+ + + N+F + + G RNP ++ + E++ LF Sbjct: 5 ASKFLGAGLATLGLIGAGIGIGNVFGSLIIGISRNPSLQQELMRTAILGFALTEAIALFC 64 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 65 LMMAFLILFA 74 >gi|188032257|emb|CAQ52960.1| Atp9 protein [Lolium perenne] Length = 75 Score = 46.4 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|124022189|ref|YP_001016496.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9303] gi|33635321|emb|CAE21646.1| ATP synthase C chain [Prochlorococcus marinus str. MIT 9313] gi|123962475|gb|ABM77231.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Prochlorococcus marinus str. MIT 9303] Length = 122 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Query: 3 KQMMEAATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASA 61 + ++ TF++ + AA VA G+A LG + + G R P A Sbjct: 29 RAVLAPHTFSSTMDSITTAASVVAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGK 88 Query: 62 HKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + +L+ ESL ++ L+V ++LLF Sbjct: 89 IRGTLLLSFAFMESLTIYGLVVALVLLFA 117 >gi|114763713|ref|ZP_01443107.1| ATP synthase subunit C [Pelagibaca bermudensis HTCC2601] gi|260429547|ref|ZP_05783524.1| conserved domain protein [Citreicella sp. SE45] gi|114543714|gb|EAU46727.1| ATP synthase subunit C [Roseovarius sp. HTCC2601] gi|260420170|gb|EEX13423.1| conserved domain protein [Citreicella sp. SE45] Length = 74 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 32/51 (62%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V N+ +L+GA RNP AA++ + I AE+LG+F LV +LL+F + Sbjct: 24 VGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALGIFSFLVALLLMFAV 74 >gi|159045569|ref|YP_001534363.1| F0F1 ATP synthase subunit C [Dinoroseobacter shibae DFL 12] gi|157913329|gb|ABV94762.1| ATP synthase F0 [Dinoroseobacter shibae DFL 12] Length = 74 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 20/51 (39%), Positives = 31/51 (60%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V ++ +L+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGHVAGNFLAGALRNPSAAAGQTATLFIGIAFAEALGIFAFLVALLLMFAV 74 >gi|254497054|ref|ZP_05109880.1| ATP synthase C subunit (H+ transporting ATP synthase) [Legionella drancourtii LLAP12] gi|254353725|gb|EET12434.1| ATP synthase C subunit (H+ transporting ATP synthase) [Legionella drancourtii LLAP12] Length = 89 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 19/73 (26%), Positives = 37/73 (50%) Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 ++SLA+ +A +G A+A+ + L R P A + + I + ESL Sbjct: 6 WFSLASTIIAALTIAIGTIGPAIAMGRAISQALDAIARQPEAEKSITRTLFIGLAMIESL 65 Query: 77 GLFLLLVVMLLLF 89 ++ L++V+++LF Sbjct: 66 AIYCLVIVLIILF 78 >gi|296230648|ref|XP_002760800.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 249 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 32/71 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G + +G+ +F + G R+ + L+ E+L LF Sbjct: 179 AAKFIGAGAGAVVVGVAGSGAGTVFERLIIGYARSTSLKRQLFSYTLLGFAFWEALELFC 238 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 239 LMVAFLILFTL 249 >gi|126734939|ref|ZP_01750685.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. CCS2] gi|126715494|gb|EBA12359.1| H+-transporting two-sector ATPase, C subunit [Roseobacter sp. CCS2] Length = 74 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 21/51 (41%), Positives = 30/51 (58%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 V + YL+GA RNP AA+ + I AE+LG+F LV +LL+F + Sbjct: 24 VGTVAGNYLAGALRNPSAAAGQTATLFIGLAFAEALGIFAFLVSLLLMFAV 74 >gi|1628567|gb|AAB69711.1| ATP synthase complex subunit 9 [Sorghum bicolor] Length = 79 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 20/74 (27%), Positives = 37/74 (50%) Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 Y AK + G A + + A+ + N+F++ + RNP A ++ + E++ Sbjct: 5 YMLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAI 64 Query: 77 GLFLLLVVMLLLFV 90 LF L++ L+LFV Sbjct: 65 ALFALMMAFLILFV 78 >gi|13159|emb|CAA33771.1| unnamed protein product [Oenothera sp.] Length = 78 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSMGSGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+LFV Sbjct: 64 PMMAFLILFV 73 >gi|17484127|gb|AAL40356.1|AF449504_1 ATPase subunit 9 [Saccharomyces transvaalensis] Length = 61 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 32/60 (53%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ + ++ +F ++G RNP + T ++ ++E+ GLF L++ ++LF Sbjct: 1 TIGLLGAGIGIAIVFAALITGVSRNPSMKNQLFTMAILGMALSEATGLFCLMISFMILFA 60 >gi|304320004|ref|YP_003853647.1| hypothetical protein PB2503_02137 [Parvularcula bermudensis HTCC2503] gi|303298907|gb|ADM08506.1| hypothetical protein PB2503_02137 [Parvularcula bermudensis HTCC2503] Length = 74 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 26/69 (37%), Positives = 41/69 (59%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G+A L + V L + +F ++ GAFRNP A + T+ I + E+ GLF Sbjct: 5 AAKFIGAGLAVLPLLGVGLGLGILFGNFMQGAFRNPSATAGLNTQFYIAFALTEATGLFA 64 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 65 LVIAFLILF 73 >gi|297493592|gb|ADI40518.1| mitochondrial H+-transporting ATP synthase F0 complex subunit C2 [Rousettus leschenaultii] Length = 79 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 22/49 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIF 69 AAK++ G A +G+ + +F + + G RNP + ++ Sbjct: 31 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILG 79 >gi|119500636|ref|XP_001267075.1| ATP synthase subunit ATP9, putative [Neosartorya fischeri NRRL 181] gi|119415240|gb|EAW25178.1| ATP synthase subunit ATP9, putative [Neosartorya fischeri NRRL 181] Length = 157 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L G RNP + ++ E++GLF L+V M+ +V Sbjct: 111 VFGALLLGVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 157 >gi|11467929|ref|NP_057990.1| ATPase subunit 9 [Scenedesmus obliquus] gi|8099194|gb|AAF72049.1|AF204057_4 ATP synthase F0 subunit 9 [Scenedesmus obliquus] gi|7711051|emb|CAB90375.1| ATPase subunit 9 [Scenedesmus obliquus] Length = 73 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 32/69 (46%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K + G A + + V + +F + A RNP A L+ + ES+ LF Sbjct: 4 ARKLIGAGSALIALAGVGAGIGIVFGALIQRARRNPQMAKRLMGYALLGFALCESVALFR 63 Query: 81 LLVVMLLLF 89 LLV L+LF Sbjct: 64 LLVTFLILF 72 >gi|297671959|ref|XP_002814088.1| PREDICTED: hypothetical protein LOC100431232 [Pongo abelii] Length = 144 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 +F + + G RN ++ + E +GLF L++ L+LF + Sbjct: 98 VFGSLIIGYARNTSLKQQLF-YPILGFALWEVMGLFCLMIASLILFAM 144 >gi|8954388|ref|NP_059377.1| ATP synthase F0 subunit 9 [Cyanidioschyzon merolae] gi|4115801|dbj|BAA36539.1| ATP synthase protein 9 [Cyanidioschyzon merolae strain 10D] Length = 76 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ V V +F ++ RNP ++ + E++GLF Sbjct: 7 SAKIIGAGLATIGLAGVGAGVGIVFAALVNAYARNPSLKQQLFGYTILGFALTEAVGLFA 66 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 67 LMMAFLILFT 76 >gi|323136715|ref|ZP_08071796.1| H+transporting two-sector ATPase C subunit [Methylocystis sp. ATCC 49242] gi|322398032|gb|EFY00553.1| H+transporting two-sector ATPase C subunit [Methylocystis sp. ATCC 49242] Length = 74 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 30/47 (63%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 V IF +++GA RNP AA+ T +I A +AE LG+F ++ +LL Sbjct: 24 VGLIFGNFVNGALRNPSAAAGQFTNAIIGAALAEGLGIFAFVIALLL 70 >gi|83319513|ref|YP_424074.1| ATP synthase F0, subunit c [Mycoplasma capricolum subsp. capricolum ATCC 27343] gi|123726534|sp|Q2ST39|ATPL_MYCCT RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|83283399|gb|ABC01331.1| ATP synthase F0, subunit c [Mycoplasma capricolum subsp. capricolum ATCC 27343] Length = 101 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 37/69 (53%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+ G+A +G+ + I RNP AS + +++ A I+ES ++ L+ Sbjct: 33 KYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLV 92 Query: 83 VVMLLLFVI 91 + +LL+FV+ Sbjct: 93 IAILLIFVV 101 >gi|179234|gb|AAA51804.1| ATPase subunit 9 [Homo sapiens] Length = 58 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 28/55 (50%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + +F + + G RNP + ++ ++E++GLF L+V L+LF + Sbjct: 4 SGAGIGTVFGSLIIGYARNPSLKQQLFSYAIVGFALSEAMGLFCLMVAFLILFAM 58 >gi|27544886|ref|NP_775399.1| ATP synthase F0 subunit 9 [Lecanicillium muscarium] gi|187373188|ref|YP_001876499.1| ATP synthase F0 subunit 9 [Beauveria bassiana] gi|197935753|ref|YP_002213596.1| ATP synthase F0 subunit 9 [Cordyceps brongniartii] gi|27450718|gb|AAO14660.1|AF487277_4 ATP synthase F0 subunit 9 [Lecanicillium muscarium] gi|156122210|gb|ABU50169.1| ATP synthase F0 subunit 9 [Cordyceps brongniartii] gi|164598932|gb|ABY61750.1| ATP synthase F0 subunit 9 [Beauveria bassiana] Length = 74 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 26/56 (46%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 ++K + G+A +G+ + + +F + G RNP + + ++ +E+ Sbjct: 4 SSKIIGAGLATVGLAGAGVGIGVVFGCLILGVARNPSLKNQLFSYSILGFAFSEAT 59 >gi|70994086|ref|XP_751890.1| ATP synthase subunit ATP9 [Aspergillus fumigatus Af293] gi|66849524|gb|EAL89852.1| ATP synthase subunit ATP9, putative [Aspergillus fumigatus Af293] gi|159125196|gb|EDP50313.1| ATP synthase subunit ATP9, putative [Aspergillus fumigatus A1163] Length = 157 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L G RNP + ++ E++GLF L+V M+ +V Sbjct: 111 VFGALLLGVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 157 >gi|299737836|ref|XP_002910005.1| ATP synthase F0 subunit 9 [Coprinopsis cinerea okayama7#130] gi|298402997|gb|EFI26511.1| ATP synthase F0 subunit 9 [Coprinopsis cinerea okayama7#130] Length = 73 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + +F + + RNP T ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGTVFGSLIIATARNPQLRGQLFTYAILGFALAEATGLFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMAFLLLY 72 >gi|15088709|ref|NP_150118.1| ATP synthase F0 subunit 9 [Schizophyllum commune] gi|15077916|gb|AAK83402.1|AF402141_6 ATP synthase F0 subunit 9 [Schizophyllum commune] Length = 73 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 38/69 (55%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+AC G+ + IF++ ++ RNP T ++ +AE+ GLF Sbjct: 4 AAKYIGAGLACSGLIGAGAGIGLIFSSLIASTARNPQLRGQLFTFAILGFALAEATGLFS 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMIAFLLLY 72 >gi|121707414|ref|XP_001271825.1| ATP synthase subunit ATP9, putative [Aspergillus clavatus NRRL 1] gi|119399973|gb|EAW10399.1| ATP synthase subunit ATP9, putative [Aspergillus clavatus NRRL 1] Length = 157 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L G RNP + ++ E++GLF L+V M+ +V Sbjct: 111 VFGALLLGVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 157 >gi|42561408|ref|NP_975859.1| ATP synthase C chain [Mycoplasma mycoides subsp. mycoides SC str. PG1] gi|81697959|sp|Q6MS89|ATPL_MYCMS RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|42492906|emb|CAE77501.1| ATP SYNTHASE C CHAIN [Mycoplasma mycoides subsp. mycoides SC str. PG1] gi|301320903|gb|ADK69546.1| ATP synthase F0, C subunit [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale] Length = 101 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 37/69 (53%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+ G+A +G+ + I RNP AS + +++ A I+ES ++ L+ Sbjct: 33 KYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLV 92 Query: 83 VVMLLLFVI 91 + +LL+FV+ Sbjct: 93 IAILLIFVV 101 >gi|238491290|ref|XP_002376882.1| ATP synthase subunit ATP9, putative [Aspergillus flavus NRRL3357] gi|220697295|gb|EED53636.1| ATP synthase subunit ATP9, putative [Aspergillus flavus NRRL3357] Length = 156 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L G RNP + ++ E++GLF L+V M+ +V Sbjct: 110 VFGALLLGVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 156 >gi|317055020|ref|YP_004103487.1| ATP synthase F0 subunit C [Ruminococcus albus 7] gi|315447289|gb|ADU20853.1| ATP synthase F0, C subunit [Ruminococcus albus 7] Length = 86 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/72 (19%), Positives = 28/72 (38%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + L + G+A + + + R P A + I +AES G Sbjct: 7 FVLGCSALGAGLAMIAGIGPGIGEGYAVGKTIESIARQPEAQGDCTRTMFIGVAMAESTG 66 Query: 78 LFLLLVVMLLLF 89 ++ +V ++L+F Sbjct: 67 IYAFVVALILMF 78 >gi|156122189|gb|ABU50149.1| ATP synthase F0 subunit 9 [Cordyceps bassiana] Length = 74 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 26/56 (46%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 ++K + G+A +G+ + + +F + G RNP + + ++ +E+ Sbjct: 4 SSKIIGAGLATVGLAGAGVGIGVVFGCLILGVGRNPSLKNQLFSYSILGFAFSEAT 59 >gi|294155623|ref|YP_003560007.1| ATP synthase C chain, sodium ion specific (Lipid-bindingprotein) [Mycoplasma crocodyli MP145] gi|291599935|gb|ADE19431.1| ATP synthase C chain, sodium ion specific (Lipid-bindingprotein) [Mycoplasma crocodyli MP145] Length = 101 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 38/83 (45%) Query: 8 AATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A AA+ + +G+A +G+ + RNP A S ++ ++ Sbjct: 17 AEAQKAADKGLGFGLVGIGIGLAMVGVLGTGVGQGFAAGKAAEAVGRNPEAESKIRSMMI 76 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 I I+ES ++ L++ +LLLFV Sbjct: 77 IGMAISESSAIYALVISILLLFV 99 >gi|169773321|ref|XP_001821129.1| ATP synthase subunit 9 [Aspergillus oryzae RIB40] gi|83768990|dbj|BAE59127.1| unnamed protein product [Aspergillus oryzae] Length = 156 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L G RNP + ++ E++GLF L+V M+ +V Sbjct: 110 VFGALLLGVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 156 >gi|50812094|ref|YP_054496.1| ATPase complex subunit 9 [Kluyveromyces lactis] gi|49343296|gb|AAT64949.1| ATPase complex subunit 9 [Kluyveromyces lactis] Length = 54 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 25/50 (50%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIF 69 LAAKY+ G++ +G+ + ++ +F+ + G RNP ++ Sbjct: 5 LAAKYIGAGISTIGLLGAGIGIAIVFSALIQGVSRNPSLKDTLFPFAILG 54 >gi|314908378|gb|ADT62136.1| ATP synthase subunit 9 [Isoetes engelmannii] Length = 74 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + G RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIHGVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|2662061|dbj|BAA23683.1| proton-translocating ATPase, c subunit [Ruminococcus albus] Length = 87 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/72 (19%), Positives = 28/72 (38%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + L + G+A + + + R P A + I +AES G Sbjct: 7 FVLGCSALGAGLAMIAGIGPGIGEGYAVGKTIESIARQPEAQGDCTRTMFIGVAMAESTG 66 Query: 78 LFLLLVVMLLLF 89 ++ +V ++L+F Sbjct: 67 IYAFVVALILMF 78 >gi|103486566|ref|YP_616127.1| H+-transporting two-sector ATPase, C subunit [Sphingopyxis alaskensis RB2256] gi|98976643|gb|ABF52794.1| H+-transporting two-sector ATPase, C subunit [Sphingopyxis alaskensis RB2256] Length = 75 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 30/71 (42%), Positives = 43/71 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G G+ A+ V N+F ++L A RNP AA + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGAGMAAIGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFVI 91 +V M+LLFV+ Sbjct: 65 FVVAMILLFVV 75 >gi|164421009|ref|YP_001648504.1| ATP synthase F0 subunit 9 [Topsentia ophiraphidites] gi|158938939|gb|ABW83866.1| ATP synthase F0 subunit 9 [Topsentia ophiraphidites] Length = 78 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKYV G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 8 AAKYVGAGAASIGAAGSGAGIGTVFGNLIIGYSRNPSLKQQLFTYCILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMMAFLILF 76 >gi|331703822|ref|YP_004400509.1| ATP synthase C chain [Mycoplasma mycoides subsp. capri LC str. 95010] gi|328802377|emb|CBW54532.1| ATP synthase C chain [Mycoplasma mycoides subsp. capri LC str. 95010] Length = 101 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 36/69 (52%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+ G+A +G+ + I RNP A + +++ A I+ES ++ L+ Sbjct: 33 KYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMAPKVTSTMIVSAGISESGAIYSLV 92 Query: 83 VVMLLLFVI 91 + +LL+FV+ Sbjct: 93 IAILLIFVV 101 >gi|308072453|dbj|BAJ22088.1| ATPase subunit 9 [Cycas taitungensis] Length = 74 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|11497480|ref|NP_042270.1| H(+)-transporting ATPase, subunit 9 [Prototheca wickerhamii] gi|467871|gb|AAD12658.1| H(+)-transporting ATPase, subunit 9 [Prototheca wickerhamii] gi|253807625|gb|ACT36203.1| ATP synthase F0 subunit 9 [Helicosporidium sp. ex Simulium jonesi] Length = 74 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + + +F + ++ RNP ++ + E++ LF Sbjct: 4 GAKLIGAGCATIALAGAGAGIGIVFGSLINSVARNPSLTKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|2939|emb|CAA24039.1| unnamed protein product [Neurospora crassa] gi|289606481|emb|CBI61324.1| unnamed protein product [Sordaria macrospora] gi|223481|prf||0808299A ATPase subunit Length = 74 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 35/69 (50%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 AK + G+A G+ + + +F + + G RNP S ++ +E+ GLF L Sbjct: 5 AKIIGTGLATTGLIGAGIGIGVVFGSLIIGVSRNPSLKSQLFAYAILGFAFSEATGLFAL 64 Query: 82 LVVMLLLFV 90 ++ LLL+V Sbjct: 65 MMAFLLLYV 73 >gi|17484125|gb|AAL40355.1|AF449503_1 ATPase subunit 9 [Saccharomyces yakushimaensis] Length = 61 Score = 44.8 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 32/60 (53%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ + ++ +F ++G RNP + + ++ ++E+ GLF L++ ++LF Sbjct: 1 TIGLLGAGIGIAIVFAALITGVSRNPSMKAQLFSYAILGMALSEATGLFCLMISFMILFA 60 >gi|11467161|ref|NP_054462.1| ATP synthase F0 subunit 9 [Marchantia polymorpha] gi|416675|sp|P26855|ATP9_MARPO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|786245|gb|AAC09459.1| putative [Marchantia polymorpha] Length = 74 Score = 44.8 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ ++ RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLINSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|256384230|gb|ACU78800.1| ATP synthase c chain [Mycoplasma mycoides subsp. capri str. GM12] gi|256385062|gb|ACU79631.1| ATP synthase c chain [Mycoplasma mycoides subsp. capri str. GM12] gi|296455684|gb|ADH21919.1| ATP synthase c chain [synthetic Mycoplasma mycoides JCVI-syn1.0] Length = 101 Score = 44.8 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 37/69 (53%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+ G+A +G+ + I RNP AS + +++ A I+ES ++ L+ Sbjct: 33 KYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLV 92 Query: 83 VVMLLLFVI 91 + +LL+FV+ Sbjct: 93 IAILLIFVV 101 >gi|313665014|ref|YP_004046885.1| ATP synthase F0, C subunit [Mycoplasma leachii PG50] gi|312949413|gb|ADR24009.1| ATP synthase F0, C subunit [Mycoplasma leachii PG50] Length = 101 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 37/69 (53%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+ G+A +G+ + I RNP AS + +++ A I+ES ++ L+ Sbjct: 33 KYIGAGLASVGILGTGVGQGLIGQGACLAIGRNPEMASKVTSTMIVSAGISESGAIYSLV 92 Query: 83 VVMLLLFVI 91 + +LL+FV+ Sbjct: 93 IAILLIFVV 101 >gi|209916087|gb|ACI95882.1| ATP synthase subunit 9 [Isoetes engelmannii] gi|217331575|gb|ACK38301.1| ATP synthase subunit 9 [Isoetes engelmannii] gi|217331585|gb|ACK38311.1| ATP synthase subunit 9 [Isoetes engelmannii] gi|241912113|gb|ACS71776.1| ATP synthase F0 subunit 9 [Isoetes engelmannii] Length = 74 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + G RNP A ++ + E++ LF Sbjct: 4 GAKLIRAGAATIALAGAAVGIGNVFSSLIYGVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|114496|sp|P14571|ATP9_BETVU RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|12817|emb|CAA34604.1| unnamed protein product [Beta vulgaris subsp. vulgaris] Length = 88 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ ++E + LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALSELIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 64 LMMAFLILFA 73 >gi|197107678|gb|ACH42419.1| ATP synthase subunit 9 [Ralfsia fungiformis] Length = 56 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 V G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LVGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLRDDLFRIAILGFALTEAIALF 56 >gi|291010613|ref|YP_003495142.1| ATP synthase F0 subunit 9 [Pycnococcus provasolii] gi|258406736|gb|ACV72082.1| ATP synthase F0 subunit 9 [Pycnococcus provasolii] Length = 74 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + + +F + ++ RNP ++ + E++ LF Sbjct: 4 GAKLIGAGCATIALAGAGAGIGVVFGSLINSVARNPSLTKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|81176510|ref|YP_398394.1| atp9 [Triticum aestivum] gi|2118196|pir||S62132 H+-transporting two-sector ATPase (EC 3.6.3.14) protein 9 - barley mitochondrion gi|13687|emb|CAA33193.1| unnamed protein product [Triticum aestivum] gi|13721|emb|CAA34061.1| unnamed protein product [Triticum aestivum] gi|1405782|emb|CAA56642.1| ATP synthase subunit 9 [Triticum turgidum subsp. durum x Triticosecale sp.] gi|1430901|emb|CAA67493.1| atp9 [Secale cereale] gi|78675234|dbj|BAE47659.1| atp9 [Triticum aestivum] gi|169649047|gb|ACA62608.1| apt9 [Triticum aestivum] gi|291498597|gb|ADE08071.1| apt9-1 [Triticum aestivum] gi|291498598|gb|ADE08072.1| apt9-2 [Triticum aestivum] gi|228552|prf||1805412A ATP synthase:SUBUNIT=9 Length = 80 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|85374333|ref|YP_458395.1| hypothetical protein ELI_07530 [Erythrobacter litoralis HTCC2594] gi|84787416|gb|ABC63598.1| hypothetical protein ELI_07530 [Erythrobacter litoralis HTCC2594] Length = 75 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK V G+A +G G+ A+ V N+F ++L A RNP AA + + I AE LGL Sbjct: 5 AAKLVGAGLAAIGAGMAAIGVGNVFGSFLESALRNPGAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFV 90 +V M+L+FV Sbjct: 65 FVVAMILIFV 74 >gi|112253889|ref|YP_717144.1| ATPase subunit 9 [Brassica napus] gi|162279915|ref|NP_064001.2| ATPase subunit 9 [Beta vulgaris subsp. vulgaris] gi|224104477|ref|XP_002333936.1| predicted protein [Populus trichocarpa] gi|224107559|ref|XP_002333492.1| predicted protein [Populus trichocarpa] gi|323435154|ref|YP_004222372.1| ATPase subunit 9 [Beta vulgaris subsp. maritima] gi|1771353|emb|CAA90583.1| atp9 [Lolium perenne] gi|1771355|emb|CAA90584.1| atp9 [Lolium perenne] gi|37591091|dbj|BAC98893.1| ATPase subunit 9 [Brassica napus] gi|87248015|gb|ABD36060.1| ATPase subunit 9 [Beta vulgaris subsp. vulgaris] gi|110189751|gb|ABG49445.1| ATPase subunit 9 [Carthamus tinctorius] gi|110294539|gb|ABG66728.1| ATP synthase subunit 9 [Carthamus tinctorius] gi|148491417|dbj|BAA99313.2| ATPase subunit 9 [Beta vulgaris subsp. vulgaris] gi|222837061|gb|EEE75440.1| predicted protein [Populus trichocarpa] gi|222839247|gb|EEE77598.1| predicted protein [Populus trichocarpa] gi|296040797|gb|ADG85366.1| ATPase subunit 9 [Silene noctiflora] gi|317905605|emb|CBJ14011.1| ATPase subunit 9 [Beta vulgaris subsp. maritima] gi|319439887|emb|CBJ17587.1| ATPase subunit 9 [Beta vulgaris subsp. maritima] gi|320148042|emb|CBJ20705.1| ATPase subunit 9 [Beta vulgaris subsp. maritima] gi|328905408|gb|AEB54952.1| ATP synthase F0 subunit 9 [Funaria hygrometrica] Length = 74 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|164421135|ref|YP_001648580.1| ATP synthase F0 subunit 9 [Ectyoplasia ferox] gi|164421180|ref|YP_001648566.1| ATP synthase F0 subunit 9 [Ptilocaulis walpersi] gi|158668126|gb|ABW76586.1| ATP synthase F0 subunit 9 [Ectyoplasia ferox] gi|158938962|gb|ABW83887.1| ATP synthase F0 subunit 9 [Ptilocaulis walpersi] Length = 78 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 24/69 (34%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKYV G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 8 AAKYVGAGAASIGAAGSGAGIGTVFGNLIIGYSRNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ LLLF Sbjct: 68 LMMAFLLLF 76 >gi|158344571|gb|ABW36056.1| mitochondrial ATP synthase subunit C [Caenorhabditis remanei] Length = 59 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 29/59 (49%) Query: 33 GMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 G+ + N+F + G RNP + ++ ++E++GLF L + ++LF + Sbjct: 1 GVAGSGAGIGNVFGALVIGYARNPSLKQQLFSYAILGFALSEAMGLFCLTMGFMILFAL 59 >gi|110225645|ref|YP_665651.1| ATP synthase F0 subunit 9 [Nephroselmis olivacea] gi|6066160|gb|AAF03178.1|AF110138_10 ATP synthase F0 subunit 9 [Nephroselmis olivacea] Length = 74 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + + +F + ++ RNP ++ + E++ LF Sbjct: 4 GAKLIGAGCATIALAGAGAGIGIVFGSLINSVARNPSLTKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|327195237|ref|YP_004339019.1| ATP synthase F0 subunit 9 [Coccomyxa sp. C-169] gi|325070733|gb|ADY75461.1| ATP synthase F0 subunit 9 [Coccomyxa sp. C-169] Length = 74 Score = 44.5 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + + +F + ++ RNP ++ + E++ LF Sbjct: 4 GAKLIGAGCATIALAGAGAGIGIVFGSLINSVARNPSLTKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|11465882|ref|NP_066431.1| ATP synthase F0 subunit 9 [Ochromonas danica] gi|10505215|gb|AAG18397.1|AF287134_22 ATP synthase F0 subunit 9 [Ochromonas danica] Length = 74 Score = 44.5 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 34/69 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+ + G++ G+ + + IF + + G RNP ++ + E++ LF Sbjct: 5 AAQKIGAGLSTFGLAGAGIGIGVIFGSLIIGTSRNPNLKDDLFRVAILGFALTEAIALFA 64 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 65 LMIGFLVLF 73 >gi|57639533|gb|AAW55634.1| ATPase subunit 9 [Brassica juncea] Length = 74 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|115397709|ref|XP_001214446.1| ATP synthase protein 9, mitochondrial precursor [Aspergillus terreus NIH2624] gi|114192637|gb|EAU34337.1| ATP synthase protein 9, mitochondrial precursor [Aspergillus terreus NIH2624] Length = 154 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 +F L G RNP + ++ E++GLF L+V M+ Sbjct: 109 VFGALLLGVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMM 151 >gi|56551564|ref|YP_162403.1| H+transporting two-sector ATPase subunit C [Zymomonas mobilis subsp. mobilis ZM4] gi|241761304|ref|ZP_04759392.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|260752836|ref|YP_003225729.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|56543138|gb|AAV89292.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis ZM4] gi|241374211|gb|EER63708.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|258552199|gb|ACV75145.1| H+transporting two-sector ATPase C subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 79 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 25/46 (54%) Query: 45 FTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 F +L A RNP AA + + I AE LGL ++ +LL+FV Sbjct: 33 FAGFLESALRNPAAADGQQGRLFIGFAAAELLGLLSFVISILLIFV 78 >gi|7524985|ref|NP_050083.1| ATPase subunit 9 [Dictyostelium discoideum] gi|87043015|ref|YP_492629.1| ATP synthase F0 subunit 9 [Dictyostelium citrinum] gi|5915722|sp|Q37315|ATP9_DICDI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|122074015|sp|Q2LCR3|ATP9_DICCI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|699595|dbj|BAA03937.1| ATPase subunit 9 [Dictyostelium discoideum] gi|4958888|dbj|BAA78065.1| ATPase subunit 9 [Dictyostelium discoideum] gi|84682115|gb|ABC60380.1| ATPase subunit 9 [Dictyostelium citrinum] Length = 88 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 31/68 (45%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K V G+A +G+ V +F ++ NP ++ ++E++GL L Sbjct: 20 GKKVGAGLAAIGLTGAGAGVGIVFAAFILAVGMNPNLRGELFKLAMLGFALSEAVGLLAL 79 Query: 82 LVVMLLLF 89 ++ L+L+ Sbjct: 80 MMSFLILY 87 >gi|41203476|ref|NP_957736.1| ATP synthase F0 subunit 9 [Emiliania huxleyi] gi|33114162|gb|AAP94718.1| ATP synthase F0 subunit 9 [Emiliania huxleyi] Length = 74 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 31/70 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+ + + V + +F+ + RNP ++ E++ LF Sbjct: 4 AAKLIGAGLCTIALAGVGGGIGTVFSALIISVARNPHLMKQLFAYAILGFAFTEAVALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LF Sbjct: 64 LMMAFLILFT 73 >gi|94502704|ref|YP_588368.1| ATPase subunit 9 [Zea mays subsp. mays] gi|194033243|ref|YP_002000580.1| ATP synthase F0 subunit 9 [Oryza sativa Japonica Group] gi|307101723|ref|YP_003875496.1| ATPase subunit 9 [Silene latifolia] gi|114506|sp|P13547|ATP9_WHEAT RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|60391806|sp|P00840|ATP9_MAIZE RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|148886788|sp|P0C518|ATP9_ORYSI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|148886789|sp|P0C519|ATP9_ORYSJ RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|2118195|pir||S59552 H+-transporting two-sector ATPase (EC 3.6.3.14) chain 9.2 - radish mitochondrion gi|7436169|pir||S70027 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - maize mitochondrion gi|14861558|gb|AAK73729.1|AF390542_1 ATP synthase subunit 9 [Zea mays] gi|13685|emb|CAA38441.1| ATPase subunit 9 [Triticum aestivum] gi|259021|gb|AAB23976.1| ATP synthase subunit 9 [Triticum aestivum] gi|387878|gb|AAA70317.1| ATP synthase subunit 9 [Glycine max] gi|23495404|dbj|BAC19885.1| ATP synthase F0 subunit 9 [Oryza sativa Japonica Group] gi|40795143|gb|AAR91187.1| ATPase subunit 9 [Zea mays] gi|270267977|gb|ACZ65568.1| ATP synthase subunit 9 [Zea mays] gi|270267979|gb|ACZ65569.1| ATP synthase subunit 9 [Zea mays] gi|270267981|gb|ACZ65570.1| ATP synthase subunit 9 [Zea mays] gi|270267983|gb|ACZ65571.1| ATP synthase subunit 9 [Zea mays] gi|296040795|gb|ADG85365.1| ATPase subunit 9 [Silene latifolia] gi|301338018|gb|ADK73310.1| ATPase subunit 9 [Silene latifolia] Length = 74 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|27753516|dbj|BAA02855.2| F0-ATPase subunit 9 [Brassica napus] Length = 74 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|166831556|gb|ABY89816.1| ATPase subunit 9 [Boehmeria nivea] Length = 74 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIQSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|164420990|ref|YP_001648611.1| ATP synthase F0 subunit 9 [Halisarca dujardini] gi|164421153|ref|YP_001648555.1| ATP synthase F0 subunit 9 [Chondrilla aff. nucula CHOND] gi|317134243|ref|YP_004123487.1| ATP synthase F0 subunit 9 [Halisarca sp. DVL-2010] gi|158668114|gb|ABW76575.1| ATP synthase F0 subunit 9 [Chondrilla aff. nucula CHOND] gi|158668144|gb|ABW76603.1| ATP synthase F0 subunit 9 [Halisarca dujardini] gi|315141534|gb|ADT81738.1| ATP synthase F0 subunit 9 [Halisarca sp. DVL-2010] Length = 78 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + +F + G RNP T ++ ++E++GLF Sbjct: 8 AAKFVGAGAATIGAAGSGAGIGTVFGNLIIGYSRNPSLKQQLFTYAILGFALSEAMGLFC 67 Query: 81 LLVVMLLLFV 90 L++ LLL+ Sbjct: 68 LMMAFLLLYA 77 >gi|60391805|sp|P69420|ATP9_PEA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|60391807|sp|P69421|ATP9_SOYBN RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|60391808|sp|P69422|ATP9_VICFA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|13379|emb|CAA68420.1| unnamed protein product [Pisum sativum] gi|13879|emb|CAA30224.1| unnamed protein product [Vicia faba] gi|286141|dbj|BAA03525.1| F1 ATPase subunit 9 [Pisum sativum] gi|450545|emb|CAA36290.1| ATPase proteolipid subunit [Glycine max] Length = 74 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|323649878|ref|YP_004237252.1| ATPase subunit 9 [Ricinus communis] gi|322394258|gb|ADW96015.1| ATPase subunit 9 [Ricinus communis] Length = 75 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|169335788|ref|ZP_02862981.1| hypothetical protein ANASTE_02213 [Anaerofustis stercorihominis DSM 17244] gi|169258526|gb|EDS72492.1| hypothetical protein ANASTE_02213 [Anaerofustis stercorihominis DSM 17244] Length = 84 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A +G + N R P A +L+ +AE+ ++ Sbjct: 10 LAFSALGAGLAMIGALGTGVGQGNATGKACESVARQPEAEGTILRTLLVGCAVAETSAIY 69 Query: 80 LLLVVMLLLFV 90 L++ ++LLFV Sbjct: 70 CLVIALILLFV 80 >gi|325973362|ref|YP_004250426.1| ATP synthase F0 C subunit [Mycoplasma suis str. Illinois] gi|325989797|ref|YP_004249496.1| ATP synthase subunit c [Mycoplasma suis KI3806] gi|323574882|emb|CBZ40542.1| ATP synthase subunit c [Mycoplasma suis] gi|323651964|gb|ADX98046.1| ATP synthase F0, C subunit [Mycoplasma suis str. Illinois] Length = 90 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 32/67 (47%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 KY+ G+A L A+A I + RNP + + ++ I ES+ ++ L+ Sbjct: 22 KYIGAGVAILAGLGAAVAQGYIGGKAVESLARNPEVEALIFKQYIVGVAICESVAIYGLI 81 Query: 83 VVMLLLF 89 V +L L+ Sbjct: 82 VSILCLY 88 >gi|240047760|ref|YP_002961148.1| F0F1 ATP synthase subunit C [Mycoplasma conjunctivae HRC/581] gi|239985332|emb|CAT05345.1| PUTATIVE ATP synthase C chain [Mycoplasma conjunctivae] Length = 98 Score = 44.5 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 37/83 (44%) Query: 8 AATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A A S+ A+ + G+A +G+ L + RNP A +L Sbjct: 16 AQNIAPTVATSSMGAEKIGAGLAMIGVIGAGLGQGIAGAKAVEAVGRNPEAQKEIFKTLL 75 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + IAE+ ++ L+V +LL+F+ Sbjct: 76 FSSAIAETSAIYALVVAILLIFI 98 >gi|134285794|emb|CAM82800.1| ATP synthase subunit 9 [Asplenium nidus] Length = 74 Score = 44.5 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ +S RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLISSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|38605626|sp|P60113|ATP9_BRANA RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|11251|emb|CAA49160.1| F0-F1 ATPase proteolipid [Raphanus sativus] gi|1507655|dbj|BAA11530.1| subunit 9 of mitochondrial F0-ATPase [Arabidopsis thaliana] gi|101919340|dbj|BAE94708.1| atp9-a [Diplotaxis muralis] Length = 74 Score = 44.5 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+LFV Sbjct: 64 PMMAFLILFV 73 >gi|110004061|emb|CAK98400.1| putative atp synthase c chain transmembrane protein [Spiroplasma citri] Length = 100 Score = 44.1 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 20/86 (23%), Positives = 36/86 (41%) Query: 5 MMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKT 64 MM A ++ + G+A +G + + RNP S +T Sbjct: 13 MMTIWFMAGITDGFTKGMSLLGAGLAAIGCCGSGIGQGYTGGKAVEAIARNPEVESKVRT 72 Query: 65 EVLIFAVIAESLGLFLLLVVMLLLFV 90 + +I A I ES ++ L++ ++L FV Sbjct: 73 QYIIAAAITESGSIYALVIAIILAFV 98 >gi|91208880|ref|YP_539041.1| ATP synthase F0 subunit 9 [Physcomitrella patens] gi|90991420|dbj|BAE93112.1| ATP synthase F0 subunit 9 [Physcomitrella patens] Length = 74 Score = 44.1 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIALAGAAIGIGNVFSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|117926949|ref|YP_867566.1| ATP synthase F0 subunit chi [Magnetococcus sp. MC-1] gi|117610705|gb|ABK46160.1| ATP synthase F0 subcomplex C subunit [Magnetococcus sp. MC-1] Length = 75 Score = 44.1 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 34/70 (48%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 S AA ++ +G+A GM + + +F + R P A + + I A E++ L Sbjct: 3 SAAAAFIGMGLAAAGMAGSGIGLGYLFGKTIESIARQPGAEAQMTKYMWIGAAFVEAVAL 62 Query: 79 FLLLVVMLLL 88 + L++ +++ Sbjct: 63 YGLVIAFIIM 72 >gi|94498733|ref|ZP_01305283.1| H+-transporting two-sector ATPase, C subunit [Sphingomonas sp. SKA58] gi|294012249|ref|YP_003545709.1| F0F1-type ATP synthase subunit c [Sphingobium japonicum UT26S] gi|307294415|ref|ZP_07574259.1| H+transporting two-sector ATPase C subunit [Sphingobium chlorophenolicum L-1] gi|94421832|gb|EAT06883.1| H+-transporting two-sector ATPase, C subunit [Sphingomonas sp. SKA58] gi|292675579|dbj|BAI97097.1| F0F1-type ATP synthase subunit c [Sphingobium japonicum UT26S] gi|306880566|gb|EFN11783.1| H+transporting two-sector ATPase C subunit [Sphingobium chlorophenolicum L-1] Length = 75 Score = 44.1 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 30/70 (42%), Positives = 44/70 (62%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G G+ AL V N+F+++L GA RNP AA + + I AE LGL Sbjct: 5 AAKLLGAGLAAIGAGIAALGVGNVFSSFLEGALRNPGAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFV 90 ++ M+L+FV Sbjct: 65 FVIAMILVFV 74 >gi|32398077|emb|CAD78172.1| ATP synthase c subunit [Rhodopirellula baltica SH 1] Length = 109 Score = 44.1 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G+ +G A A L+ + P +++ + + + ES ++ Sbjct: 31 ASIIMAGLTTAIGSIGPAFAEGRAVAQALNSIAQQPDSSNTITRTLFVGLAMIESTAIYC 90 Query: 81 LLVVMLLLFV 90 +V M+LLF Sbjct: 91 FVVSMILLFA 100 >gi|317134342|ref|YP_004123128.1| ATP synthase F0 subunit 9 [Oscarella microlobata] gi|308912657|gb|ADO51420.1| ATP synthase F0 subunit 9 [Oscarella microlobata] Length = 75 Score = 44.1 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 L+AK++ G A +G + +F + + G RNP T ++ ++E++GL Sbjct: 3 ELSAKFIGAGAATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYTILGFALSEAMGL 62 Query: 79 FLLLVVMLLLF 89 F L++ L+LF Sbjct: 63 FCLMMAFLILF 73 >gi|113170476|ref|YP_717267.1| Atp9 [Ostreococcus tauri] gi|229315917|ref|YP_002860143.1| ATPase subunit 9 [Micromonas sp. RCC299] gi|112806883|emb|CAL36389.1| unnamed protein product [Ostreococcus tauri] gi|226431202|gb|ACO55607.1| ATPase subunit 9 [Micromonas sp. RCC299] Length = 74 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + + +F +++S RNP ++ + E++ LF Sbjct: 4 GAKLIGAGCATIALAGAGAGIGIVFGSFISSVARNPSLTKTLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|54606730|dbj|BAD66753.1| ATPase subunit 9 [Beta vulgaris subsp. vulgaris] Length = 74 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+ FV Sbjct: 64 LMMAFLISFV 73 >gi|283795053|ref|YP_003359469.1| ATP synthase F0 subunit 9 [Synedra acus] gi|261279709|gb|ACX62017.1| ATP synthase F0 subunit 9 [Synedra acus] Length = 75 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 5 AAKCLGAGLATIGLAGAGIGIGTVFGALVLGTSRNPSLKDELFKIAILGFALTEAIALFA 64 Query: 81 LLVVMLLLFVI 91 L++ L+LF I Sbjct: 65 LMIAFLILFAI 75 >gi|253583914|ref|ZP_04861112.1| F0F1 ATP synthase subunit C [Fusobacterium varium ATCC 27725] gi|251834486|gb|EES63049.1| F0F1 ATP synthase subunit C [Fusobacterium varium ATCC 27725] Length = 132 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 29/71 (40%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A + G A + + + + P T +++ +AES G+F Sbjct: 6 LGASAIGAGCAMIAGLGAGIGEGYAAGKAVEAVVKIPEQKGNIITTMILGQAVAESTGIF 65 Query: 80 LLLVVMLLLFV 90 L+V ++LL+ Sbjct: 66 ALVVALILLYA 76 >gi|148259413|ref|YP_001233540.1| H+-transporting two-sector ATPase, C subunit [Acidiphilium cryptum JF-5] gi|326402639|ref|YP_004282720.1| ATP synthase subunit c [Acidiphilium multivorum AIU301] gi|146401094|gb|ABQ29621.1| ATP synthase F0 subcomplex C subunit [Acidiphilium cryptum JF-5] gi|325049500|dbj|BAJ79838.1| ATP synthase subunit c [Acidiphilium multivorum AIU301] Length = 77 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 39/71 (54%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A+ V G+A +G+ + + N+F ++ RNP A +VL+ + E++ L+ Sbjct: 7 LLARDVGAGLATIGVAGAGVGIGNLFGAFVGAVGRNPAARDKMFRDVLLGFALTEAVALY 66 Query: 80 LLLVVMLLLFV 90 L++ +++LF Sbjct: 67 ALVIALIILFA 77 >gi|197107690|gb|ACH42425.1| ATP synthase subunit 9 [Seirococcus axillaris] gi|259017964|gb|ACV89570.1| ATP synthetase subunit 9 [Caulocystis cephalornithos] gi|259017984|gb|ACV89580.1| ATP synthetase subunit 9 [Rosenvingea intricata] gi|259017986|gb|ACV89581.1| ATP synthetase subunit 9 [Sargassum fallax] Length = 55 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 24/55 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLRDELFRIAILGFALTEAIALF 55 >gi|124516450|gb|EAY57958.1| ATP synthase F0, subunit C [Leptospirillum rubarum] gi|206603291|gb|EDZ39771.1| ATP synthase F0, subunit C [Leptospirillum sp. Group II '5-way CG'] Length = 76 Score = 43.7 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 12/68 (17%), Positives = 30/68 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA + +G A +G+ + IF + R P + + ++E++ L+ Sbjct: 5 AAALIGMGAAAIGVAGSGAGIGYIFGKMIEAVARQPEVEGRVSKYMWLGFALSEAVALYA 64 Query: 81 LLVVMLLL 88 L++ +++ Sbjct: 65 LVIAFIIM 72 >gi|291556554|emb|CBL33671.1| ATP synthase F0 subcomplex C subunit [Eubacterium siraeum V10Sc8a] Length = 93 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A + G+A + + + R P A+ A ++I +AE+ GL+ Sbjct: 16 LGASAIGAGLAMIAGLGPGIGEGFCGGKAVEAIGRQPEASGAITRTMIIGDALAETTGLY 75 Query: 80 LLLVVMLLLFV 90 L++ +LL+F Sbjct: 76 SLIIALLLMFA 86 >gi|323140889|ref|ZP_08075802.1| ATP synthase F0, C subunit [Phascolarctobacterium sp. YIT 12067] gi|322414627|gb|EFY05433.1| ATP synthase F0, C subunit [Phascolarctobacterium sp. YIT 12067] Length = 87 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMACLGMG-LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G+ CLG N+ + R P + T +L+ + ES+ + Sbjct: 12 AASVIGAGLVCLGAAMGAGFGNGNMCGKSIESMARQPEESGKIFTNMLVCVGLIESMPIL 71 Query: 80 LLLVVMLLLFV 90 ++ ++L+F Sbjct: 72 CYVIAIVLVFA 82 >gi|255708776|gb|ACU30293.1| ATP synthase subunit 9 [Silene succulenta] Length = 56 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 26/56 (46%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 G A + + A+ + N+F++ + RNP + ++ + E++ LF L Sbjct: 1 GAGTATIALAGAAIGIGNVFSSLIHSVARNPSLSKQLFGYAILGFALTEAIALFAL 56 >gi|167750152|ref|ZP_02422279.1| hypothetical protein EUBSIR_01121 [Eubacterium siraeum DSM 15702] gi|167656895|gb|EDS01025.1| hypothetical protein EUBSIR_01121 [Eubacterium siraeum DSM 15702] gi|291531903|emb|CBK97488.1| ATP synthase F0 subcomplex C subunit [Eubacterium siraeum 70/3] Length = 93 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A + G+A + + + R P A+ A ++I +AE+ GL+ Sbjct: 16 LGASAIGAGLAMIAGLGPGIGEGFCGGKAVEAIGRQPEASGAITRTMIIGDALAETTGLY 75 Query: 80 LLLVVMLLLFV 90 L++ +LL+F Sbjct: 76 SLVIALLLMFA 86 >gi|197107626|gb|ACH42393.1| ATP synthase subunit 9 [Bifurcaria bifurcata] gi|197107638|gb|ACH42399.1| ATP synthase subunit 9 [Cystoseira nodicaulis] gi|197107684|gb|ACH42422.1| ATP synthase subunit 9 [Sargassum muticum] Length = 56 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLRDELFRIAILGFALTEAIALF 56 >gi|294084671|ref|YP_003551429.1| ATP synthase subunit C [Candidatus Puniceispirillum marinum IMCC1322] gi|292664244|gb|ADE39345.1| ATP synthase C chain [Candidatus Puniceispirillum marinum IMCC1322] Length = 75 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 30/56 (53%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 AAK + G+A + + VAL + NIF+ ++ RNP A S ++ + E++ Sbjct: 5 AAKMIGAGLAVIALHGVALGIGNIFSALVTSIARNPAARSEVFGIGILGFALTEAI 60 >gi|156052236|ref|XP_001592079.1| hypothetical protein SS1G_07527 [Sclerotinia sclerotiorum 1980] gi|154705303|gb|EDO05042.1| hypothetical protein SS1G_07527 [Sclerotinia sclerotiorum 1980 UF-70] Length = 150 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 23/50 (46%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + +F L RNP + ++ E++GLF L+V M+ F+ Sbjct: 101 IGLVFAALLQAVARNPSMRGQLFSYAILGFAFVEAIGLFDLMVAMMAKFL 150 >gi|148654686|ref|YP_001274891.1| ATP synthase F0 subunit C [Roseiflexus sp. RS-1] gi|148566796|gb|ABQ88941.1| ATP synthase F0, C subunit [Roseiflexus sp. RS-1] Length = 77 Score = 43.7 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + IF+ L RNP A +T + + + E+L +F L++ +L+ F I Sbjct: 20 IGPGVGIGVIFSGALQAMGRNPEAEGTLRTYMFLGFALVEALFIFALVISLLIAFRI 76 >gi|149184786|ref|ZP_01863104.1| hypothetical protein ED21_28748 [Erythrobacter sp. SD-21] gi|148832106|gb|EDL50539.1| hypothetical protein ED21_28748 [Erythrobacter sp. SD-21] Length = 75 Score = 43.7 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G G+ A+ V N+F ++L A RNP AA + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGAGMAAIGVGNVFGSFLESALRNPGAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFV 90 +V M+L+FV Sbjct: 65 FVVAMILIFV 74 >gi|113170456|ref|YP_717248.1| AtpH [Ostreococcus tauri] gi|112806863|emb|CAL36370.1| AtpH [Ostreococcus tauri] Length = 101 Score = 43.7 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA V G+A LG + + G R P A + +L+ E+L ++ Sbjct: 26 AASVVGAGLAIGLGAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 85 Query: 80 LLLVVMLLLFV 90 L+V + L+F Sbjct: 86 GLVVALALMFA 96 >gi|3617811|emb|CAA08854.1| F0-F1 ATPase subunit 9 [Daucus carota] gi|15809223|gb|AAK00504.1| ATPase9 [Daucus carota] Length = 76 Score = 43.7 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+L V Sbjct: 64 LMMAFLILSV 73 >gi|10802836|gb|AAG23624.1| ATP synthase protein 9 [Helianthus annuus] gi|92084860|emb|CAI83763.1| ATP synthase F0 subunit 9 [Helianthus annuus] Length = 86 Score = 43.3 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 29/67 (43%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+ ++ + RNP A ++ + E++ F Sbjct: 4 GAKLIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLL 87 ++ L+ Sbjct: 64 PMMAFLI 70 >gi|237744085|ref|ZP_04574566.1| ATP synthase subunit C [Fusobacterium sp. 7_1] gi|256028109|ref|ZP_05441943.1| F0F1 ATP synthase subunit C [Fusobacterium sp. D11] gi|260494330|ref|ZP_05814461.1| ATP synthase F0, C subunit [Fusobacterium sp. 3_1_33] gi|289766050|ref|ZP_06525428.1| ATP synthase subunit C [Fusobacterium sp. D11] gi|229431314|gb|EEO41526.1| ATP synthase subunit C [Fusobacterium sp. 7_1] gi|260198476|gb|EEW95992.1| ATP synthase F0, C subunit [Fusobacterium sp. 3_1_33] gi|289717605|gb|EFD81617.1| ATP synthase subunit C [Fusobacterium sp. D11] Length = 89 Score = 43.3 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 28/66 (42%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A + + + R P A + ++I +AES G++ +V Sbjct: 16 VGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGTILSTMIIGQAVAESTGIYSFVVA 75 Query: 85 MLLLFV 90 ++LL+ Sbjct: 76 LILLYA 81 >gi|224487717|sp|Q4A5Z9|ATPL_MYCS5 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|144575098|gb|AAZ43822.2| ATP synthase C chain [Mycoplasma synoviae 53] Length = 111 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 30/66 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G L + RNP S + +I A IAE+ ++ +V Sbjct: 44 VGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVA 103 Query: 85 MLLLFV 90 +LL+FV Sbjct: 104 LLLIFV 109 >gi|251771549|gb|EES52126.1| ATP synthase F0, C subunit [Leptospirillum ferrodiazotrophum] Length = 76 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/68 (17%), Positives = 30/68 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA + +G A +G+ + IF + R P + + ++E++ L+ Sbjct: 5 AAALIGMGAAAIGVAGSGAGIGYIFGKMIEAVARQPEIEGRVSKYMWLGFALSEAVALYA 64 Query: 81 LLVVMLLL 88 L++ +++ Sbjct: 65 LVIAFIIM 72 >gi|114644460|ref|XP_001137249.1| PREDICTED: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 isoform 1 [Pan troglodytes] Length = 256 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 17/34 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFR 54 AAK++ G A +G+ + +F + + G R Sbjct: 128 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYAR 161 >gi|38605627|sp|P60114|ATP9_SOLTU RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|38605628|sp|P60115|ATP9_OENBI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|67892|pir||LWPJ9M H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein (atp9-1) - garden petunia mitochondrion gi|67893|pir||LWOBM H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - evening primrose mitochondrion gi|7428291|pir||LWNTM H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - common tobacco mitochondrion gi|14137|emb|CAA45770.1| ATPase subunit 9 [Nicotiana tabacum] gi|297838|emb|CAA45154.1| ATP synthase (ATPase) subunit 9 [Solanum tuberosum] gi|316996012|dbj|BAD83468.2| ATP synthase F0 subunit 9 [Nicotiana tabacum] gi|447801|prf||1915346A ATP synthase:SUBUNIT=9 Length = 74 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|309390210|gb|ADO78090.1| ATP synthase F0 subcomplex C subunit [Halanaerobium praevalens DSM 2228] Length = 85 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 32/71 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A+ + G A + + + R+P A T +L+ +AES G++ Sbjct: 15 ASALLGAGFAMIAGIGPGIGQGYAAGKAVESVARDPEARGNIITTMLLGQAVAESTGIYS 74 Query: 81 LLVVMLLLFVI 91 L++ ++L+F I Sbjct: 75 LVIAIVLIFTI 85 >gi|126695330|ref|YP_001090217.1| ATP synthase F0 subunit 9 [Oscarella carmela] gi|317097067|ref|YP_004123209.1| ATP synthase F0 subunit 9 [Oscarella viridis] gi|317097413|ref|YP_004123618.1| ATP synthase F0 subunit 9 [Oscarella malakhovi] gi|317097447|ref|YP_004123646.1| ATP synthase F0 subunit 9 [Oscarella tuberculata] gi|317134141|ref|YP_004123304.1| ATP synthase F0 subunit 9 [Oscarella lobularis] gi|317134285|ref|YP_004123168.1| ATP synthase F0 subunit 9 [Pseudocorticium jarrei] gi|116876186|gb|ABK30950.1| ATP synthase F0 subunit 9 [Oscarella carmela] gi|308912626|gb|ADO51391.1| ATP synthase F0 subunit 9 [Oscarella tuberculata] gi|308912686|gb|ADO51447.1| ATP synthase F0 subunit 9 [Pseudocorticium jarrei] gi|308912702|gb|ADO51462.1| ATP synthase F0 subunit 9 [Oscarella viridis] gi|308912748|gb|ADO51505.1| ATP synthase F0 subunit 9 [Oscarella lobularis] gi|312162790|gb|ADO51547.1| ATP synthase F0 subunit 9 [Oscarella malakhovi] Length = 75 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 L+AK++ G A +G + +F + + G RNP T ++ ++E++GL Sbjct: 3 ELSAKFIGAGAATVGAAGSGAGIGTVFGSLVIGYARNPSLKQQLFTYAILGFALSEAMGL 62 Query: 79 FLLLVVMLLLF 89 F L++ L+LF Sbjct: 63 FCLMMAFLILF 73 >gi|319997210|gb|ADV91199.1| mitochondrial ATP synthase F0 lipid binding subunit-like protein 4 [Karlodinium micrum] Length = 104 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + +G A + +F + G RNP T LI E L + ++++ Sbjct: 38 LGCAITMVAVGGCAQGIGQLFAALVVGMARNPSMKEDLFTYTLIGMGFLEFLAIVVIMMA 97 Query: 85 MLLLF 89 LLL+ Sbjct: 98 GLLLY 102 >gi|197107640|gb|ACH42400.1| ATP synthase subunit 9 [Cystoseira tamariscifolia] Length = 56 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLRDELFRIAILGFAMTEAIALF 56 >gi|58578621|ref|YP_203311.1| ATP synthase F0 subunit 9 [Rhizopus oryzae] gi|121923516|sp|Q3T4E5|ATP9_RHIOR RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|57339008|gb|AAW49478.1| ATP synthase F0 subunit 9 [Rhizopus oryzae] Length = 74 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + V +F ++ RNP + ++ + E++GLF Sbjct: 4 AAKILGAGLATIGLAGAGVGVGLVFAALINSTSRNPSLRPQLFSYTILGFALTEAIGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+ Sbjct: 64 LMMAFLLLYA 73 >gi|164421045|ref|YP_001648675.1| ATP synthase F0 subunit 9 [Plakortis angulospiculatus] gi|317097081|ref|YP_004123220.1| ATP synthase F0 subunit 9 [Plakortis halichondrioides] gi|317097128|ref|YP_004123260.1| ATP synthase F0 subunit 9 [Plakina jani] gi|317097378|ref|YP_004123587.1| ATP synthase F0 subunit 9 [Plakina monolopha] gi|317097394|ref|YP_004123601.1| ATP synthase F0 subunit 9 [Plakina crypta] gi|317097478|ref|YP_004123694.1| ATP synthase F0 subunit 9 [Plakina sp. DVL-2010] gi|317134166|ref|YP_004123419.1| ATP synthase F0 subunit 9 [Corticium candelabrum] gi|158939035|gb|ABW83955.1| ATP synthase F0 subunit 9 [Plakortis angulospiculatus] gi|308912592|gb|ADO51359.1| ATP synthase F0 subunit 9 [Plakina monolopha] gi|308912607|gb|ADO51373.1| ATP synthase F0 subunit 9 [Plakina crypta] gi|308912638|gb|ADO51402.1| ATP synthase F0 subunit 9 [Plakina sp. DVL-2010] gi|308912714|gb|ADO51473.1| ATP synthase F0 subunit 9 [Plakortis halichondrioides] gi|308912729|gb|ADO51487.1| ATP synthase F0 subunit 9 [Plakina jani] gi|308912775|gb|ADO51530.1| ATP synthase F0 subunit 9 [Corticium candelabrum] Length = 75 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 L+AK++ G A +G + +F + + G RNP T + ++E++GL Sbjct: 3 ELSAKFIGAGAATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAIFGFALSEAMGL 62 Query: 79 FLLLVVMLLLF 89 F L++ L+LF Sbjct: 63 FCLMMAFLILF 73 >gi|259017960|gb|ACV89568.1| ATP synthetase subunit 9 [Agarum clathratum] gi|259017962|gb|ACV89569.1| ATP synthetase subunit 9 [Bellotia eriophorum] gi|259017968|gb|ACV89572.1| ATP synthetase subunit 9 [Chnoospora implexa] gi|259017970|gb|ACV89573.1| ATP synthetase subunit 9 [Cystophora grevillei] gi|259017974|gb|ACV89575.1| ATP synthetase subunit 9 [Desmarestia menziesii] gi|259017976|gb|ACV89576.1| ATP synthetase subunit 9 [Ecklonia radiata] gi|259017978|gb|ACV89577.1| ATP synthetase subunit 9 [Himantothallus grandifolius] gi|259017980|gb|ACV89578.1| ATP synthetase subunit 9 [Hydroclathrus clathratus] gi|259017982|gb|ACV89579.1| ATP synthetase subunit 9 [Phyllariopsis brevipes] Length = 55 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 24/55 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKDELFRIAILGFALTEAIALF 55 >gi|295311671|ref|YP_003587252.1| ATPase subunit 9 [Citrullus lanatus] gi|295311677|ref|YP_003587354.1| ATPase subunit 9 [Cucurbita pepo] gi|259156799|gb|ACV96661.1| ATPase subunit 9 [Citrullus lanatus] gi|259156805|gb|ACV96666.1| ATPase subunit 9 [Cucurbita pepo] Length = 74 Score = 42.9 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLMGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|27734220|sp|Q37550|ATP9_MALDO RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|531252|dbj|BAA07175.1| F0-ATPase subunit 9 [Malus x domestica] Length = 82 Score = 42.9 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 30/67 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLL 87 ++ L+ Sbjct: 64 PMMAFLI 70 >gi|323149035|ref|YP_004222812.1| ATPase subunit 9 [Vigna radiata] gi|323149046|ref|YP_004222828.1| ATPase subunit 9 [Vigna radiata] gi|308206741|gb|ADO19878.1| ATPase subunit 9 [Vigna radiata] gi|308206752|gb|ADO19889.1| ATPase subunit 9 [Vigna radiata] Length = 74 Score = 42.9 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 28/52 (53%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N+F++ + RNP A ++ + E++ LF L++ L+LFV Sbjct: 22 VGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFV 73 >gi|164421030|ref|YP_001648481.1| ATP synthase F0 subunit 9 [Aplysina fulva] gi|158668079|gb|ABW76542.1| ATP synthase F0 subunit 9 [Aplysina fulva] Length = 78 Score = 42.9 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + ++F + G RNP T ++ ++E++GLF Sbjct: 8 AAKFVGAGAATIGAAGSGAGIGSVFGNLIIGYARNPSLKQQLFTYAILGFALSEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|116206054|ref|XP_001228836.1| predicted protein [Chaetomium globosum CBS 148.51] gi|88182917|gb|EAQ90385.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 77 Score = 42.9 bits (100), Expect = 0.013, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 25/49 (51%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F + +SG RNP + ++ AE+ GLF L+V LLL+ Sbjct: 28 GQVFGSLISGVARNPAMRGQLFSYAVLGFAFAEATGLFALMVAFLLLYA 76 >gi|296536544|ref|ZP_06898631.1| H(+)-transporting two-sector ATPase [Roseomonas cervicalis ATCC 49957] gi|296263140|gb|EFH09678.1| H(+)-transporting two-sector ATPase [Roseomonas cervicalis ATCC 49957] Length = 75 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 32/60 (53%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L + V LA+ NIF+T ++ RNP A ++ + E++ LF LL+ L+LF Sbjct: 16 VLALFGVGLALGNIFSTLIASVARNPAARDTVFPIGILGFALTEAVALFALLIAFLILFT 75 >gi|145258791|ref|XP_001402177.1| ATP synthase subunit 9 [Aspergillus niger CBS 513.88] gi|134074790|emb|CAK44785.1| unnamed protein product [Aspergillus niger] Length = 157 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 22/47 (46%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L RNP + ++ E++GLF L+V M+ +V Sbjct: 111 VFGALLLSVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 157 >gi|63025103|ref|YP_232797.1| ATP synthase F0 subunit 9 [Geodia neptuni] gi|164421119|ref|YP_001648414.1| ATP synthase F0 subunit 9 [Cinachyrella kuekenthali] gi|37961465|gb|AAP59162.1| ATP synthase F0 subunit A6L [Geodia neptuni] gi|158938901|gb|ABW83830.1| ATP synthase F0 subunit 9 [Cinachyrella kuekenthali] Length = 78 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 8 AAKFVGAGAASIGAAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|197107616|gb|ACH42388.1| ATP synthase subunit 9 [Alaria esculenta] gi|197107620|gb|ACH42390.1| ATP synthase subunit 9 [Ascophyllum nodosum] gi|197107624|gb|ACH42392.1| ATP synthase subunit 9 [Asperococcus bullosus] gi|197107628|gb|ACH42394.1| ATP synthase subunit 9 [Chorda filum] gi|197107634|gb|ACH42397.1| ATP synthase subunit 9 [Cutleria multifida] gi|197107642|gb|ACH42401.1| ATP synthase subunit 9 [Desmarestia aculeata] gi|197107644|gb|ACH42402.1| ATP synthase subunit 9 [Desmarestia ligulata] gi|197107646|gb|ACH42403.1| ATP synthase subunit 9 [Durvillaea potatorum] gi|197107648|gb|ACH42404.1| ATP synthase subunit 9 [Ectocarpus sp. FRA0524] gi|197107652|gb|ACH42406.1| ATP synthase subunit 9 [Halidrys siliquosa] gi|197107654|gb|ACH42407.1| ATP synthase subunit 9 [Himanthalia elongata] gi|197107656|gb|ACH42408.1| ATP synthase subunit 9 [Hincksia granulosa] gi|197107658|gb|ACH42409.1| ATP synthase subunit 9 [Hormosira banksii] gi|197107660|gb|ACH42410.1| ATP synthase subunit 9 [Leathesia difformis] gi|197107662|gb|ACH42411.1| ATP synthase subunit 9 [Nemoderma tingitanum] gi|197107668|gb|ACH42414.1| ATP synthase subunit 9 [Pelvetia canaliculata] gi|197107670|gb|ACH42415.1| ATP synthase subunit 9 [Petalonia fascia] gi|197107672|gb|ACH42416.1| ATP synthase subunit 9 [Petrospongium berkeleyi] gi|197107674|gb|ACH42417.1| ATP synthase subunit 9 [Phyllospora comosa] gi|197107682|gb|ACH42421.1| ATP synthase subunit 9 [Saccorhiza polyschides] gi|197107686|gb|ACH42423.1| ATP synthase subunit 9 [Scytosiphon lomentaria] gi|197107688|gb|ACH42424.1| ATP synthase subunit 9 [Scytothamnus australis] gi|197107692|gb|ACH42426.1| ATP synthase subunit 9 [Splachnidium rugosum] gi|197107694|gb|ACH42427.1| ATP synthase subunit 9 [Sporochnus pedunculatus] gi|197107696|gb|ACH42428.1| ATP synthase subunit 9 [Tilopteris mertensii] gi|197107698|gb|ACH42429.1| ATP synthase subunit 9 [Xiphophora chondrophylla] gi|197107700|gb|ACH42430.1| ATP synthase subunit 9 [Zanardinia typus] Length = 56 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKDELFRIAILGFALTEAIALF 56 >gi|220932622|ref|YP_002509530.1| ATP synthase F0, C subunit [Halothermothrix orenii H 168] gi|219993932|gb|ACL70535.1| ATP synthase F0, C subunit [Halothermothrix orenii H 168] Length = 83 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 31/69 (44%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA + G+A + + + R P A T +L+ +AES G++ Sbjct: 15 AASLLGAGIAMVAGIGPGIGQGYAAGKAVEAVARQPEARGNILTTMLLGQAVAESTGIYS 74 Query: 81 LLVVMLLLF 89 L++ +LL+F Sbjct: 75 LVIAILLIF 83 >gi|85708926|ref|ZP_01039992.1| ATP synthase subunit A [Erythrobacter sp. NAP1] gi|85690460|gb|EAQ30463.1| ATP synthase subunit A [Erythrobacter sp. NAP1] Length = 76 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 29/70 (41%), Positives = 42/70 (60%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G G+ A+ V N+F ++L A RNP AA + + I AE LGL Sbjct: 5 AAKLIGAGLAAIGAGMAAIGVGNVFGSFLESALRNPGAADGQQGRLFIGFAAAELLGLLA 64 Query: 81 LLVVMLLLFV 90 +V M+L+FV Sbjct: 65 FVVAMILIFV 74 >gi|26553509|ref|NP_757443.1| ATP synthase subunit C [Mycoplasma penetrans HF-2] gi|81748107|sp|Q8EWZ3|ATPL_MYCPE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|26453515|dbj|BAC43847.1| ATP synthase subunit C [Mycoplasma penetrans HF-2] Length = 78 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 33/67 (49%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A + + V + + RNP S +++ ++ A + E+ L+ ++ Sbjct: 10 FIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTETGALYCFII 69 Query: 84 VMLLLFV 90 +LL+FV Sbjct: 70 AILLVFV 76 >gi|226394|prf||1510195A ATP synthase 9 Length = 157 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 22/47 (46%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F L RNP + ++ E++GLF L+V M+ +V Sbjct: 111 VFGALLLSVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 157 >gi|218508793|ref|ZP_03506671.1| F0F1 ATP synthase subunit C [Rhizobium etli Brasil 5] Length = 37 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 21/37 (56%) Query: 34 MGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 M AL + NIF +YLSGA RNP AA + ++ Sbjct: 1 MAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGF 37 >gi|163854292|ref|YP_001633638.1| ATP synthase F0 subunit 9 [Negombata magnifica] gi|163639447|emb|CAM06603.1| ATP synthase F0 subunit 9 [Negombata magnifica] Length = 78 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK+V G A +G G + + +F + G RNP T ++ I+E++GLF Sbjct: 8 GAKFVGAGAATIGAGGSGVGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMMAFLILF 76 >gi|11466480|ref|NP_038183.1| ATP synthase F0 subunit 9 [Chrysodidymus synuroideus] gi|7110477|gb|AAF36949.1|AF222718_23 ATP synthase F0 subunit 9 [Chrysodidymus synuroideus] Length = 75 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA+ + G++ G+ + + IF + + G RNP ++ E++ LF Sbjct: 5 AAQKIGAGLSTFGLAGAGIGIGLIFASLIIGVSRNPNLKDDLFRFAILGFAFTEAIALFA 64 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 65 LMIAFLILFV 74 >gi|269114795|ref|YP_003302558.1| ATP synthase subunit C [Mycoplasma hominis] gi|268322420|emb|CAX37155.1| ATP synthase C chain [Mycoplasma hominis ATCC 23114] Length = 101 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 22/79 (27%), Positives = 38/79 (48%) Query: 12 AAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A N + + G+A LG GLV++ RNP A S +T +++ Sbjct: 23 AGVNYPLAYGLTMLGAGIAVLGSGLVSIGQGLAVAKACEAVGRNPEALSKIRTLLILGLG 82 Query: 72 IAESLGLFLLLVVMLLLFV 90 I E+ ++ L++ +LL+FV Sbjct: 83 IVETGSIYCLVISLLLIFV 101 >gi|160902216|ref|YP_001567797.1| ATP synthase F0, C subunit [Petrotoga mobilis SJ95] gi|224487656|sp|A9BFX8|ATPL_PETMO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|160359860|gb|ABX31474.1| ATP synthase F0, C subunit [Petrotoga mobilis SJ95] Length = 96 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 K + G+A +G + NI + R P + T +L+ + ES GL+ Sbjct: 25 GKLLGAGVAMGIGAIGPGVGEGNIGAHAMDAMARQPEMSGNLTTRMLLAMAVTESTGLYS 84 Query: 81 LLVVMLLLFVI 91 L+V ++LLFV+ Sbjct: 85 LVVALILLFVL 95 >gi|197107618|gb|ACH42389.1| ATP synthase subunit 9 [Analipus japonicus] Length = 56 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 V G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LVGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKEELFRIAILGFALTEAIALF 56 >gi|54298274|ref|YP_124643.1| hypothetical protein lpp2332 [Legionella pneumophila str. Paris] gi|148360286|ref|YP_001251493.1| hypothetical protein LPC_2223 [Legionella pneumophila str. Corby] gi|296106666|ref|YP_003618366.1| ATP synthase C subunit (H transporting ATP synthase) [Legionella pneumophila 2300/99 Alcoy] gi|53752059|emb|CAH13485.1| hypothetical protein lpp2332 [Legionella pneumophila str. Paris] gi|148282059|gb|ABQ56147.1| hypothetical protein LPC_2223 [Legionella pneumophila str. Corby] gi|295648567|gb|ADG24414.1| ATP synthase C subunit (H transporting ATP synthase) [Legionella pneumophila 2300/99 Alcoy] Length = 91 Score = 42.9 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 20/73 (27%), Positives = 37/73 (50%) Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 ++SLA+ +A +G ALA+ + L R P A + + I + ESL Sbjct: 6 WFSLASTVIAAIAIAIGTIGPALAMGRAISHALDALARQPEAEKSITRTLFIGLAMIESL 65 Query: 77 GLFLLLVVMLLLF 89 ++ L++V+++LF Sbjct: 66 AIYCLVIVLIILF 78 >gi|291543819|emb|CBL16928.1| ATP synthase F0 subcomplex C subunit [Ruminococcus sp. 18P13] Length = 84 Score = 42.9 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 28/71 (39%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A + + R P A+ + + +AES G++ Sbjct: 7 LAGSAIGAGLAMIAGIGPGIGEGYAVGKACEAIGRQPEASGPVTRTMFVGCAVAESTGIY 66 Query: 80 LLLVVMLLLFV 90 +V ++LLF Sbjct: 67 GFVVALILLFA 77 >gi|197127238|gb|ACH43736.1| putative ATP synthase H+ transporting mitochondrial F0 complex subunit c isoform 1 [Taeniopygia guttata] Length = 99 Score = 42.9 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 19/37 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPC 57 AAK++ G A +G+ + +F + + G RNP Sbjct: 60 AAKFIGAGAATVGVAGSGAGIGTVFGSLIFGYARNPS 96 >gi|62161300|ref|YP_214866.1| ATP synthase F0 subunit 9 [Axinella corrugata] gi|55275031|gb|AAV49309.1| ATP synthase F0 subunit 9 [Axinella corrugata] Length = 78 Score = 42.5 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 8 AAKFVGAGAASIGAAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMMAFLILF 76 >gi|186920133|ref|YP_001874787.1| ATP synthase F0 subunit 9 [Hemiselmis andersenii] gi|186461079|gb|ACC78241.1| ATP synthase F0 subunit 9 [Hemiselmis andersenii] Length = 77 Score = 42.5 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 36/69 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ V + + +F ++ RNP ++ + E++GLF Sbjct: 8 SAKQIGAGLATIGLAGVGVGIGVVFGALVNSFARNPSLRQQLFGFTILGFALTEAIGLFA 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMMAFLILF 76 >gi|115278600|ref|YP_762503.1| ATPase subunit 9 [Tripsacum dactyloides] gi|114432091|gb|ABI74640.1| ATPase subunit 9 [Tripsacum dactyloides] Length = 84 Score = 42.5 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|164422234|gb|ABY55207.1| Atp9 [Bambusa oldhamii] Length = 80 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|115278530|ref|YP_762352.1| ATPase subunit 9 [Sorghum bicolor] gi|114309651|gb|ABI60868.1| ATPase subunit 9 [Sorghum bicolor] Length = 86 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|317097238|ref|YP_004123367.1| ATP synthase F0 subunit 9 [Plakortis simplex] gi|308912760|gb|ADO51516.1| ATP synthase F0 subunit 9 [Plakortis simplex] Length = 75 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 35/71 (49%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 L+AK++ G A +G + +F + + G RNP T + ++E++GL Sbjct: 3 ELSAKFIGAGAATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAIFGFALSEAMGL 62 Query: 79 FLLLVVMLLLF 89 F L++ L+ F Sbjct: 63 FCLMMAFLIXF 73 >gi|255956353|ref|XP_002568929.1| Pc21g19380 [Penicillium chrysogenum Wisconsin 54-1255] gi|62952900|gb|AAY23173.1| putative ATP synthase protein 9 [Penicillium chrysogenum] gi|211590640|emb|CAP96835.1| Pc21g19380 [Penicillium chrysogenum Wisconsin 54-1255] Length = 150 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 +K + +G A +G+G + + +F L RNP + ++ E++GLF L Sbjct: 82 SKNIGMGSAAIGLGGAGIGIGLVFAALLMSVSRNPALRGQLFSYAILGFAFVEAMGLFDL 141 Query: 82 LVVMLLLFV 90 +V M+ +V Sbjct: 142 MVAMMCKYV 150 >gi|259017988|gb|ACV89582.1| ATP synthetase subunit 9 [Undaria pinnatifida] Length = 55 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 24/55 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKDELFRIAILGLRLTEAIALF 55 >gi|154312752|ref|XP_001555703.1| ATP synthase protein 9 [Botryotinia fuckeliana B05.10] gi|150849779|gb|EDN24972.1| ATP synthase protein 9 [Botryotinia fuckeliana B05.10] Length = 149 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 23/50 (46%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + +F L RNP + ++ E++GLF L+V M+ F+ Sbjct: 100 IGLVFAALLQAVARNPSMRGQLFSYAILGFAFVEAIGLFDLMVAMMAKFL 149 >gi|319997212|gb|ADV91200.1| mitochondrial ATP synthase F0 lipid binding subunit-like protein 5 [Karlodinium micrum] Length = 128 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + +G A + +F + G RNP T LI E L + ++++ Sbjct: 62 LGCAITMVAVGGCAQGIGQLFAALVVGMARNPSMKEDLFTYTLIGMGFLEFLAIVVIMMA 121 Query: 85 MLLLF 89 LLL+ Sbjct: 122 GLLLY 126 >gi|38605629|sp|P60116|ATP9_TOBAC RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|38605630|sp|P60117|ATP9_SOLLC RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|38605631|sp|P60118|ATP9_PETHY RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein Length = 74 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLMGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+ FV Sbjct: 64 LMMAFLISFV 73 >gi|325973531|ref|YP_004250595.1| ATP synthase F0 C subunit [Mycoplasma suis str. Illinois] gi|323652133|gb|ADX98215.1| ATP synthase F0, C subunit [Mycoplasma suis str. Illinois] Length = 96 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 31/66 (46%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K + G+A L ALA + + RNP + + ++ A I ES+ ++ L Sbjct: 28 GKNIGSGIAILAGLGAALAQGYMGGKAIEALARNPEVETLIFKQFIVGAAICESVAIYGL 87 Query: 82 LVVMLL 87 ++ ++L Sbjct: 88 IIAIIL 93 >gi|197107622|gb|ACH42391.1| ATP synthase subunit 9 [Ascoseira mirabilis] Length = 56 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 25/56 (44%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F ++ G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGAHVLGTARNPSLKKELFKLAILGFALTEAIALF 56 >gi|291286404|ref|YP_003503220.1| ATP synthase F0, C subunit [Denitrovibrio acetiphilus DSM 12809] gi|290883564|gb|ADD67264.1| ATP synthase F0, C subunit [Denitrovibrio acetiphilus DSM 12809] Length = 106 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Query: 23 KYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 KY+ G+A + + N + G RNP A+ T ++I + ESL ++ L Sbjct: 37 KYIGAGLAIGVAALGTGIGQGNAIKGAVEGISRNPSASGKISTTMIIGLALIESLAIYAL 96 Query: 82 LVVMLLLFVI 91 +V ++LLFV+ Sbjct: 97 VVALILLFVV 106 >gi|282600936|ref|ZP_05980213.2| ATP synthase c chain [Subdoligranulum variabile DSM 15176] gi|282570088|gb|EFB75623.1| ATP synthase c chain [Subdoligranulum variabile DSM 15176] Length = 97 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 28/53 (52%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 A+ N L G R P + +T +++ I ES G++ L++ +LLLFV Sbjct: 44 AIGEGNAVGKALEGMSRQPEMTNVLRTNMILGCAITESTGIYSLVISLLLLFV 96 >gi|325989989|ref|YP_004249688.1| putative ATP synthase subunit c [Mycoplasma suis KI3806] gi|323575074|emb|CBZ40735.1| probable ATP synthase subunit c [Mycoplasma suis] Length = 96 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 31/66 (46%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K + G+A L ALA + + RNP + + ++ A I ES+ ++ L Sbjct: 28 GKNIGAGIAILAGLGAALAQGYMGGKAIEALARNPEVETLIFKQFIVGAAICESVAIYGL 87 Query: 82 LVVMLL 87 ++ ++L Sbjct: 88 IIAIIL 93 >gi|168019|gb|AAA33296.1| mitochondrial ATP synthase precursor [Emericella nidulans] Length = 143 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F + L RNP + ++ E++GLF L+V M+ +V Sbjct: 97 VFGSLLLAVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 143 >gi|67522334|ref|XP_659228.1| ATP9_EMENI ATP synthase protein 9, mitochondrial precursor (Lipid-binding protein) [Aspergillus nidulans FGSC A4] gi|146345376|sp|P16000|ATP9_EMENI RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein; Flags: Precursor gi|40745588|gb|EAA64744.1| ATP9_EMENI ATP synthase protein 9, mitochondrial precursor (Lipid-binding protein) [Aspergillus nidulans FGSC A4] gi|259486959|tpe|CBF85243.1| TPA: ATP synthase subunit 9, mitochondrial Precursor (Lipid-binding protein) [Source:UniProtKB/Swiss-Prot;Acc:P16000] [Aspergillus nidulans FGSC A4] Length = 143 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 23/47 (48%) Query: 44 IFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +F + L RNP + ++ E++GLF L+V M+ +V Sbjct: 97 VFGSLLLAVSRNPALRGQLFSYAILGFAFVEAIGLFDLMVAMMCKYV 143 >gi|156741256|ref|YP_001431385.1| ATP synthase F0 subunit C [Roseiflexus castenholzii DSM 13941] gi|156232584|gb|ABU57367.1| ATP synthase F0, C subunit [Roseiflexus castenholzii DSM 13941] Length = 77 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + +A +A +G + + IF+ L RNP A +T + + + E+L +F Sbjct: 5 GLRLIAAALAVGIGAVGPGVGIGVIFSGALQAMGRNPEAEGTLRTYMFLGFALVEALFIF 64 Query: 80 LLLVVMLLLFVI 91 L++ +L+ F I Sbjct: 65 ALVIALLIAFRI 76 >gi|322789549|gb|EFZ14807.1| hypothetical protein SINV_13286 [Solenopsis invicta] Length = 54 Score = 42.1 bits (98), Expect = 0.022, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 28/53 (52%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + ++F + + G RNP + ++ ++E++GLF L++ LLLF Sbjct: 1 GAGIGSVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLLFA 53 >gi|197107650|gb|ACH42405.1| ATP synthase subunit 9 [Elachista fucicola] Length = 56 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKEELFRIAILGFALTEAIALF 56 >gi|226324162|ref|ZP_03799680.1| hypothetical protein COPCOM_01941 [Coprococcus comes ATCC 27758] gi|225207711|gb|EEG90065.1| hypothetical protein COPCOM_01941 [Coprococcus comes ATCC 27758] Length = 88 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 20/77 (25%), Positives = 35/77 (45%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 +N LA + G+A + + S RNP A S + +L+ +A Sbjct: 5 SNEALILACSAIGAGLAMIAGIGPGVGQGIAAGHGASAVGRNPGARSDITSTMLLGQAVA 64 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ L++ ++LLF Sbjct: 65 ETTGLYSLVIALILLFA 81 >gi|4877659|gb|AAD31399.1|AF119053_1 ATPase subunit 9 [Candida apicola] Length = 55 Score = 42.1 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 29/55 (52%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 A +G+ + ++ +F ++G RNP + + ++ ++E+ GLF L++ Sbjct: 1 ATIGLLGAGIGIAIVFAALITGVSRNPSMKAQLFSYAILGMALSEATGLFCLMIS 55 >gi|226348809|gb|ACO50713.1| ATPase subunit 9 [Micromonas pusilla CCMP1545] Length = 74 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + + +F +++S RNP ++ + E++ LF Sbjct: 4 GAKLIGAGCATIALAGAGAGIGIVFGSFISSVARNPALTKTLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 L++ L+LFV Sbjct: 64 LMMAFLILFV 73 >gi|15828742|ref|NP_326102.1| ATP synthase C chain [Mycoplasma pulmonis UAB CTIP] gi|81533022|sp|Q98QU0|ATPL_MYCPU RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|14089684|emb|CAC13444.1| ATP SYNTHASE C CHAIN [Mycoplasma pulmonis] Length = 92 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 30/66 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G L RNP A ++ ++I I+ES L+ ++ Sbjct: 26 VGAGLASIGNFGTGLGQGLSAGRAAEAVGRNPEAIKKIRSLMIIGMAISESASLYSFIIA 85 Query: 85 MLLLFV 90 +LL+FV Sbjct: 86 ILLVFV 91 >gi|111283587|gb|ABH09165.1| ATP synthase subunit 9 [Silene vulgaris] gi|111283591|gb|ABH09167.1| ATP synthase subunit 9 [Silene vulgaris] Length = 70 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKLIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLL 87 L++ L+ Sbjct: 64 LMMAFLI 70 >gi|197107632|gb|ACH42396.1| ATP synthase subunit 9 [Colpomenia peregrina] Length = 56 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKEELFRLAILGFALTEAIALF 56 >gi|170676853|ref|YP_001742096.1| ATP synthase F0 subunit 9 [Suberites domuncula] gi|170649719|emb|CAM84211.1| ATP synthase F0 subunit 9 [Suberites domuncula] Length = 78 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 33/69 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK+V G A +G + +F + G RNP ++ I+E++GLF Sbjct: 8 GAKFVGAGAASIGAAGSGAGIGTVFGNLIIGYARNPSLKQQLFAYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMIAFLILF 76 >gi|111283585|gb|ABH09164.1| ATP synthase subunit 9 [Silene vulgaris] gi|111283589|gb|ABH09166.1| ATP synthase subunit 9 [Silene vulgaris] gi|111283593|gb|ABH09168.1| ATP synthase subunit 9 [Silene vulgaris] gi|111283599|gb|ABH09171.1| ATP synthase subunit 9 [Silene vulgaris] Length = 70 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLL 87 L++ L+ Sbjct: 64 LMMAFLI 70 >gi|1352023|sp|P17254|ATP9_HELAN RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|12984|emb|CAA36177.1| unnamed protein product [Helianthus annuus] Length = 83 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 31/71 (43%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+ ++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFVI 91 ++ L+ VI Sbjct: 64 PMMAFLISSVI 74 >gi|71894425|ref|YP_278533.1| ATP synthase C chain [Mycoplasma synoviae 53] Length = 105 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 30/66 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G L + RNP S + +I A IAE+ ++ +V Sbjct: 38 VGAGLAMIGAIGSGLGQGYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVA 97 Query: 85 MLLLFV 90 +LL+FV Sbjct: 98 LLLIFV 103 >gi|254302784|ref|ZP_04970142.1| F-type two-sector ATPase, F(0) subunit C [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148322976|gb|EDK88226.1| F-type two-sector ATPase, F(0) subunit C [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 89 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 30/66 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A + + + R P A + + +++ +AES G++ L++ Sbjct: 16 VGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIA 75 Query: 85 MLLLFV 90 ++LL+ Sbjct: 76 LILLYA 81 >gi|331092000|ref|ZP_08340831.1| hypothetical protein HMPREF9477_01474 [Lachnospiraceae bacterium 2_1_46FAA] gi|330402201|gb|EGG81772.1| hypothetical protein HMPREF9477_01474 [Lachnospiraceae bacterium 2_1_46FAA] Length = 88 Score = 41.8 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 20/77 (25%), Positives = 35/77 (45%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 +N LA + G+A + + S RNP A S + +L+ +A Sbjct: 5 SNEALILACSAIGAGLAMIAGIGPGIGQGVAAGHGASAVGRNPGAKSDITSTMLLGQAVA 64 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ L++ ++LLF Sbjct: 65 ETTGLYSLVIALILLFA 81 >gi|222839800|ref|YP_002587017.1| ATP synthase F0 subunit 9 [Glomus intraradices] gi|306960109|ref|YP_003875525.1| ATP synthase F0 subunit c [Glomus irregulare] gi|222136762|gb|ACM44994.1| ATP synthase F0 subunit 9 [Glomus intraradices] gi|306490539|gb|ADM94780.1| ATP synthase F0 subunit c [Glomus irregulare] Length = 74 Score = 41.8 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G+A +G+ + V +F + + RNP + ++ + E+L LF Sbjct: 4 AAKIIGAGLATIGLAGAGVGVGIVFASLVISTARNPSLRPQLFSYAILGFALTEALALFA 63 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 64 LMMAFLLLY 72 >gi|218782140|ref|YP_002433458.1| ATP synthase F0 subunit C [Desulfatibacillum alkenivorans AK-01] gi|218763524|gb|ACL05990.1| Putative ATP synthase F0, C subunit [Desulfatibacillum alkenivorans AK-01] Length = 325 Score = 41.8 bits (97), Expect = 0.028, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A ++ G+A G A+ + RNP + +L+ +AES +F Sbjct: 11 AAFIGGGLAMGFGAIGAAVGEGYAAANANAAISRNPEVSGDVFKTMLVGQAVAESAAIFA 70 Query: 81 LLVVMLLLFV 90 L+V MLL+F Sbjct: 71 LVVAMLLVFA 80 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 18/84 (21%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 F A + A ++ G+ +G + + + RN A + +L Sbjct: 242 KAFDPAGTTLAPAMALLSAGICMGIGAIGPGVGEGFAAQSAVGWIARNENATAELTRTML 301 Query: 68 IFAVIAESLGLFLLLVVMLLLFVI 91 + +AES G++ L+V ++L+FV+ Sbjct: 302 VGQAVAESTGIYALVVALVLIFVV 325 >gi|167972503|ref|ZP_02554780.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] gi|167974524|ref|ZP_02556801.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] gi|167975073|ref|ZP_02557350.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] gi|167988347|ref|ZP_02570018.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] gi|168362153|ref|ZP_02695332.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] gi|195867727|ref|ZP_03079728.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|198273492|ref|ZP_03206028.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] gi|209554333|ref|YP_002284559.1| ATP synthase, C subunit [Ureaplasma urealyticum serovar 10 str. ATCC 33699] gi|225550673|ref|ZP_03771622.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 2 str. ATCC 27814] gi|225551561|ref|ZP_03772507.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 8 str. ATCC 27618] gi|224487686|sp|B5ZAW9|ATPL_UREU1 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|171903575|gb|EDT49864.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 13 str. ATCC 33698] gi|184209439|gb|EDU06482.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 5 str. ATCC 27817] gi|188018794|gb|EDU56834.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 7 str. ATCC 27819] gi|188997901|gb|EDU66998.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 11 str. ATCC 33695] gi|195659995|gb|EDX53375.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 12 str. ATCC 33696] gi|195660582|gb|EDX53838.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 9 str. ATCC 33175] gi|198250012|gb|EDY74792.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 4 str. ATCC 27816] gi|209541834|gb|ACI60063.1| ATP synthase, C subunit [Ureaplasma urealyticum serovar 10 str. ATCC 33699] gi|225379376|gb|EEH01741.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 8 str. ATCC 27618] gi|225379827|gb|EEH02189.1| ATP synthase F0, C subunit family protein [Ureaplasma urealyticum serovar 2 str. ATCC 27814] Length = 109 Score = 41.8 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 KY+ G+ L G V L + RNP A + +++ +AE++ ++ L Sbjct: 40 GKYIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYAL 99 Query: 82 LVVMLLLFV 90 +V +L++FV Sbjct: 100 IVSILIIFV 108 >gi|112253604|gb|ABI14388.1| ATP synthase F0 subunit C [Karlodinium micrum] Length = 130 Score = 41.8 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + +G A + +F + G RNP T LI E L + ++++ Sbjct: 64 LGCAITMVAVGGCAQGIGQLFAALVVGMARNPSMKEDLFTYTLIGMGFLEFLAIVVIMMA 123 Query: 85 MLLLF 89 LLL+ Sbjct: 124 GLLLY 128 >gi|34763447|ref|ZP_00144394.1| ATP synthase C chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|237742363|ref|ZP_04572844.1| ATP synthase subunit C [Fusobacterium sp. 4_1_13] gi|256845691|ref|ZP_05551149.1| ATP synthase F0, C subunit [Fusobacterium sp. 3_1_36A2] gi|294785062|ref|ZP_06750350.1| ATP synthase C chain, sodium ion specific, Lipid-binding protein [Fusobacterium sp. 3_1_27] gi|27886888|gb|EAA24013.1| ATP synthase C chain, sodium ion specific [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|229430011|gb|EEO40223.1| ATP synthase subunit C [Fusobacterium sp. 4_1_13] gi|256719250|gb|EEU32805.1| ATP synthase F0, C subunit [Fusobacterium sp. 3_1_36A2] gi|294486776|gb|EFG34138.1| ATP synthase C chain, sodium ion specific, Lipid-binding protein [Fusobacterium sp. 3_1_27] Length = 89 Score = 41.8 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 30/66 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A + + + R P A + + +++ +AES G++ L++ Sbjct: 16 VGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIA 75 Query: 85 MLLLFV 90 ++LL+ Sbjct: 76 LILLYA 81 >gi|291165814|gb|EFE27862.1| ATP synthase subunit C [Filifactor alocis ATCC 35896] Length = 95 Score = 41.8 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 30/70 (42%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G+A + + R P A +L+ A +AE+ G++ Sbjct: 21 ACSAIGAGLAMIAGIGPGIGQGYAAGKGAEAVGRQPEAQGDIIKTMLLGAAVAETTGIYG 80 Query: 81 LLVVMLLLFV 90 L++ ++L+FV Sbjct: 81 LIIALILIFV 90 >gi|326792684|ref|YP_004310505.1| ATP synthase F0 subunit chi [Clostridium lentocellum DSM 5427] gi|326543448|gb|ADZ85307.1| ATP synthase F0, C subunit [Clostridium lentocellum DSM 5427] Length = 93 Score = 41.8 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A + + R P A S + +L+ A +AE+ G++ Sbjct: 13 LACSAIGAGLAMIAGIGPGIGQGYAAGKGAEAVGRQPEAQSTIVSTMLLGAAVAETTGIY 72 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 73 GLIVAIILLFA 83 >gi|157166467|gb|ABV25236.1| ATP synthase subunit 9 [Silene vulgaris] gi|255708782|gb|ACU30296.1| ATP synthase subunit 9 [Silene uniflora] Length = 56 Score = 41.8 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 25/56 (44%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 G A + A+ + N+F++ + RNP A ++ + E++ LF L Sbjct: 1 GAGAATIASAGSAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|262186757|ref|YP_003276016.1| ATP synthase F0 subunit 9 [Pleurozia purpurea] gi|237780754|gb|ACR19400.1| ATP synthase F0 subunit 9 [Pleurozia purpurea] Length = 75 Score = 41.8 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+F++ + RNP A ++ + E++ F Sbjct: 4 GAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 L++ + FV Sbjct: 64 LMMAFSISFV 73 >gi|193891068|gb|ACF28687.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 41.8 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 33/83 (39%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A FA + A V G A L + N + G R P A + +L Sbjct: 57 AAFADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGNASGRCIDGISRQPEVADDLRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 117 LSLAFMESLTIYGLVIALVLLFA 139 >gi|295101393|emb|CBK98938.1| ATP synthase F0 subcomplex C subunit [Faecalibacterium prausnitzii L2-6] Length = 93 Score = 41.8 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 14/80 (17%), Positives = 31/80 (38%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F +LA + G A + + N R P S + +++ Sbjct: 4 FQFLARGIALAGCGIGAGCALIAGIGPGIGEGNAAAAACEAVGRQPECKSDVTSTLILGV 63 Query: 71 VIAESLGLFLLLVVMLLLFV 90 ++E+ G++ + +LL+F+ Sbjct: 64 ALSETTGIYGFVTGLLLIFL 83 >gi|111283595|gb|ABH09169.1| ATP synthase subunit 9 [Silene vulgaris] gi|111283603|gb|ABH09173.1| ATP synthase subunit 9 [Silene latifolia] Length = 70 Score = 41.8 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLL 87 L++ L+ Sbjct: 64 LMMAFLI 70 >gi|89280728|ref|YP_514662.1| ATP synthase F0 subunit 9 [Oryza sativa Indica Group] gi|74100095|gb|AAZ99259.1| ATP synthase F0 subunit 9 [Oryza sativa Indica Group] gi|74100204|gb|AAZ99366.1| ATP synthase F0 subunit 9 [Oryza sativa Japonica Group] Length = 75 Score = 41.8 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|19703705|ref|NP_603267.1| F0F1 ATP synthase subunit C [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|237739742|ref|ZP_04570223.1| F0F1 ATP synthase subunit C [Fusobacterium sp. 2_1_31] gi|262066574|ref|ZP_06026186.1| ATP synthase C chain, sodium ion specific [Fusobacterium periodonticum ATCC 33693] gi|294783128|ref|ZP_06748452.1| ATP synthase C chain, sodium ion specific, Lipid-binding protein [Fusobacterium sp. 1_1_41FAA] gi|296327991|ref|ZP_06870526.1| ATP synthase F0 sector subunit C [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] gi|81763577|sp|Q8RGD7|ATPL_FUSNN RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|19713829|gb|AAL94566.1| ATP synthase C chain, sodium ion specific [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|229423350|gb|EEO38397.1| F0F1 ATP synthase subunit C [Fusobacterium sp. 2_1_31] gi|291379709|gb|EFE87227.1| ATP synthase C chain, sodium ion specific [Fusobacterium periodonticum ATCC 33693] gi|294480006|gb|EFG27783.1| ATP synthase C chain, sodium ion specific, Lipid-binding protein [Fusobacterium sp. 1_1_41FAA] gi|296154947|gb|EFG95729.1| ATP synthase F0 sector subunit C [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] Length = 89 Score = 41.8 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 30/66 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A + + + R P A + + +++ +AES G++ L++ Sbjct: 16 VGAGLAMIAGLGPGIGEGYAAGKAVESVARQPEARGSIISTMILGQAVAESTGIYSLVIA 75 Query: 85 MLLLFV 90 ++LL+ Sbjct: 76 LILLYA 81 >gi|164421076|ref|YP_001648621.1| ATP synthase F0 subunit 9 [Agelas schmidti] gi|158938991|gb|ABW83914.1| ATP synthase F0 subunit 9 [Agelas schmidti] Length = 78 Score = 41.8 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 8 AAKFVGAGAASIGAAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMMAFLILF 76 >gi|160942710|ref|ZP_02089952.1| hypothetical protein FAEPRAM212_00186 [Faecalibacterium prausnitzii M21/2] gi|158445984|gb|EDP22987.1| hypothetical protein FAEPRAM212_00186 [Faecalibacterium prausnitzii M21/2] gi|295104096|emb|CBL01640.1| ATP synthase F0 subcomplex C subunit [Faecalibacterium prausnitzii SL3/3] Length = 93 Score = 41.4 bits (96), Expect = 0.037, Method: Composition-based stats. Identities = 14/80 (17%), Positives = 31/80 (38%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F +LA + G A + + N R P S + +++ Sbjct: 4 FQYLARGIALAGCGIGAGCALIAGIGPGIGEGNAAAAACEAVGRQPECKSDVTSTLILGV 63 Query: 71 VIAESLGLFLLLVVMLLLFV 90 ++E+ G++ + +LL+F+ Sbjct: 64 ALSETTGIYGFVTGLLLIFL 83 >gi|253579152|ref|ZP_04856422.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251849250|gb|EES77210.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 92 Score = 41.4 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 18/80 (22%), Positives = 31/80 (38%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F +LA + G A + + N L R P + +L+ Sbjct: 3 FQLLAKGIALAGCAIGAGCALIAGIGPGIGEGNAVAKALEAIGRQPECKGDVTSTMLLGC 62 Query: 71 VIAESLGLFLLLVVMLLLFV 90 IAE+ G++ + +LL+FV Sbjct: 63 AIAETTGIYGFVTGLLLIFV 82 >gi|302669535|ref|YP_003829495.1| ATP synthase F0 C subunit AtpE1 [Butyrivibrio proteoclasticus B316] gi|302394008|gb|ADL32913.1| ATP synthase F0 C subunit AtpE1 [Butyrivibrio proteoclasticus B316] Length = 93 Score = 41.4 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 30/80 (37%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F +LA + G A + + + L R P +L+ Sbjct: 4 FQMLAKGIALAGCGIGAGCALIAGIGPGIGEGTAVSKALEAIGRQPECKGDVTGTMLLGC 63 Query: 71 VIAESLGLFLLLVVMLLLFV 90 +AE+ G++ + +LL+FV Sbjct: 64 AVAETTGIYGFVTGLLLIFV 83 >gi|319997208|gb|ADV91198.1| mitochondrial ATP synthase F0 lipid binding subunit-like protein 3 [Karlodinium micrum] Length = 130 Score = 41.4 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + +G A + +F + G RNP T LI E L + ++++ Sbjct: 64 LGCAITMVAVGGCAQGIGQLFAALVVGMARNPSMKEDLFTYTLIGMGFLEFLAIVVIMMA 123 Query: 85 MLLLF 89 LLL+ Sbjct: 124 GLLLY 128 >gi|295098947|emb|CBK88036.1| ATP synthase F0 subcomplex C subunit [Eubacterium cylindroides T2-87] Length = 81 Score = 41.4 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 16/76 (21%), Positives = 36/76 (47%) Query: 15 NGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAE 74 N ++ + G+A + + RNP AAS ++ +++ +AE Sbjct: 4 NEFFVQGMALLGAGIAMVAGLGQGIGQGFAAGKGAESVARNPEAASKIQSIMVLGIALAE 63 Query: 75 SLGLFLLLVVMLLLFV 90 + G++ L++ +LL+F+ Sbjct: 64 TTGIYSLVIAILLIFI 79 >gi|153809942|ref|ZP_01962610.1| hypothetical protein RUMOBE_00323 [Ruminococcus obeum ATCC 29174] gi|149834120|gb|EDM89200.1| hypothetical protein RUMOBE_00323 [Ruminococcus obeum ATCC 29174] gi|295109098|emb|CBL23051.1| ATP synthase F0 subcomplex C subunit [Ruminococcus obeum A2-162] Length = 92 Score = 41.4 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 18/80 (22%), Positives = 32/80 (40%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F +LA + G A + + N + L R P + +L+ Sbjct: 3 FQLLAKGIALAGCAIGAGCALIAGIGPGIGEGNAVASALEAIGRQPECKGDVTSTMLLGC 62 Query: 71 VIAESLGLFLLLVVMLLLFV 90 IAE+ G++ + +LL+FV Sbjct: 63 AIAETTGIYGFVTGLLLIFV 82 >gi|220983459|dbj|BAH11228.1| ATP synthase CF0 C chain [Welwitschia mirabilis] Length = 112 Score = 41.4 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + L G R P A + +L+ E+L ++ Sbjct: 38 AASVIAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIY 97 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 98 GLVVALALLFA 108 >gi|11466528|ref|NP_044777.1| ATP synthase F0 subunit 9 [Reclinomonas americana] gi|2258358|gb|AAD11892.1| ATP synthase F0 subunit 9 [Reclinomonas americana] Length = 75 Score = 41.4 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 36/70 (51%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G A +G+ + +F ++ RNP ++ L+ + E++ LF Sbjct: 5 AAKLIGAGCATIGLAGAGAGIGTVFGALVTAIARNPSQFKQLQSSALLGFALTEAIALFA 64 Query: 81 LLVVMLLLFV 90 L+VV LLLFV Sbjct: 65 LMVVFLLLFV 74 >gi|197107666|gb|ACH42413.1| ATP synthase subunit 9 [Padina pavonica] Length = 56 Score = 41.4 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 23/56 (41%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + + + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTVLGALVLGTARNPSLKDELFRIAILGFALTEAIALF 56 >gi|224543575|ref|ZP_03684114.1| hypothetical protein CATMIT_02784 [Catenibacterium mitsuokai DSM 15897] gi|224523502|gb|EEF92607.1| hypothetical protein CATMIT_02784 [Catenibacterium mitsuokai DSM 15897] Length = 75 Score = 41.4 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 34/66 (51%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 +A G+A L + + +S RNP A S +T +++ + E++ L+ LL+ Sbjct: 8 IAAGIAVLAGLGTGIGEGLVAAHAVSAIGRNPEAESKIRTTMILGIALTETVALYGLLIS 67 Query: 85 MLLLFV 90 +LLFV Sbjct: 68 FILLFV 73 >gi|157093153|gb|ABV22231.1| unknown [Karlodinium micrum] Length = 130 Score = 41.4 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 27/65 (41%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + +G + +F + G RNP T LI E L + ++++ Sbjct: 64 LGCAITMVAVGGCVQGIGQLFAALVVGMARNPSMKEDLFTYTLIGMGFLEFLAIVVIMMA 123 Query: 85 MLLLF 89 LLL+ Sbjct: 124 GLLLY 128 >gi|325662856|ref|ZP_08151425.1| hypothetical protein HMPREF0490_02165 [Lachnospiraceae bacterium 4_1_37FAA] gi|331086572|ref|ZP_08335650.1| hypothetical protein HMPREF0987_01953 [Lachnospiraceae bacterium 9_1_43BFAA] gi|325470908|gb|EGC74137.1| hypothetical protein HMPREF0490_02165 [Lachnospiraceae bacterium 4_1_37FAA] gi|330410405|gb|EGG89837.1| hypothetical protein HMPREF0987_01953 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 88 Score = 41.4 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 20/77 (25%), Positives = 34/77 (44%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 N LA + G+A + + S RNP A S + +L+ +A Sbjct: 5 TNEALILACSAIGAGLAMIAGIGPGIGQGVAAGHGASAVGRNPGAKSDITSTMLLGQAVA 64 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ L++ ++LLF Sbjct: 65 ETTGLYGLVIALILLFA 81 >gi|13357693|ref|NP_077967.1| ATP synthase C chain [Ureaplasma parvum serovar 3 str. ATCC 700970] gi|167972129|ref|ZP_02554406.1| ATP synthase F0, C subunit family protein [Ureaplasma parvum serovar 6 str. ATCC 27818] gi|168282254|ref|ZP_02689921.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] gi|168308404|ref|ZP_02691079.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] gi|170762112|ref|YP_001752219.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] gi|17367034|sp|Q9PR08|ATPL_UREPA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487685|sp|B1AIC5|ATPL_UREP2 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|11356744|pir||G82929 ATP synthase C chain UU136 [imported] - Ureaplasma urealyticum gi|6899095|gb|AAF30542.1|AE002114_9 ATP synthase C chain [Ureaplasma parvum serovar 3 str. ATCC 700970] gi|168827689|gb|ACA32951.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 3 str. ATCC 27815] gi|171902625|gb|EDT48914.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 1 str. ATCC 27813] gi|182675799|gb|EDT87704.1| ATP synthase F0, C subunit [Ureaplasma parvum serovar 14 str. ATCC 33697] gi|186700696|gb|EDU18978.1| ATP synthase F0, C subunit family protein [Ureaplasma parvum serovar 6 str. ATCC 27818] Length = 109 Score = 41.4 bits (96), Expect = 0.046, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 34/69 (49%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 KY+ G+ L G V L + RNP A + +++ +AE++ ++ L Sbjct: 40 GKYIGTGITMLAAGAVGLMQGFSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYAL 99 Query: 82 LVVMLLLFV 90 +V +L++FV Sbjct: 100 IVSILIIFV 108 >gi|197107664|gb|ACH42412.1| ATP synthase subunit 9 [Notheia anomala] Length = 56 Score = 41.4 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 23/56 (41%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RNP ++ + E++ F Sbjct: 1 LLGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKEELIRIAILGFALTEAIAHF 56 >gi|164421015|ref|YP_001648536.1| ATP synthase F0 subunit 9 [Iotrochota birotulata] gi|158938945|gb|ABW83871.1| ATP synthase F0 subunit 9 [Iotrochota birotulata] Length = 78 Score = 41.4 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 22/69 (31%), Positives = 35/69 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK+V G A +G G + +F + G RNP T ++ I+E++GLF Sbjct: 8 GAKFVGAGAASIGAGGSGAGIGTVFGNLIIGYARNPALKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLF 89 L++ L+LF Sbjct: 68 LMIAFLILF 76 >gi|107735861|ref|YP_626448.1| ATP synthase F0 subunit 9 [Metarhizium anisopliae] gi|57904563|gb|AAW58818.1| ATP synthase F0 subunit 9 [Metarhizium anisopliae] Length = 74 Score = 41.4 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 37/70 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 ++K + G+A +G+ + + +F + G RNP + T ++ +E+ LF Sbjct: 4 SSKILGAGLATVGVAGAGVGIGVVFGCLILGVARNPSLKNQLFTYSILGFAFSEATALFA 63 Query: 81 LLVVMLLLFV 90 L++ +LLLFV Sbjct: 64 LMMSLLLLFV 73 >gi|70955246|gb|AAZ16249.1| ATP synthase subunit 9 [Brassica oleracea] Length = 74 Score = 41.0 bits (95), Expect = 0.049, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + R P A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARXPSLAKQSFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+LFV Sbjct: 64 PMMAFLILFV 73 >gi|257438175|ref|ZP_05613930.1| ATP synthase F0, C subunit [Faecalibacterium prausnitzii A2-165] gi|313112904|ref|ZP_07798550.1| ATP synthase F0, C subunit [Faecalibacterium cf. prausnitzii KLE1255] gi|257199374|gb|EEU97658.1| ATP synthase F0, C subunit [Faecalibacterium prausnitzii A2-165] gi|310624809|gb|EFQ08118.1| ATP synthase F0, C subunit [Faecalibacterium cf. prausnitzii KLE1255] Length = 93 Score = 41.0 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 14/80 (17%), Positives = 31/80 (38%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 F +LA + G A + + N R P S + +++ Sbjct: 4 FQYLARGIALAGCGIGAGCALIAGIGPGIGEGNAAAAACEAVGRQPECKSDVTSTLILGV 63 Query: 71 VIAESLGLFLLLVVMLLLFV 90 ++E+ G++ + +LL+F+ Sbjct: 64 ALSETTGIYGFVTGLLLIFL 83 >gi|320527150|ref|ZP_08028337.1| putative F0F1 ATP synthase subunit C [Solobacterium moorei F0204] gi|320132478|gb|EFW25021.1| putative F0F1 ATP synthase subunit C [Solobacterium moorei F0204] Length = 74 Score = 41.0 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 32/66 (48%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L L + +NP A S ++ +++ ++E+ ++ LLV Sbjct: 8 IGAGIAVFTGFLTGLGEGTVAAHACDAIGKNPEAESKIRSTMILGIALSETCAIYGLLVS 67 Query: 85 MLLLFV 90 +LL+FV Sbjct: 68 ILLIFV 73 >gi|237736345|ref|ZP_04566826.1| F0F1 ATP synthase subunit C [Fusobacterium mortiferum ATCC 9817] gi|229421387|gb|EEO36434.1| F0F1 ATP synthase subunit C [Fusobacterium mortiferum ATCC 9817] Length = 90 Score = 41.0 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA V VG A + + + R P A + +++ ++ES G++ Sbjct: 12 LAASAVGVGCAMIAGLGPGIGEGYAAGKAVESVARQPEAKGDIISTMILGQAVSESTGIY 71 Query: 80 LLLVVMLLLFV 90 L+V ++L++ Sbjct: 72 SLVVSLILMYA 82 >gi|293364108|ref|ZP_06610843.1| ATP synthase F0, C subunit [Mycoplasma alligatoris A21JP2] gi|292552333|gb|EFF41108.1| ATP synthase F0, C subunit [Mycoplasma alligatoris A21JP2] Length = 103 Score = 41.0 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V +G + +G+ RNP A S ++ +++ IAES ++ LL+ Sbjct: 36 VGIGASMIGVLGTGAGQGYAAGKAAEAVGRNPEAESKIRSMMIVGMAIAESSAIYSLLIA 95 Query: 85 MLLLFV 90 +LL FV Sbjct: 96 ILLFFV 101 >gi|193891039|gb|ACF28673.1| chloroplast ATP synthase [Amphidinium carterae] gi|193891043|gb|ACF28675.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 41.0 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A FA + A V G A L + + G R P A + +L Sbjct: 57 AAFADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 117 LSLAFMESLTIYGLVIALVLLFA 139 >gi|169351556|ref|ZP_02868494.1| hypothetical protein CLOSPI_02336 [Clostridium spiroforme DSM 1552] gi|169291778|gb|EDS73911.1| hypothetical protein CLOSPI_02336 [Clostridium spiroforme DSM 1552] Length = 77 Score = 41.0 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 +A G+A + + + RNP A +T +++ + E++ ++ LL+ Sbjct: 9 IAAGIAVCAGLGTGIGEGICASKAVEAIGRNPEAEGKIRTTMILGIALTETVAIYGLLIS 68 Query: 85 MLLLFV 90 LLLFV Sbjct: 69 FLLLFV 74 >gi|319997204|gb|ADV91196.1| mitochondrial ATP synthase F0 lipid binding subunit-like protein 1 [Karlodinium micrum] gi|319997214|gb|ADV91201.1| mitochondrial ATP synthase F0 lipid binding subunit-like protein 6 [Karlodinium micrum] Length = 129 Score = 41.0 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + +G A + +F + G RNP T LI E L + ++++ Sbjct: 63 LGCAITMVAVGGCAQGIGQLFAALVVGMARNPSMKEDLFTYTLIGMGFLEFLAIVVIMMA 122 Query: 85 MLLLF 89 LLL+ Sbjct: 123 GLLLY 127 >gi|164420800|ref|YP_001648468.1| ATP synthase F0 subunit 9 [Ephydatia muelleri] gi|284794664|ref|YP_003412022.1| ATP synthase F0 subunit 9 [Lubomirskia baicalensis] gi|158938916|gb|ABW83844.1| ATP synthase F0 subunit 9 [Ephydatia muelleri] gi|284098133|gb|ADB78064.1| ATP synthase F0 subunit 9 [Lubomirskia baicalensis] Length = 78 Score = 41.0 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK+V G A +G + +F + G RNP T ++ I+E++GLF Sbjct: 8 AAKFVGAGAATIGAAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|223983275|ref|ZP_03633468.1| hypothetical protein HOLDEFILI_00748 [Holdemania filiformis DSM 12042] gi|223964768|gb|EEF69087.1| hypothetical protein HOLDEFILI_00748 [Holdemania filiformis DSM 12042] Length = 76 Score = 41.0 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 33/66 (50%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A + + + + + RNP A ++ +++ ++E+ ++ LLV Sbjct: 10 IGAGLAVMTGMMTGIGEGFVAGKAVEAIGRNPEAEGKIRSTMILGIALSETCAIYGLLVA 69 Query: 85 MLLLFV 90 +LL+FV Sbjct: 70 ILLIFV 75 >gi|194333723|ref|YP_002015583.1| alternate F1F0 ATPase F0 subunit C [Prosthecochloris aestuarii DSM 271] gi|194311541|gb|ACF45936.1| alternate F1F0 ATPase, F0 subunit C [Prosthecochloris aestuarii DSM 271] Length = 95 Score = 41.0 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A V G+ +G AL ++ L+ + P AA+ + I + ES+ ++ Sbjct: 12 ASIVTAGLTTAIGCIGPALGEGRAVSSALTSLAQQPDAAATITRTLFIGLAMVESVAIYC 71 Query: 81 LLVVMLLLFV 90 ++ M+L+F Sbjct: 72 FVISMILIFA 81 >gi|197107676|gb|ACH42418.1| ATP synthase subunit 9 [Punctaria latifolia] Length = 56 Score = 41.0 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 23/56 (41%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + F + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTAFGALVLGTARNPSLKDEMFRIAILGFALTEAIALF 56 >gi|118445005|ref|YP_879001.1| F0F1 ATP synthase subunit C [Clostridium novyi NT] gi|168185927|ref|ZP_02620562.1| ATP synthase F0 subunit c [Clostridium botulinum C str. Eklund] gi|253681121|ref|ZP_04861924.1| ATP synthase F0 subunit c [Clostridium botulinum D str. 1873] gi|331270438|ref|YP_004396930.1| ATP synthase F0 subunit C [Clostridium botulinum BKT015925] gi|224487643|sp|A0Q2Z9|ATPL_CLONN RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|118135461|gb|ABK62505.1| ATP synthase F0 subunit c [Clostridium novyi NT] gi|169296143|gb|EDS78276.1| ATP synthase F0 subunit c [Clostridium botulinum C str. Eklund] gi|253562970|gb|EES92416.1| ATP synthase F0 subunit c [Clostridium botulinum D str. 1873] gi|329126988|gb|AEB76933.1| ATP synthase F0, C subunit [Clostridium botulinum BKT015925] Length = 84 Score = 41.0 bits (95), Expect = 0.060, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 31/67 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A + + N + G R P A+ + ++I + ++E+ ++ L+ Sbjct: 14 IGAGLASIACIGGGIGTGNATAKAVEGVSRQPEASGKILSTMIIGSALSEATAIYGFLIA 73 Query: 85 MLLLFVI 91 +LL+ I Sbjct: 74 ILLVLKI 80 >gi|291561949|emb|CBL40756.1| ATP synthase F0 subcomplex C subunit [butyrate-producing bacterium SS3/4] Length = 84 Score = 41.0 bits (95), Expect = 0.061, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G+A + + S RNP A S + +L+ +AE+ GL+ Sbjct: 11 ACSAIGAGIAMIAGIGPGVGQGIAAGFGASAVGRNPGAKSDITSTMLLGQAVAETTGLYG 70 Query: 81 LLVVMLLLFV 90 L+V ++L+FV Sbjct: 71 LVVAIILMFV 80 >gi|320160463|ref|YP_004173687.1| ATP synthase subunit C [Anaerolinea thermophila UNI-1] gi|319994316|dbj|BAJ63087.1| ATP synthase C chain [Anaerolinea thermophila UNI-1] Length = 78 Score = 40.6 bits (94), Expect = 0.064, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 36/71 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G++ +G + + L G RNP T +++ +E++ ++ Sbjct: 8 AAKFIGAGLSMIGALGAGIGIGLSVQGALEGMARNPDTYGNLLTNMILGIAFSEAIAIYC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LFV+ Sbjct: 68 LVIAFLMLFVL 78 >gi|74100150|gb|AAZ99313.1| ATP synthase F0 subunit 9 [Oryza sativa Japonica Group] Length = 74 Score = 40.6 bits (94), Expect = 0.065, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 33/70 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|150388188|ref|YP_001318237.1| F0F1 ATP synthase subunit C [Alkaliphilus metalliredigens QYMF] gi|149948050|gb|ABR46578.1| ATP synthase F0, C subunit [Alkaliphilus metalliredigens QYMF] Length = 88 Score = 40.6 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA + G+A + + G R P A +L+ A +AE+ G++ Sbjct: 11 LAASAIGAGLAMIAGIGPGIGQGYAAGKGAEGVGRQPEAQGDIVRTMLLGAAVAETTGIY 70 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 71 GLIIALILLFA 81 >gi|88807377|ref|ZP_01122889.1| ATP synthase subunit C [Synechococcus sp. WH 7805] gi|88788591|gb|EAR19746.1| ATP synthase subunit C [Synechococcus sp. WH 7805] Length = 113 Score = 40.6 bits (94), Expect = 0.068, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 53 IGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 108 >gi|119599457|gb|EAW79051.1| hCG2040185 [Homo sapiens] Length = 92 Score = 40.6 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 15/80 (18%), Positives = 32/80 (40%), Gaps = 10/80 (12%) Query: 21 AAKYVAVGMACLGMG---------LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 AAK++ G +G+ ++ + + +P ++ Sbjct: 14 AAKFIDAGAITIGVSHHTQPTIVTGSGAGIAMVSGNLIIHYAISPSLKEQLF-YAILDFA 72 Query: 72 IAESLGLFLLLVVMLLLFVI 91 ++E++GLF L V L+LF + Sbjct: 73 LSEAMGLFCLTVTFLILFAM 92 >gi|158321585|ref|YP_001514092.1| F0F1 ATP synthase subunit C [Alkaliphilus oremlandii OhILAs] gi|224487620|sp|A8MJW4|ATPL_ALKOO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|158141784|gb|ABW20096.1| ATP synthase F0, C subunit [Alkaliphilus oremlandii OhILAs] Length = 88 Score = 40.6 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 30/71 (42%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA + G+A + + R P A +L+ +AE+ G++ Sbjct: 11 LAASAIGAGLAMIAGLGPGIGQGIAAGKGAEAVGRQPEAQGDILRTMLLGQAVAETTGIY 70 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 71 SLVIALILLFA 81 >gi|309775239|ref|ZP_07670249.1| ATP synthase F0, C subunit [Erysipelotrichaceae bacterium 3_1_53] gi|308916991|gb|EFP62721.1| ATP synthase F0, C subunit [Erysipelotrichaceae bacterium 3_1_53] Length = 81 Score = 40.6 bits (94), Expect = 0.072, Method: Composition-based stats. Identities = 16/75 (21%), Positives = 35/75 (46%) Query: 15 NGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAE 74 N Y+ + G+A + + + RNP AA ++ +++ +AE Sbjct: 4 NEYFVQGMALLGAGIAMIAGLGPGIGQGIAASKGAESVGRNPDAAGKVRSIMVLGIALAE 63 Query: 75 SLGLFLLLVVMLLLF 89 + G++ L+V ++L+F Sbjct: 64 TTGIYALIVALILIF 78 >gi|293115408|ref|ZP_06604499.1| ATP synthase C chain, sodium ion specific [Butyrivibrio crossotus DSM 2876] gi|292810155|gb|EFF69360.1| ATP synthase C chain, sodium ion specific [Butyrivibrio crossotus DSM 2876] Length = 104 Score = 40.6 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A + + + RNP A S + +L+ +AE+ GL+ Sbjct: 27 LACSAIGAGLAMIAGLGPGIGQGIAAGHAAAAVGRNPGAKSDITSTMLLGQAVAETTGLY 86 Query: 80 LLLVVMLLLFV 90 V ++LLF Sbjct: 87 GFAVAIILLFA 97 >gi|20091267|ref|NP_617342.1| F0F1 ATP synthase subunit C [Methanosarcina acetivorans C2A] gi|19916389|gb|AAM05822.1| H(+)-transporting ATP synthase, subunit C [Methanosarcina acetivorans C2A] Length = 91 Score = 40.6 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 28/59 (47%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ A+ T LS + P A++ + + + ESL ++ +V M+L+F Sbjct: 24 IGVLGPAIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLSIYCFVVSMILIFA 82 >gi|125213989|dbj|BAF46417.1| ATP synthase subunit 9 [Rhodotorula glutinis] Length = 68 Score = 40.6 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAKY+ G+A +G+ + + +F+ ++ A + ++ ++E+ GLF Sbjct: 4 AAKYIGSGLATIGLAGAGVGIGVVFSGLITA-----TAHWQLFSYAILGFALSEATGLFA 58 Query: 81 LLVVMLLLF 89 L++ LLL+ Sbjct: 59 LMMSFLLLY 67 >gi|313899127|ref|ZP_07832652.1| ATP synthase F0, C subunit [Clostridium sp. HGF2] gi|312956067|gb|EFR37710.1| ATP synthase F0, C subunit [Clostridium sp. HGF2] Length = 81 Score = 40.6 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 16/75 (21%), Positives = 35/75 (46%) Query: 15 NGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAE 74 N Y+ + G+A + + + RNP AA ++ +++ +AE Sbjct: 4 NEYFVQGMALLGAGIAMIAGLGPGIGQGIAASKGAESVGRNPDAAGKIRSIMVLGIALAE 63 Query: 75 SLGLFLLLVVMLLLF 89 + G++ L+V ++L+F Sbjct: 64 TTGIYALIVALILIF 78 >gi|259017966|gb|ACV89571.1| ATP synthetase subunit 9 [Caulocystis uvifera] Length = 55 Score = 40.6 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 23/55 (41%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + +F + G RN ++ + E++ LF Sbjct: 1 LGAGLATIGLAGAGVGIGTVFGALVLGTARNSSLRDELFRIAILGFALTEAIALF 55 >gi|168333939|ref|ZP_02692171.1| ATP synthase F0, C subunit [Epulopiscium sp. 'N.t. morphotype B'] Length = 87 Score = 40.6 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A + + R P A S +L+ A +AE+ G++ Sbjct: 10 LACSAIGAGLAMIAGIGPGIGQGYAAGKGAEAVGRQPEAQSDVVRTMLLGAAVAETTGIY 69 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 70 GLIVAIILLFA 80 >gi|193891057|gb|ACF28682.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 40.6 bits (94), Expect = 0.079, Method: Composition-based stats. Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A FA + A V G A L + + G R P A + +L Sbjct: 57 AAFADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 117 LSLAFMESLTIYGLVIALVLLFA 139 >gi|193216467|ref|YP_001999709.1| ATP synthase C chain [Mycoplasma arthritidis 158L3-1] gi|224487652|sp|B3PLV3|ATPL_MYCA5 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|193001790|gb|ACF07005.1| ATP synthase C chain [Mycoplasma arthritidis 158L3-1] Length = 90 Score = 40.6 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 36/67 (53%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 VA G+A +G G+V++ + RNP A S ++ +++ I E+ ++ ++ Sbjct: 24 MVAAGLAIMGAGVVSVGQGMAVAKAVEAIGRNPEATSKIRSTLIMGLAIVETASIYCFII 83 Query: 84 VMLLLFV 90 +L++FV Sbjct: 84 ALLIIFV 90 >gi|47459049|ref|YP_015911.1| ATP synthase c chain [Mycoplasma mobile 163K] gi|81614341|sp|Q6KI76|ATPL_MYCMO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|47458378|gb|AAT27700.1| ATP synthase c chain [Mycoplasma mobile 163K] Length = 99 Score = 40.6 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G L RNP A + + ++I IAE+ ++ L++ Sbjct: 33 VGAGLAMIGALGTGLGQGVSAGKAAEAVGRNPEAEAKIRLMMIIGMGIAETAAIYSLIIA 92 Query: 85 MLLLFV 90 +LL+FV Sbjct: 93 ILLIFV 98 >gi|253582457|ref|ZP_04859679.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725] gi|257470706|ref|ZP_05634796.1| F0F1 ATP synthase subunit C [Fusobacterium ulcerans ATCC 49185] gi|317064911|ref|ZP_07929396.1| F0F1 ATP synthase subunit C [Fusobacterium ulcerans ATCC 49185] gi|251835602|gb|EES64141.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725] gi|313690587|gb|EFS27422.1| F0F1 ATP synthase subunit C [Fusobacterium ulcerans ATCC 49185] Length = 90 Score = 40.6 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA + G A + + + R P A + +++ +AES G++ Sbjct: 12 LAASAIGAGCAMIAGLGPGIGEGYAAGKAVEAVARQPEAKGNIISTMILGQAVAESTGIY 71 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 72 SLVIALILLYA 82 >gi|164420976|ref|YP_001648598.1| ATP synthase F0 subunit 9 [Xestospongia muta] gi|158938981|gb|ABW83905.1| ATP synthase F0 subunit 9 [Xestospongia muta] Length = 78 Score = 40.2 bits (93), Expect = 0.083, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G + +F + + G RNP T ++ ++E++GLF Sbjct: 8 AAKFIGSGAATIGAAGSGAGIGIVFGSLIIGYARNPSLKQQLFTYAIMGFALSEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|164420961|ref|YP_001648528.1| ATP synthase F0 subunit 9 [Callyspongia plicifera] gi|158668100|gb|ABW76562.1| ATP synthase F0 subunit 9 [Callyspongia plicifera] Length = 78 Score = 40.2 bits (93), Expect = 0.083, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G + +F + + G RNP T ++ ++E++GLF Sbjct: 8 AAKFIGSGAATIGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAIMGFALSEAMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|291521325|emb|CBK79618.1| ATP synthase F0 subcomplex C subunit [Coprococcus catus GD/7] Length = 88 Score = 40.2 bits (93), Expect = 0.085, Method: Composition-based stats. Identities = 19/77 (24%), Positives = 32/77 (41%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 N LA + G+A + + S RNP A +L+ +A Sbjct: 5 TNEGLVLACSAIGAGLAVIAGIGPGVGQGIAAGHGASAVGRNPGAKGDIMQTMLLGQAVA 64 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ L++ ++LLF Sbjct: 65 ETTGLYGLVIALILLFA 81 >gi|315092946|gb|EFT64922.1| putative ATP synthase F0, C subunit [Propionibacterium acnes HL060PA1] Length = 73 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L AL V+ IF ++G R P A A T I + E+L LF ++ ++ Sbjct: 17 LATVGPALGVAWIFAAVINGTARQPEARPAMMTTAFIGFAVVEALALFGFVLAFIV 72 >gi|282853797|ref|ZP_06263134.1| ATP synthase F0, C subunit [Propionibacterium acnes J139] gi|282583250|gb|EFB88630.1| ATP synthase F0, C subunit [Propionibacterium acnes J139] gi|314923489|gb|EFS87320.1| ATP synthase F0, C subunit [Propionibacterium acnes HL001PA1] gi|314966534|gb|EFT10633.1| ATP synthase F0, C subunit [Propionibacterium acnes HL082PA2] gi|314981459|gb|EFT25553.1| ATP synthase F0, C subunit [Propionibacterium acnes HL110PA3] gi|315092123|gb|EFT64099.1| ATP synthase F0, C subunit [Propionibacterium acnes HL110PA4] gi|315103533|gb|EFT75509.1| ATP synthase F0, C subunit [Propionibacterium acnes HL050PA2] gi|327327358|gb|EGE69134.1| ATP synthase F0, C subunit [Propionibacterium acnes HL103PA1] Length = 73 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L AL V+ IF ++G R P A A T I + E+L LF ++ ++ Sbjct: 17 LATLGPALGVAWIFAAVINGTARQPEARPAMMTTAFIGFAVVEALALFGFVLAFIV 72 >gi|77917634|ref|YP_355449.1| ATP synthase F0 subunit C [Pelobacter carbinolicus DSM 2380] gi|123756710|sp|Q3A8L3|ATPL1_PELCD RecName: Full=ATP synthase subunit c 1; AltName: Full=ATP synthase F(0) sector subunit c 1; AltName: Full=F-type ATPase subunit c 1; Short=F-ATPase subunit c 1; AltName: Full=Lipid-binding protein 1 gi|77543717|gb|ABA87279.1| ATP synthase F0 subcomplex C subunit [Pelobacter carbinolicus DSM 2380] Length = 88 Score = 40.2 bits (93), Expect = 0.090, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 G A+ + L G RNP A+ T ++I + ESL +++ +V M++LF Sbjct: 15 MAFGSLGTAIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMVESLAIYVFVVSMIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|312200981|gb|ACB20507.2| ATPase subunit 9 [Carica papaya] Length = 74 Score = 40.2 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 10/49 (20%), Positives = 24/49 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 + + N+F++ + RNP A ++ + E++ LF ++ L+ Sbjct: 22 VGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMAFLI 70 >gi|210613765|ref|ZP_03289879.1| hypothetical protein CLONEX_02086 [Clostridium nexile DSM 1787] gi|210150974|gb|EEA81982.1| hypothetical protein CLONEX_02086 [Clostridium nexile DSM 1787] Length = 88 Score = 40.2 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 19/77 (24%), Positives = 34/77 (44%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 N LA + G+A + + + RNP A S + +L+ +A Sbjct: 5 TNEALILACSAIGAGLAMIAGIGPGIGQGVAAGHGAAAVGRNPGAKSDITSTMLLGQAVA 64 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ L++ ++LLF Sbjct: 65 ETTGLYSLVIALILLFA 81 >gi|57013931|ref|YP_173404.1| ATP synthase F0 subunit 9 [Nicotiana tabacum] gi|13078|emb|CAA38272.1| unnamed protein product [Solanum lycopersicum] gi|13149|emb|CAA27644.1| unnamed protein product [Nicotiana tabacum] gi|13324|emb|CAA28189.1| unnamed protein product [Petunia x hybrida] gi|297835|emb|CAA45155.1| ATP synthase (ATPase) subunit 9 [Solanum tuberosum] gi|447802|prf||1915346B ATP synthase:SUBUNIT=9 Length = 77 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 24/52 (46%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N+ ++ + RNP A ++ + E++ F ++ L+ FV Sbjct: 22 IGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIASFAPMMAFLISFV 73 >gi|77918560|ref|YP_356375.1| ATP synthase F0 subunit C [Pelobacter carbinolicus DSM 2380] gi|123743062|sp|Q3A602|ATPL2_PELCD RecName: Full=ATP synthase subunit c 2; AltName: Full=ATP synthase F(0) sector subunit c 2; AltName: Full=F-type ATPase subunit c 2; Short=F-ATPase subunit c 2; AltName: Full=Lipid-binding protein 2 gi|77544643|gb|ABA88205.1| ATP synthase F0 subcomplex C subunit [Pelobacter carbinolicus DSM 2380] Length = 88 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G + + L G RNP A+ T ++I + ESL +++ +V M++LF Sbjct: 15 MAIGSLGTGIGQGLAVKSALEGVARNPGASGKILTTMMIGLAMIESLAIYVFVVAMIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|313837669|gb|EFS75383.1| ATP synthase subunit C [Propionibacterium acnes HL037PA2] gi|314927450|gb|EFS91281.1| ATP synthase subunit C [Propionibacterium acnes HL044PA1] gi|314972608|gb|EFT16705.1| ATP synthase subunit C [Propionibacterium acnes HL037PA3] gi|328907535|gb|EGG27301.1| ATP synthase F0, C subunit [Propionibacterium sp. P08] Length = 73 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 26/56 (46%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L AL V+ IF ++G R P A A + I + E+L LF ++ ++ Sbjct: 17 LATLGPALGVAWIFAAVINGTARQPEARPAMMSTAFIGFAVVEALALFGFVLAFIV 72 >gi|111283597|gb|ABH09170.1| ATP synthase subunit 9 [Silene vulgaris] Length = 70 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+F++ + RNP A ++ + E++ LF Sbjct: 4 GAKSIGAGAATIASAGAAIGIGNVFSSLIRSVARNPSLAKLLFGYAILGFALTEAIALFA 63 Query: 81 LLVVMLL 87 L++ L+ Sbjct: 64 LMMAFLI 70 >gi|159904115|ref|YP_001551459.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9211] gi|159889291|gb|ABX09505.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Prochlorococcus marinus str. MIT 9211] Length = 111 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A LG + + + G R P A + +L+ ESL ++ Sbjct: 36 AASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIY 95 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 96 GLVVALVLLFA 106 >gi|308189780|ref|YP_003922711.1| ATP synthase C chain [Mycoplasma fermentans JER] gi|319776998|ref|YP_004136649.1| ATP synthase subunit c [Mycoplasma fermentans M64] gi|307624522|gb|ADN68827.1| ATP synthase C chain [Mycoplasma fermentans JER] gi|318038073|gb|ADV34272.1| ATP synthase subunit c [Mycoplasma fermentans M64] Length = 78 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G+A LG L RNP AA+ ++ +LI +AES ++ L+V Sbjct: 10 IGIGIAMLGSFGTGLGQGLAAGKATEAVGRNPEAAAKIRSMLLIGQGVAESSAIYCLVVA 69 Query: 85 MLLLFV 90 +L F Sbjct: 70 FILAFA 75 >gi|193891055|gb|ACF28681.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A FA + A V G A L + + G R P A + +L Sbjct: 57 AAFADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDPRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 117 LSLAFMESLTIYGLVIALVLLFA 139 >gi|317060278|ref|ZP_07924763.1| ATP synthase subunit C [Fusobacterium sp. D12] gi|313685954|gb|EFS22789.1| ATP synthase subunit C [Fusobacterium sp. D12] Length = 90 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + VG+A + + + R P A + +++ +AES G++ Sbjct: 12 LAGSGIGVGLAMIAGLGPGIGEGYAAGKAVEAVARQPEARGNIISTMILGQAVAESTGIY 71 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 72 SLVIALILLYA 82 >gi|164420946|ref|YP_001648459.1| ATP synthase F0 subunit 9 [Amphimedon compressa] gi|158668070|gb|ABW76534.1| ATP synthase F0 subunit 9 [Amphimedon compressa] Length = 78 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 35/71 (49%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G + +F + G RNP T ++ ++E +GLF Sbjct: 8 AAKFIGAGAATIGAAGSGAGIGAVFGNLIIGYARNPSLKQQLFTYAILGFALSEVMGLFC 67 Query: 81 LLVVMLLLFVI 91 L++ L+LF + Sbjct: 68 LMMAFLILFAL 78 >gi|254520288|ref|ZP_05132344.1| predicted protein [Clostridium sp. 7_2_43FAA] gi|226914037|gb|EEH99238.1| predicted protein [Clostridium sp. 7_2_43FAA] Length = 76 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 36/72 (50%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 ++ + + +A L A+ + N + G R P A+ T +++ + AE+ + Sbjct: 2 EISMRALGAAIAVLVGIGAAIGIGNATAKAVEGISRQPEASGKITTALMLGSAFAEATAI 61 Query: 79 FLLLVVMLLLFV 90 + LLV +LL+FV Sbjct: 62 YGLLVSILLIFV 73 >gi|317059387|ref|ZP_07923872.1| ATP synthase subunit C [Fusobacterium sp. 3_1_5R] gi|313685063|gb|EFS21898.1| ATP synthase subunit C [Fusobacterium sp. 3_1_5R] Length = 90 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + VG+A + + + R P A + +++ +AES G++ Sbjct: 12 LAGSGIGVGLAMIAGLGPGIGEGYAAGKAVEAVARQPEARGNIISTMILGQAVAESTGIY 71 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 72 SLVIALILLYA 82 >gi|50364925|ref|YP_053350.1| ATP synthase subunit C [Mesoplasma florum L1] gi|81695704|sp|Q6F207|ATPL_MESFL RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|50363481|gb|AAT75466.1| ATP synthase subunit C [Mesoplasma florum L1] Length = 104 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 34/70 (48%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 K + G+A +G+ + + RNP A + ++I A IAES ++ Sbjct: 34 GLKLLGAGVAIIGVAGAGIGQGAVGQGACMAIGRNPEMAPKITSTMIIAAGIAESGAIYA 93 Query: 81 LLVVMLLLFV 90 L+V +LL+FV Sbjct: 94 LVVAILLIFV 103 >gi|238925248|ref|YP_002938765.1| hypothetical protein EUBREC_2902 [Eubacterium rectale ATCC 33656] gi|238876924|gb|ACR76631.1| Hypothetical protein EUBREC_2902 [Eubacterium rectale ATCC 33656] gi|291524469|emb|CBK90056.1| ATP synthase F0 subcomplex C subunit [Eubacterium rectale DSM 17629] gi|291527488|emb|CBK93074.1| ATP synthase F0 subcomplex C subunit [Eubacterium rectale M104/1] Length = 76 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 29/64 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L L + ++ + R P A S +L+ +AE+ ++ ++ Sbjct: 9 IGAGIAVLTGIGAGLGIGKATSSAVDAIARQPEAESKISKSLLLGCALAEATAIYGFVIA 68 Query: 85 MLLL 88 +L++ Sbjct: 69 LLII 72 >gi|193891045|gb|ACF28676.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A FA + A V G A L + + G R P A + +L Sbjct: 57 AAFADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 117 LSLAFMESLTIYGLVIALVLLFA 139 >gi|289629434|gb|ADD13563.1| ATP synthase F0 subunit 9 [Capsicum annuum] Length = 74 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+ ++ + RNP A ++ + E++ F Sbjct: 4 GAKLMGAGAATIASAGAAIGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 ++ L+LFV Sbjct: 64 PMMAFLILFV 73 >gi|257462631|ref|ZP_05627041.1| F0F1 ATP synthase subunit C [Fusobacterium sp. D12] Length = 91 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + VG+A + + + R P A + +++ +AES G++ Sbjct: 13 LAGSGIGVGLAMIAGLGPGIGEGYAAGKAVEAVARQPEARGNIISTMILGQAVAESTGIY 72 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 73 SLVIALILLYA 83 >gi|310659425|ref|YP_003937146.1| AtpE protein [Clostridium sticklandii DSM 519] gi|308826203|emb|CBH22241.1| AtpE [Clostridium sticklandii] Length = 84 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA + G+A + + R P A S +L+ A +AES G++ Sbjct: 7 LAASAIGAGLAMIAGIGPGIGQGFAAGKGAEAVGRQPEAQSDIVRTMLLGAAVAESTGIY 66 Query: 80 LLLVVMLLLFV 90 L++ +LLLF Sbjct: 67 GLVIALLLLFA 77 >gi|219809121|gb|ACL36052.1| ATPase subunit 9 [Equisetum arvense] Length = 63 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 10/49 (20%), Positives = 25/49 (51%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 + + ++F++ + RNP A ++ + E++ LF L++ L+ Sbjct: 15 VGIGHVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLI 63 >gi|312142782|ref|YP_003994228.1| ATP synthase F0, C subunit [Halanaerobium sp. 'sapolanicus'] gi|311903433|gb|ADQ13874.1| ATP synthase F0, C subunit [Halanaerobium sp. 'sapolanicus'] Length = 85 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 26/57 (45%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + R+P A T +L+ +AES G++ L++ ++L+F I Sbjct: 29 IGPGIGQGYAAGKAVESVARDPEARGNIITTMLLGQAVAESTGIYSLVIAIVLIFTI 85 >gi|255658911|ref|ZP_05404320.1| ATP synthase F0, C subunit [Mitsuokella multacida DSM 20544] gi|260848861|gb|EEX68868.1| ATP synthase F0, C subunit [Mitsuokella multacida DSM 20544] Length = 83 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AA V G+ L L + + ++ G R P A S T LI + ES+ + Sbjct: 7 VAAALVGAGLCMGLAAIGAGLGDGLVTSRFIEGITRQPEAQSKLFTNTLISVGLIESMAI 66 Query: 79 FLLLVVMLLLFV 90 +V +++L+ Sbjct: 67 IATVVALIMLYA 78 >gi|153799746|gb|ABS50604.1| ATPase subunit 9 [Arabidopsis thaliana] gi|153799748|gb|ABS50605.1| ATPase subunit 9 [Arabidopsis thaliana] Length = 62 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 22/46 (47%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+F++ + RNP A ++ + E++ LF ++ Sbjct: 17 IGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMA 62 >gi|238809779|dbj|BAH69569.1| hypothetical protein [Mycoplasma fermentans PG18] Length = 79 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G+A LG L RNP AA+ ++ +LI +AES ++ L+V Sbjct: 11 IGIGIAMLGSFGTGLGQGLAAGKATEAVGRNPEAAAKIRSMLLIGQGVAESSAIYCLVVA 70 Query: 85 MLLLFV 90 +L F Sbjct: 71 FILAFA 76 >gi|292670136|ref|ZP_06603562.1| H(+)-transporting two-sector ATPase [Selenomonas noxia ATCC 43541] gi|292648235|gb|EFF66207.1| H(+)-transporting two-sector ATPase [Selenomonas noxia ATCC 43541] Length = 83 Score = 39.4 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AA + G+ A L A+ + + ++ G R P A T LI + E+L + Sbjct: 7 VAAALIGAGITAGLAAVGAAIGDGLVTSRFIEGLARQPEARGTLFTNTLISVGLIEALAI 66 Query: 79 FLLLVVMLLLFV 90 ++V +L+L+ Sbjct: 67 IAVVVALLMLYA 78 >gi|67920479|ref|ZP_00513999.1| ATP synthase F0, C subunit [Crocosphaera watsonii WH 8501] gi|126655503|ref|ZP_01726942.1| ATP synthase subunit C [Cyanothece sp. CCY0110] gi|172039397|ref|YP_001805898.1| F0F1 ATP synthase subunit C [Cyanothece sp. ATCC 51142] gi|67857963|gb|EAM53202.1| ATP synthase F0, C subunit [Crocosphaera watsonii WH 8501] gi|126622982|gb|EAZ93687.1| ATP synthase subunit C [Cyanothece sp. CCY0110] gi|171700851|gb|ACB53832.1| ATP synthase F0, C subunit [Cyanothece sp. ATCC 51142] Length = 81 Score = 39.4 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 27/59 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG L N +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 19 LGSIGPGLGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLFA 77 >gi|1703633|sp|Q07060|ATP9_PETSP RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|13320|emb|CAA29251.1| unnamed protein product [Petunia x hybrida] gi|13322|emb|CAA29250.1| unnamed protein product [Petunia x hybrida] gi|297476|emb|CAA68651.1| ATP synthase [Petunia x hybrida x Petunia axillaris subsp. parodii] Length = 77 Score = 39.4 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 23/52 (44%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N+ ++ + RNP A ++ + E+ F ++ L+ FV Sbjct: 22 IGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEANASFAPMMAFLISFV 73 >gi|149174228|ref|ZP_01852855.1| H+-transporting two-sector ATPase, C subunit [Planctomyces maris DSM 8797] gi|148846773|gb|EDL61109.1| H+-transporting two-sector ATPase, C subunit [Planctomyces maris DSM 8797] Length = 92 Score = 39.4 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 24/60 (40%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL LS + P AS + + + ES ++ ++ M+L+F Sbjct: 20 AIGSIGPALGEGRALAQALSAIAQQPDEASTITRTLFVGLAMVESTAIYCFVISMILIFA 79 >gi|116629878|ref|YP_815050.1| F0F1 ATP synthase subunit C [Lactobacillus gasseri ATCC 33323] gi|311110485|ref|ZP_07711882.1| conserved domain protein [Lactobacillus gasseri MV-22] gi|116095460|gb|ABJ60612.1| ATP synthase F0 subcomplex C subunit [Lactobacillus gasseri ATCC 33323] gi|311065639|gb|EFQ45979.1| conserved domain protein [Lactobacillus gasseri MV-22] Length = 85 Score = 39.4 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 26/51 (50%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P +A+ ++ + I + E++ + +++ L+LF+ Sbjct: 35 GNGKVISKTIEGIARQPESANNLRSTMFIGVGLIEAVPILAIVIGFLILFL 85 >gi|310778006|ref|YP_003966339.1| ATP synthase F0 subcomplex C subunit [Ilyobacter polytropus DSM 2926] gi|309747329|gb|ADO81991.1| ATP synthase F0 subcomplex C subunit [Ilyobacter polytropus DSM 2926] Length = 89 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA V G A + + + R P A + +++ +AES G++ Sbjct: 11 LAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIY 70 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 71 SLVIALILLYA 81 >gi|257452846|ref|ZP_05618145.1| F0F1 ATP synthase subunit C [Fusobacterium sp. 3_1_5R] gi|257466789|ref|ZP_05631100.1| F0F1 ATP synthase subunit C [Fusobacterium gonidiaformans ATCC 25563] gi|315917937|ref|ZP_07914177.1| ATP synthase subunit C [Fusobacterium gonidiaformans ATCC 25563] gi|313691812|gb|EFS28647.1| ATP synthase subunit C [Fusobacterium gonidiaformans ATCC 25563] Length = 91 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 32/71 (45%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + VG+A + + + R P A + +++ +AES G++ Sbjct: 13 LAGSGIGVGLAMIAGLGPGIGEGYAAGKAVEAVARQPEARGNIISTMILGQAVAESTGIY 72 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 73 SLVIALILLYA 83 >gi|75526948|sp|Q8KRV3|ATPL_ILYTA RecName: Full=ATP synthase subunit c, sodium ion specific; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|66360700|pdb|1YCE|A Chain A, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360701|pdb|1YCE|B Chain B, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360702|pdb|1YCE|C Chain C, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360703|pdb|1YCE|D Chain D, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360704|pdb|1YCE|E Chain E, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360705|pdb|1YCE|F Chain F, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360706|pdb|1YCE|G Chain G, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360707|pdb|1YCE|H Chain H, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360708|pdb|1YCE|I Chain I, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360709|pdb|1YCE|J Chain J, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360710|pdb|1YCE|K Chain K, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360711|pdb|1YCE|L Chain L, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360712|pdb|1YCE|M Chain M, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360713|pdb|1YCE|N Chain N, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360714|pdb|1YCE|O Chain O, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360715|pdb|1YCE|P Chain P, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360716|pdb|1YCE|Q Chain Q, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360717|pdb|1YCE|R Chain R, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360718|pdb|1YCE|S Chain S, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360719|pdb|1YCE|T Chain T, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360720|pdb|1YCE|U Chain U, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360721|pdb|1YCE|V Chain V, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360722|pdb|1YCE|AA Chain a, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360723|pdb|1YCE|BB Chain b, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360724|pdb|1YCE|CC Chain c, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360725|pdb|1YCE|DD Chain d, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360726|pdb|1YCE|EE Chain e, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360727|pdb|1YCE|FF Chain f, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360728|pdb|1YCE|GG Chain g, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360729|pdb|1YCE|HH Chain h, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360730|pdb|1YCE|II Chain i, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360731|pdb|1YCE|JJ Chain j, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360732|pdb|1YCE|KK Chain k, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360733|pdb|1YCE|LL Chain l, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360734|pdb|1YCE|MM Chain m, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360735|pdb|1YCE|NN Chain n, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360736|pdb|1YCE|OO Chain o, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360737|pdb|1YCE|PP Chain p, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360738|pdb|1YCE|QQ Chain q, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360739|pdb|1YCE|RR Chain r, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360740|pdb|1YCE|SS Chain s, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360741|pdb|1YCE|TT Chain t, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360742|pdb|1YCE|UU Chain u, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|66360743|pdb|1YCE|VV Chain v, Structure Of The Rotor Ring Of F-Type Na+-Atpase From Ilyobacter Tartaricus gi|239781678|pdb|2WGM|A Chain A, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781679|pdb|2WGM|B Chain B, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781680|pdb|2WGM|C Chain C, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781681|pdb|2WGM|D Chain D, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781682|pdb|2WGM|E Chain E, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781683|pdb|2WGM|F Chain F, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781684|pdb|2WGM|G Chain G, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781685|pdb|2WGM|H Chain H, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781686|pdb|2WGM|I Chain I, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781687|pdb|2WGM|J Chain J, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781688|pdb|2WGM|K Chain K, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781689|pdb|2WGM|L Chain L, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781690|pdb|2WGM|M Chain M, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781691|pdb|2WGM|N Chain N, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781692|pdb|2WGM|O Chain O, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781693|pdb|2WGM|P Chain P, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781694|pdb|2WGM|Q Chain Q, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781695|pdb|2WGM|R Chain R, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781696|pdb|2WGM|S Chain S, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781697|pdb|2WGM|T Chain T, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781698|pdb|2WGM|U Chain U, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781699|pdb|2WGM|V Chain V, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781700|pdb|2WGM|AA Chain a, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781701|pdb|2WGM|BB Chain b, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781702|pdb|2WGM|CC Chain c, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781703|pdb|2WGM|DD Chain d, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781704|pdb|2WGM|EE Chain e, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781705|pdb|2WGM|FF Chain f, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781706|pdb|2WGM|GG Chain g, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781707|pdb|2WGM|HH Chain h, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781708|pdb|2WGM|II Chain i, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781709|pdb|2WGM|JJ Chain j, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781710|pdb|2WGM|KK Chain k, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781711|pdb|2WGM|LL Chain l, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781712|pdb|2WGM|MM Chain m, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781713|pdb|2WGM|NN Chain n, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781714|pdb|2WGM|OO Chain o, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781715|pdb|2WGM|PP Chain p, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781716|pdb|2WGM|QQ Chain q, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781717|pdb|2WGM|RR Chain r, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781718|pdb|2WGM|SS Chain s, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781719|pdb|2WGM|TT Chain t, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781720|pdb|2WGM|UU Chain u, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|239781721|pdb|2WGM|VV Chain v, Complete Ion-Coordination Structure In The Rotor Ring Of Na- Dependent F-Atp Synthase gi|22266794|gb|AAM94908.1|AF522463_3 subunit c [Ilyobacter tartaricus] Length = 89 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA V G A + + + R P A + +++ +AES G++ Sbjct: 11 LAASAVGAGTAMIAGIGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAVAESTGIY 70 Query: 80 LLLVVMLLLFV 90 L++ ++LL+ Sbjct: 71 SLVIALILLYA 81 >gi|319936640|ref|ZP_08011053.1| ATP synthase subunit C [Coprobacillus sp. 29_1] gi|319808197|gb|EFW04762.1| ATP synthase subunit C [Coprobacillus sp. 29_1] Length = 80 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 32/66 (48%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 +A G+A + + + RNP A +T +++ ++E++ ++ LL+ Sbjct: 9 IAAGIAVCAGLGTGIGEGIAASKAVEAVGRNPEAEGKIRTMMILGIALSETVAIYGLLIS 68 Query: 85 MLLLFV 90 LL+FV Sbjct: 69 FLLMFV 74 >gi|255708768|gb|ACU30289.1| ATP synthase subunit 9 [Silene samia] Length = 56 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 22/43 (51%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ ++ RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLINSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|301057690|ref|ZP_07198763.1| ATP synthase F0, C subunit [delta proteobacterium NaphS2] gi|300448151|gb|EFK11843.1| ATP synthase F0, C subunit [delta proteobacterium NaphS2] Length = 126 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +GMA LG + + N L G RNP A T ++I + ESL ++ L++ Sbjct: 47 IGIGMAALG---TGIGMGNAINGALQGTARNPEAGGKIMTTMIIGLALIESLCIYALVIC 103 Query: 85 MLLLFVI 91 +L+F I Sbjct: 104 FILVFKI 110 >gi|197107636|gb|ACH42398.1| ATP synthase subunit 9 [Cystoseira baccata] Length = 56 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 22/56 (39%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + G+A +G+ + + + G RNP ++ + E++ LF Sbjct: 1 LLGAGLATIGLAGAGVGIGTASGALVLGTARNPSLRDEIFRIAILGFALTEAIALF 56 >gi|225028198|ref|ZP_03717390.1| hypothetical protein EUBHAL_02470 [Eubacterium hallii DSM 3353] gi|224954510|gb|EEG35719.1| hypothetical protein EUBHAL_02470 [Eubacterium hallii DSM 3353] Length = 88 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 18/77 (23%), Positives = 33/77 (42%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 N LA + G+A + + S RNP A + +L+ +A Sbjct: 5 TNEGLVLACSAIGAGLAVIAGIGPGVGQGIAAGYGASAVGRNPGAKGDVMSTMLLGQAVA 64 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ L++ ++LL+ Sbjct: 65 ETTGLYGLVIALILLYA 81 >gi|301759945|ref|XP_002915783.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase lipid-binding protein, mitochondrial-like [Ailuropoda melanoleuca] Length = 138 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 32/71 (45%), Gaps = 2/71 (2%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ A + + + + + + + RN + ++ V++E L F Sbjct: 70 AAKFIGAVAATVEVAVFCAGIGTVSGSLVISYARNLSPKQQLFSNAILEVVLSEXL--FC 127 Query: 81 LLVVMLLLFVI 91 L+V L+LF + Sbjct: 128 LMVAFLILFAM 138 >gi|157092927|gb|ABV22118.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] Length = 145 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 70 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 129 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 130 GLVIALVLLFA 140 >gi|224365680|ref|YP_002608407.1| ATPase subunit 9 [Vitis vinifera] gi|209954204|emb|CAQ77677.1| ATPase subunit 9 [Vitis vinifera] gi|239764715|gb|ACS15186.1| ATPase subunit 9 [Vitis vinifera] Length = 74 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 23/49 (46%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 + + N+F++ + RNP A ++ + E++ F ++ L+ Sbjct: 22 IGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMAFLI 70 >gi|288818678|ref|YP_003433026.1| ATP synthase C chain [Hydrogenobacter thermophilus TK-6] gi|288788078|dbj|BAI69825.1| ATP synthase C chain [Hydrogenobacter thermophilus TK-6] gi|308752267|gb|ADO45750.1| ATP synthase F0, C subunit [Hydrogenobacter thermophilus TK-6] Length = 102 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 24 YVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ G+A L + + + G RNP +T + I E+L L+ LL Sbjct: 34 YLGAGLAIGLAALGTGIGMGHAVRGTQEGTARNPTVGGRLQTVMFIGLAFIETLALYALL 93 Query: 83 VVMLLLFV 90 V ++LLFV Sbjct: 94 VAIILLFV 101 >gi|114151562|ref|YP_740378.1| ATPase subunit 9 [Zea perennis] gi|114151595|ref|YP_740445.1| ATPase subunit 9 [Zea luxurians] gi|114151628|ref|YP_740418.1| ATPase subunit 9 [Zea mays subsp. parviglumis] gi|897621|gb|AAA70271.1| F-0-ATPase proteolipid [Zea mays] gi|897623|gb|AAA70273.1| ATPase subunit 9 [Zea mays] gi|93116038|gb|ABE98671.1| ATPase subunit 9 [Zea mays subsp. mays] gi|93116082|gb|ABE98714.1| ATPase subunit 9 [Zea mays subsp. mays] gi|93116127|gb|ABE98758.1| ATPase subunit 9 [Zea mays subsp. mays] gi|102567896|gb|ABF70813.1| ATPase subunit 9 [Zea perennis] gi|102567961|gb|ABF70845.1| ATPase subunit 9 [Zea mays subsp. parviglumis] gi|102579631|gb|ABF70911.1| ATPase subunit 9 [Zea mays subsp. mays] gi|110287591|gb|ABG65637.1| ATPase subunit 9 [Zea luxurians] gi|224424|prf||1103354A ATPase 9 Length = 74 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + + A+ + N+ ++ + RNP A ++ + E++ F Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFA 63 Query: 81 LLVVMLLLFV 90 ++ L+ FV Sbjct: 64 PMMAFLISFV 73 >gi|68072447|ref|XP_678137.1| hypothetical protein [Plasmodium berghei strain ANKA] gi|56498508|emb|CAH97244.1| hypothetical protein PB104581.00.0 [Plasmodium berghei] Length = 71 Score = 39.1 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 26/53 (49%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 VA + ++F+ + G RNP T LI E LG+ +L+ +LL+ Sbjct: 18 VAQGIGSLFSALVLGTSRNPSIKDELFTYTLIGMGFLEFLGIICVLMSAVLLY 70 >gi|157092939|gb|ABV22124.1| chloroplast ATP synthase subunit C [Alexandrium affine] Length = 145 Score = 39.1 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A +A + A V G A L + + G R P A + +L Sbjct: 58 AAYADGGAVWVPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 117 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 118 LSLAFMESLTIYGLVIALVLLFA 140 >gi|91176233|ref|YP_537116.1| ATP synthase F0 subunit 9 [Paracoccidioides brasiliensis] gi|63081162|gb|AAY30325.1| ATP synthase F0 subunit 9 [Paracoccidioides brasiliensis] Length = 74 Score = 39.1 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + G A +G+ + + +F + RNP + + ++ +E+ GLF Sbjct: 4 AAKIIGSGCATMGLIGAGIGIGIVFAALIMAYARNPSLKAQLFSYAILGFAFSEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|297626240|ref|YP_003688003.1| ATP synthase C chain (F1F0-ATPase subunit c ) [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] gi|296922005|emb|CBL56567.1| ATP synthase C chain (F1F0-ATPase subunit c ) [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] Length = 72 Score = 39.1 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A LG + V+ IF + G R P A T V I I E+L + ++ Sbjct: 13 IGYGLATLG---PGIGVALIFAAAIQGIARQPEARGYIMTPVYIGFAIVEALAILGFVLA 69 Query: 85 ML 86 + Sbjct: 70 FI 71 >gi|188587440|ref|YP_001918985.1| ATP synthase F0, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] gi|179352127|gb|ACB86397.1| ATP synthase F0, C subunit [Natranaerobius thermophilus JW/NM-WN-LF] Length = 185 Score = 39.1 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 29/71 (40%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA + G A + + NP +L+ A +AE+ G+F Sbjct: 25 LAASAIGAGFAMIAGIGPGIGQGFAAGKGAESVGTNPKRGRQVTVVMLLGAAVAETSGIF 84 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 85 ALVVALILLFA 95 >gi|114564217|ref|YP_751731.1| F0F1 ATP synthase subunit C [Shewanella frigidimarina NCIMB 400] gi|114335510|gb|ABI72892.1| ATP synthase F0, C subunit [Shewanella frigidimarina NCIMB 400] Length = 93 Score = 39.1 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 27/60 (45%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ +L T LS + P A++ + + + ES ++ +V M+LLF Sbjct: 20 TIGVIGPSLGEGKAVATALSSLAQQPDASATITRTLFVGLAMIESTAIYCFVVTMILLFA 79 >gi|325291359|ref|YP_004267540.1| ATP synthase F0 subcomplex C subunit [Syntrophobotulus glycolicus DSM 8271] gi|324966760|gb|ADY57539.1| ATP synthase F0 subcomplex C subunit [Syntrophobotulus glycolicus DSM 8271] Length = 76 Score = 39.1 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 26/53 (49%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +L N+ + + G R P A + + + I + E+L L ++ +L+LF Sbjct: 23 SLGNGNVISRAIEGTARQPEAKGSLQGMMFIGVGLIEALPLLTWVIALLMLFT 75 >gi|193212724|ref|YP_001998677.1| alternate F1F0 ATPase F0 subunit C [Chlorobaculum parvum NCIB 8327] gi|193086201|gb|ACF11477.1| alternate F1F0 ATPase, F0 subunit C [Chlorobaculum parvum NCIB 8327] Length = 93 Score = 39.1 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 29/59 (49%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ AL ++ L+ + P AAS + + + ES+ ++ ++ ++L+F Sbjct: 21 IGVIGPALGQGRAVSSALTALAQQPDAASTITRTLFVGLAMIESIAIYCFVISIILIFA 79 >gi|159900580|ref|YP_001546827.1| ATP synthase F0 subunit C [Herpetosiphon aurantiacus ATCC 23779] gi|159893619|gb|ABX06699.1| ATP synthase F0, C subunit [Herpetosiphon aurantiacus ATCC 23779] Length = 77 Score = 39.1 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 25/54 (46%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + V + L RNP + +T + + + E L +F L++ +L+ F + Sbjct: 23 GIGVGLLVAGALQAIARNPETEGSIRTNMFVGIALTEGLAIFGLVISLLIGFGV 76 >gi|33862011|ref|NP_893572.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus subsp. pastoris str. CCMP1986] gi|78779932|ref|YP_398044.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9312] gi|123966867|ref|YP_001011948.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9515] gi|123969189|ref|YP_001010047.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. AS9601] gi|126696983|ref|YP_001091869.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9301] gi|157414056|ref|YP_001484922.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9215] gi|254525431|ref|ZP_05137483.1| ATP synthase F0, C subunit [Prochlorococcus marinus str. MIT 9202] gi|81575626|sp|Q7V033|ATPL_PROMP RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123755045|sp|Q318T7|ATPL_PROM9 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487657|sp|A3PEU3|ATPL_PROM0 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487659|sp|A8G6V5|ATPL_PROM2 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487661|sp|A2BYI0|ATPL_PROM5 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487662|sp|A2BT29|ATPL_PROMS RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|33640379|emb|CAE19914.1| H+-transporting ATP synthase c subunit [Prochlorococcus marinus subsp. pastoris str. CCMP1986] gi|78713431|gb|ABB50608.1| ATP synthase F0 subcomplex C subunit [Prochlorococcus marinus str. MIT 9312] gi|91070171|gb|ABE11092.1| ATP synthase subunit C [uncultured Prochlorococcus marinus clone HF10-11D6] gi|123199299|gb|ABM70940.1| ATP synthase subunit c [Prochlorococcus marinus str. AS9601] gi|123201233|gb|ABM72841.1| ATP synthase subunit c [Prochlorococcus marinus str. MIT 9515] gi|126544026|gb|ABO18268.1| ATP synthase subunit c [Prochlorococcus marinus str. MIT 9301] gi|157388631|gb|ABV51336.1| ATP synthase subunit c [Prochlorococcus marinus str. MIT 9215] gi|221536855|gb|EEE39308.1| ATP synthase F0, C subunit [Prochlorococcus marinus str. MIT 9202] Length = 81 Score = 39.1 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A LG L N + G R P A + +L+ ESL ++ Sbjct: 7 AASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 GLVVALVLLFA 77 >gi|322422436|ref|YP_004221862.1| ATP synthase subunit 9 [Penicillium digitatum] gi|316891690|gb|ADU57298.1| ATP synthase subunit 9 [Penicillium digitatum] Length = 74 Score = 39.1 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 35/70 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK + GMA G+ + + +F + G RNP + ++ AE+ GLF Sbjct: 4 AAKIIGTGMATTGLIGAGIGIGIVFGALILGVARNPSLRGQLFSYAILGFAFAEATGLFA 63 Query: 81 LLVVMLLLFV 90 L++ LLL+V Sbjct: 64 LMMAFLLLYV 73 >gi|45657121|ref|YP_001207.1| ATP synthase C chain [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|45600359|gb|AAS69844.1| ATP synthase C chain [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length = 108 Score = 39.1 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 15 NGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 NG Y+ VG+A + + AL + I + G R P A +T ++I A + Sbjct: 7 NGTMEFGLGYIGVGIAAGVAILGAALGIGRIGGSATEGISRQPEAGGKIQTAMIIAAALI 66 Query: 74 ESLGLFLLLVVM 85 E LF L++ Sbjct: 67 EGAALFALVIAF 78 >gi|315650477|ref|ZP_07903547.1| ATP synthase subunit C [Eubacterium saburreum DSM 3986] gi|331004500|ref|ZP_08327970.1| hypothetical protein HMPREF0491_02832 [Lachnospiraceae oral taxon 107 str. F0167] gi|315487273|gb|EFU77585.1| ATP synthase subunit C [Eubacterium saburreum DSM 3986] gi|330410678|gb|EGG90101.1| hypothetical protein HMPREF0491_02832 [Lachnospiraceae oral taxon 107 str. F0167] Length = 85 Score = 39.1 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 32/66 (48%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A + + + RNP A + + +L+ +AE+ GL+ L+V Sbjct: 15 IGAGLAMIAGIGPGVGQGIAAGHGAAAVGRNPGARADITSTMLLGQAVAETTGLYGLVVA 74 Query: 85 MLLLFV 90 M+L+FV Sbjct: 75 MILMFV 80 >gi|291521854|emb|CBK80147.1| ATP synthase F0 subcomplex C subunit [Coprococcus catus GD/7] Length = 76 Score = 39.1 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 29/64 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + ++ + R P A S +L+ +AE+ ++ ++ Sbjct: 9 IGAGIAVLTGIGAGVGIGKATSSAVDAIARQPEAESKISKSLLLGCALAEATAIYGFVIA 68 Query: 85 MLLL 88 +L++ Sbjct: 69 LLII 72 >gi|254413651|ref|ZP_05027421.1| ATP synthase F0, C subunit [Microcoleus chthonoplastes PCC 7420] gi|196179758|gb|EDX74752.1| ATP synthase F0, C subunit [Microcoleus chthonoplastes PCC 7420] Length = 81 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|260099798|pdb|2WIE|A Chain A, High-Resolution Structure Of The Rotor Ring From A Proton Dependent Atp Synthase gi|260099799|pdb|2WIE|B Chain B, High-Resolution Structure Of The Rotor Ring From A Proton Dependent Atp Synthase gi|260099800|pdb|2WIE|C Chain C, High-Resolution Structure Of The Rotor Ring From A Proton Dependent Atp Synthase gi|260099801|pdb|2WIE|D Chain D, High-Resolution Structure Of The Rotor Ring From A Proton Dependent Atp Synthase gi|260099802|pdb|2WIE|E Chain E, High-Resolution Structure Of The Rotor Ring From A Proton Dependent Atp Synthase gi|310689660|pdb|2XQS|A Chain A, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689661|pdb|2XQS|B Chain B, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689662|pdb|2XQS|C Chain C, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689663|pdb|2XQS|D Chain D, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689664|pdb|2XQS|E Chain E, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689670|pdb|2XQU|A Chain A, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689671|pdb|2XQU|B Chain B, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689672|pdb|2XQU|C Chain C, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689673|pdb|2XQU|D Chain D, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689674|pdb|2XQU|E Chain E, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases Length = 82 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G L + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 20 IGSIGPGLGQGQAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 78 >gi|255708708|gb|ACU30259.1| ATP synthase subunit 9 [Silene caryophylloides] Length = 56 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIRNVFSSLIHSVARNPSLAKKLFGYAILGFALTEAIALFAL 56 >gi|256825634|ref|YP_003149594.1| ATP synthase F0 subcomplex C subunit [Kytococcus sedentarius DSM 20547] gi|256689027|gb|ACV06829.1| ATP synthase F0 subcomplex C subunit [Kytococcus sedentarius DSM 20547] Length = 67 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 28/56 (50%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L A+AV IF Y++G R P + S + ++ IAE+L + ++ +L Sbjct: 12 LATIGPAIAVGLIFAAYINGVARQPESRSLLQPIAILGMAIAEALAILGFVLTFIL 67 >gi|323466862|gb|ADX70549.1| H+-transporting two-sector ATPase lipid-binding protein [Lactobacillus helveticus H10] Length = 89 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 24/49 (48%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + L G R P +A + + I + E++ + ++V L+LF+ Sbjct: 41 GKVISKTLEGMARQPESAGNLRATMFIGVGLIEAVPILAIVVAFLILFL 89 >gi|297559311|ref|YP_003678285.1| ATP synthase F0 C subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296843759|gb|ADH65779.1| ATP synthase F0, C subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 76 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 21/54 (38%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 + + + V +F + R P A +T + + + E+L + ++ Sbjct: 17 ISVIGAGIGVGIVFGLGMQAIARQPEARGPLQTNIYLGFALIEALAILGFVLAF 70 >gi|157166601|gb|ABV25303.1| ATP synthase subunit 9 [Silene noctiflora] gi|255708698|gb|ACU30254.1| ATP synthase subunit 9 [Silene ammophila] gi|255708710|gb|ACU30260.1| ATP synthase subunit 9 [Silene conica] gi|255708726|gb|ACU30268.1| ATP synthase subunit 9 [Silene gallinyi] gi|255708730|gb|ACU30270.1| ATP synthase subunit 9 [Silene imbricata] gi|255708744|gb|ACU30277.1| ATP synthase subunit 9 [Silene macrodonta] gi|255708754|gb|ACU30282.1| ATP synthase subunit 9 [Silene niceensis] gi|255708762|gb|ACU30286.1| ATP synthase subunit 9 [Silene pygmaea] gi|255708770|gb|ACU30290.1| ATP synthase subunit 9 [Silene schafta] gi|255708780|gb|ACU30295.1| ATP synthase subunit 9 [Silene turkestanica] Length = 56 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|157166463|gb|ABV25234.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166465|gb|ABV25235.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166469|gb|ABV25237.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166471|gb|ABV25238.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166473|gb|ABV25239.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166475|gb|ABV25240.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166479|gb|ABV25242.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166481|gb|ABV25243.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166483|gb|ABV25244.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166485|gb|ABV25245.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166487|gb|ABV25246.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166489|gb|ABV25247.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166491|gb|ABV25248.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166493|gb|ABV25249.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166495|gb|ABV25250.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166497|gb|ABV25251.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166499|gb|ABV25252.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166501|gb|ABV25253.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166503|gb|ABV25254.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166505|gb|ABV25255.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166507|gb|ABV25256.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166511|gb|ABV25258.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166515|gb|ABV25260.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166517|gb|ABV25261.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166519|gb|ABV25262.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166521|gb|ABV25263.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166523|gb|ABV25264.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166525|gb|ABV25265.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166527|gb|ABV25266.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166529|gb|ABV25267.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166531|gb|ABV25268.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166533|gb|ABV25269.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166535|gb|ABV25270.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166537|gb|ABV25271.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166539|gb|ABV25272.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166541|gb|ABV25273.1| ATP synthase subunit 9 [Silene vulgaris] gi|157166599|gb|ABV25302.1| ATP synthase subunit 9 [Silene acaulis] gi|157166603|gb|ABV25304.1| ATP synthase subunit 9 [Silene paradoxa] gi|157166605|gb|ABV25305.1| ATP synthase subunit 9 [Silene stellata] gi|157166607|gb|ABV25306.1| ATP synthase subunit 9 [Lychnis coronaria] gi|255708686|gb|ACU30248.1| ATP synthase subunit 9 [Atocion lerchenfeldianum] gi|255708690|gb|ACU30250.1| ATP synthase subunit 9 [Heliosperma pusillum] gi|255708702|gb|ACU30256.1| ATP synthase subunit 9 [Silene argentina] gi|255708704|gb|ACU30257.1| ATP synthase subunit 9 [Silene auriculata] gi|255708706|gb|ACU30258.1| ATP synthase subunit 9 [Silene caesia] gi|255708714|gb|ACU30262.1| ATP synthase subunit 9 [Silene davidii] gi|255708718|gb|ACU30264.1| ATP synthase subunit 9 [Silene dichotoma] gi|255708720|gb|ACU30265.1| ATP synthase subunit 9 [Silene douglasii] gi|255708722|gb|ACU30266.1| ATP synthase subunit 9 [Silene flavescens] gi|255708724|gb|ACU30267.1| ATP synthase subunit 9 [Silene fruticosa] gi|255708734|gb|ACU30272.1| ATP synthase subunit 9 [Silene involucrata] gi|255708740|gb|ACU30275.1| ATP synthase subunit 9 [Silene laciniata] gi|255708742|gb|ACU30276.1| ATP synthase subunit 9 [Silene littorea] gi|255708748|gb|ACU30279.1| ATP synthase subunit 9 [Silene multicaulis] gi|255708750|gb|ACU30280.1| ATP synthase subunit 9 [Silene muscipula] gi|255708756|gb|ACU30283.1| ATP synthase subunit 9 [Silene odontopetala] gi|255708758|gb|ACU30284.1| ATP synthase subunit 9 [Silene paradoxa] gi|255708760|gb|ACU30285.1| ATP synthase subunit 9 [Silene paucifolia] gi|255708766|gb|ACU30288.1| ATP synthase subunit 9 [Silene sachalinensis] gi|255708772|gb|ACU30291.1| ATP synthase subunit 9 [Silene seoulensis] gi|255708786|gb|ACU30298.1| ATP synthase subunit 9 [Silene yemensis] gi|255708788|gb|ACU30299.1| ATP synthase subunit 9 [Silene zawadskii] gi|255708790|gb|ACU30300.1| ATP synthase subunit 9 [Viscaria alpina] Length = 56 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|85860963|ref|YP_463165.1| F0F1 ATP synthase subunit C [Syntrophus aciditrophicus SB] gi|85724054|gb|ABC78997.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type proton-ATPase, subunit K [Syntrophus aciditrophicus SB] Length = 92 Score = 39.1 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 26/62 (41%) Query: 29 MACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 +G AL N L+ + P ++ + + + ES+ ++ ++ M+L+ Sbjct: 18 CMAVGSIGPALGEGNAVKQALTAIAQQPDERNSITRTLFVGLAMIESIAIYCFVISMILI 77 Query: 89 FV 90 F Sbjct: 78 FA 79 >gi|229220795|ref|NP_866391.2| F0F1 ATP synthase subunit C [Rhodopirellula baltica SH 1] gi|327538806|gb|EGF25453.1| Alternate ATPase, F0 complex, subunit C [Rhodopirellula baltica WH47] Length = 88 Score = 39.1 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G+ +G A A L+ + P +++ + + + ES ++ Sbjct: 10 ASIIMAGLTTAIGSIGPAFAEGRAVAQALNSIAQQPDSSNTITRTLFVGLAMIESTAIYC 69 Query: 81 LLVVMLLLFV 90 +V M+LLF Sbjct: 70 FVVSMILLFA 79 >gi|255708700|gb|ACU30255.1| ATP synthase subunit 9 [Silene antirrhina] Length = 56 Score = 38.7 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLIQSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|238917407|ref|YP_002930924.1| hypothetical protein EUBELI_01485 [Eubacterium eligens ATCC 27750] gi|238872767|gb|ACR72477.1| Hypothetical protein EUBELI_01485 [Eubacterium eligens ATCC 27750] Length = 75 Score = 38.7 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 29/64 (45%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L L + ++ + R P A S +L+ +AE+ ++ ++ Sbjct: 8 IGAGIAVLTGIGAGLGIGKATSSAVDAIARQPEAESKISKSLLLGCALAEATAIYGFVIA 67 Query: 85 MLLL 88 +L++ Sbjct: 68 LLII 71 >gi|255280308|ref|ZP_05344863.1| ATP synthase C chain, sodium ion specific [Bryantella formatexigens DSM 14469] gi|255269399|gb|EET62604.1| ATP synthase C chain, sodium ion specific [Bryantella formatexigens DSM 14469] Length = 86 Score = 38.7 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A + + + RNP A S + +L+ +AE+ GL+ Sbjct: 9 LACSAIGAGLAMIAGVGPGIGQGIAAGYGANAVGRNPGAKSDITSTMLLGQAVAETTGLY 68 Query: 80 LLLVVMLLLFV 90 L + +LLF Sbjct: 69 GLAIAFILLFA 79 >gi|292492277|ref|YP_003527716.1| ATP synthase F0 C subunit [Nitrosococcus halophilus Nc4] gi|291580872|gb|ADE15329.1| ATP synthase F0, C subunit [Nitrosococcus halophilus Nc4] Length = 91 Score = 38.7 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 30/59 (50%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG L A+A+ + L R P A + + I + ESL ++ L++V+++LF Sbjct: 23 VLGTMLPAIAMGRSISHALEALSRQPEAEGSITRTLFIGLAMIESLAIYCLVIVLIVLF 81 >gi|323490916|ref|ZP_08096111.1| F0F1 ATP synthase subunit C [Planococcus donghaensis MPA1U2] gi|323395396|gb|EGA88247.1| F0F1 ATP synthase subunit C [Planococcus donghaensis MPA1U2] Length = 70 Score = 38.7 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 9/53 (16%), Positives = 23/53 (43%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + I + + G R P A +T + I + E+L + +++ +++ Sbjct: 16 GAGIGNGLIVSKTVEGIARQPEARGVLQTTMFIGVALVEALPIIAVVIAFIVM 68 >gi|197120293|ref|YP_002140720.1| ATP synthase F0 subunit C [Geobacter bemidjiensis Bem] gi|253702601|ref|YP_003023790.1| ATP synthase F0 C subunit [Geobacter sp. M21] gi|224487646|sp|B5EFG9|ATPL_GEOBB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|259585521|sp|C6E8P1|ATPL_GEOSM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|197089653|gb|ACH40924.1| ATP synthase F0, C subunit [Geobacter bemidjiensis Bem] gi|251777451|gb|ACT20032.1| ATP synthase F0, C subunit [Geobacter sp. M21] Length = 91 Score = 38.7 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG + + + G RNP A+ T ++I + ESL ++ L+V +++LF Sbjct: 15 MALGTLGTGIGQGLAVKSAVEGTSRNPGASGKILTTMMIGLAMIESLAIYALVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|269925190|ref|YP_003321813.1| ATP synthase F0, C subunit [Thermobaculum terrenum ATCC BAA-798] gi|269788850|gb|ACZ40991.1| ATP synthase F0, C subunit [Thermobaculum terrenum ATCC BAA-798] Length = 103 Score = 38.7 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 29/59 (49%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G L + + RNP A+ +T ++I A +AE++ ++ L +L+LF Sbjct: 44 VGALGPGLGIGLAVRGAMEATGRNPEASGDIRTTLIIGAALAEAVAIYAFLTALLILFT 102 >gi|284928725|ref|YP_003421247.1| ATP synthase F0 subcomplex subunit C [cyanobacterium UCYN-A] gi|284809184|gb|ADB94889.1| ATP synthase F0 subcomplex C subunit [cyanobacterium UCYN-A] Length = 81 Score = 38.7 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 25/56 (44%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVISLVLLFA 77 >gi|238917852|ref|YP_002931369.1| hypothetical protein EUBELI_01933 [Eubacterium eligens ATCC 27750] gi|238873212|gb|ACR72922.1| Hypothetical protein EUBELI_01933 [Eubacterium eligens ATCC 27750] Length = 85 Score = 38.7 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 18/73 (24%), Positives = 32/73 (43%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + A + G+A + + S RNP A S + +L+ +AE+ G Sbjct: 8 FISAMSAIGAGIAMIAGVGPGVGQGIAAGYGASAVGRNPGAKSDITSTMLLGQAVAETTG 67 Query: 78 LFLLLVVMLLLFV 90 L+ V ++L+FV Sbjct: 68 LYGFAVAIILMFV 80 >gi|332706676|ref|ZP_08426737.1| ATP synthase F0 subcomplex C subunit [Lyngbya majuscula 3L] gi|332354560|gb|EGJ34039.1| ATP synthase F0 subcomplex C subunit [Lyngbya majuscula 3L] Length = 81 Score = 38.7 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVISLVLLFA 77 >gi|50842724|ref|YP_055951.1| ATP synthase C chain [Propionibacterium acnes KPA171202] gi|289425128|ref|ZP_06426905.1| ATP synthase subunit C [Propionibacterium acnes SK187] gi|289428516|ref|ZP_06430200.1| ATP synthase subunit C [Propionibacterium acnes J165] gi|295130804|ref|YP_003581467.1| ATP synthase subunit C [Propionibacterium acnes SK137] gi|50840326|gb|AAT82993.1| ATP synthase C chain [Propionibacterium acnes KPA171202] gi|289154106|gb|EFD02794.1| ATP synthase subunit C [Propionibacterium acnes SK187] gi|289158210|gb|EFD06429.1| ATP synthase subunit C [Propionibacterium acnes J165] gi|291377149|gb|ADE01004.1| ATP synthase subunit C [Propionibacterium acnes SK137] gi|313772054|gb|EFS38020.1| ATP synthase subunit C [Propionibacterium acnes HL074PA1] gi|313801602|gb|EFS42842.1| ATP synthase subunit C [Propionibacterium acnes HL110PA2] gi|313807745|gb|EFS46232.1| ATP synthase subunit C [Propionibacterium acnes HL087PA2] gi|313810254|gb|EFS47975.1| ATP synthase subunit C [Propionibacterium acnes HL083PA1] gi|313818782|gb|EFS56496.1| ATP synthase subunit C [Propionibacterium acnes HL046PA2] gi|313820554|gb|EFS58268.1| ATP synthase subunit C [Propionibacterium acnes HL036PA1] gi|313825426|gb|EFS63140.1| ATP synthase subunit C [Propionibacterium acnes HL063PA1] gi|313827389|gb|EFS65103.1| ATP synthase subunit C [Propionibacterium acnes HL063PA2] gi|313830584|gb|EFS68298.1| ATP synthase subunit C [Propionibacterium acnes HL007PA1] gi|313833620|gb|EFS71334.1| ATP synthase subunit C [Propionibacterium acnes HL056PA1] gi|313838315|gb|EFS76029.1| ATP synthase subunit C [Propionibacterium acnes HL086PA1] gi|314917929|gb|EFS81760.1| ATP synthase subunit C [Propionibacterium acnes HL050PA1] gi|314920312|gb|EFS84143.1| ATP synthase subunit C [Propionibacterium acnes HL050PA3] gi|314924919|gb|EFS88750.1| ATP synthase subunit C [Propionibacterium acnes HL036PA3] gi|314931532|gb|EFS95363.1| ATP synthase subunit C [Propionibacterium acnes HL067PA1] gi|314955543|gb|EFS99946.1| ATP synthase subunit C [Propionibacterium acnes HL027PA1] gi|314957917|gb|EFT02020.1| ATP synthase subunit C [Propionibacterium acnes HL002PA1] gi|314967565|gb|EFT11664.1| ATP synthase subunit C [Propionibacterium acnes HL037PA1] gi|314973585|gb|EFT17681.1| ATP synthase subunit C [Propionibacterium acnes HL053PA1] gi|314975807|gb|EFT19902.1| ATP synthase subunit C [Propionibacterium acnes HL045PA1] gi|315088516|gb|EFT60492.1| ATP synthase subunit C [Propionibacterium acnes HL072PA1] gi|315095859|gb|EFT67835.1| ATP synthase subunit C [Propionibacterium acnes HL038PA1] gi|315098763|gb|EFT70739.1| ATP synthase subunit C [Propionibacterium acnes HL059PA2] gi|327326410|gb|EGE68200.1| ATP synthase C chain [Propionibacterium acnes HL096PA2] gi|327329866|gb|EGE71620.1| ATP synthase C chain [Propionibacterium acnes HL097PA1] gi|327448322|gb|EGE94976.1| ATP synthase subunit C [Propionibacterium acnes HL043PA1] gi|327453365|gb|EGF00020.1| ATP synthase subunit C [Propionibacterium acnes HL092PA1] gi|327454108|gb|EGF00763.1| ATP synthase subunit C [Propionibacterium acnes HL083PA2] gi|328753191|gb|EGF66807.1| ATP synthase subunit C [Propionibacterium acnes HL025PA2] gi|332675648|gb|AEE72464.1| F0F1 ATP synthase subunit c [Propionibacterium acnes 266] Length = 73 Score = 38.7 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L AL V+ IF ++G R P A A T I + E+L LF ++ ++ Sbjct: 17 LAALGPALGVAWIFAAVINGTARQPEARPAMMTTAFIGFAVVEALALFGFILAFIV 72 >gi|255708716|gb|ACU30263.1| ATP synthase subunit 9 [Silene delicatula] gi|255708752|gb|ACU30281.1| ATP synthase subunit 9 [Silene nana] Length = 56 Score = 38.7 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 VGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|157166543|gb|ABV25274.1| ATP synthase subunit 9 [Silene latifolia] gi|157166545|gb|ABV25275.1| ATP synthase subunit 9 [Silene latifolia] gi|157166547|gb|ABV25276.1| ATP synthase subunit 9 [Silene latifolia] gi|157166549|gb|ABV25277.1| ATP synthase subunit 9 [Silene latifolia] gi|157166551|gb|ABV25278.1| ATP synthase subunit 9 [Silene latifolia] gi|157166553|gb|ABV25279.1| ATP synthase subunit 9 [Silene latifolia] gi|157166555|gb|ABV25280.1| ATP synthase subunit 9 [Silene latifolia] gi|157166557|gb|ABV25281.1| ATP synthase subunit 9 [Silene latifolia] gi|157166559|gb|ABV25282.1| ATP synthase subunit 9 [Silene latifolia] gi|157166561|gb|ABV25283.1| ATP synthase subunit 9 [Silene latifolia] gi|157166563|gb|ABV25284.1| ATP synthase subunit 9 [Silene latifolia] gi|157166565|gb|ABV25285.1| ATP synthase subunit 9 [Silene latifolia] gi|157166567|gb|ABV25286.1| ATP synthase subunit 9 [Silene latifolia] gi|157166569|gb|ABV25287.1| ATP synthase subunit 9 [Silene latifolia] gi|157166571|gb|ABV25288.1| ATP synthase subunit 9 [Silene latifolia] gi|157166573|gb|ABV25289.1| ATP synthase subunit 9 [Silene latifolia] gi|157166575|gb|ABV25290.1| ATP synthase subunit 9 [Silene latifolia] gi|157166577|gb|ABV25291.1| ATP synthase subunit 9 [Silene latifolia] gi|157166579|gb|ABV25292.1| ATP synthase subunit 9 [Silene latifolia] gi|157166581|gb|ABV25293.1| ATP synthase subunit 9 [Silene latifolia] gi|157166583|gb|ABV25294.1| ATP synthase subunit 9 [Silene latifolia] gi|157166585|gb|ABV25295.1| ATP synthase subunit 9 [Silene latifolia] gi|157166587|gb|ABV25296.1| ATP synthase subunit 9 [Silene latifolia] gi|157166589|gb|ABV25297.1| ATP synthase subunit 9 [Silene latifolia] gi|157166591|gb|ABV25298.1| ATP synthase subunit 9 [Silene latifolia] gi|157166593|gb|ABV25299.1| ATP synthase subunit 9 [Silene latifolia] gi|157166595|gb|ABV25300.1| ATP synthase subunit 9 [Silene latifolia] gi|157166597|gb|ABV25301.1| ATP synthase subunit 9 [Silene latifolia] gi|255708684|gb|ACU30247.1| ATP synthase subunit 9 [Agrostemma githago] gi|255708688|gb|ACU30249.1| ATP synthase subunit 9 [Eudianthe laeta] gi|255708692|gb|ACU30251.1| ATP synthase subunit 9 [Petrocoptis pyrenaica] gi|255708694|gb|ACU30252.1| ATP synthase subunit 9 [Silene acutifolia] gi|255708696|gb|ACU30253.1| ATP synthase subunit 9 [Silene akinfievii] gi|255708712|gb|ACU30261.1| ATP synthase subunit 9 [Silene cordifolia] gi|255708728|gb|ACU30269.1| ATP synthase subunit 9 [Silene hookeri] gi|255708732|gb|ACU30271.1| ATP synthase subunit 9 [Silene integripetala] gi|255708736|gb|ACU30273.1| ATP synthase subunit 9 [Silene khasiana] gi|255708738|gb|ACU30274.1| ATP synthase subunit 9 [Silene lacera] gi|255708746|gb|ACU30278.1| ATP synthase subunit 9 [Silene menziesii] gi|255708774|gb|ACU30292.1| ATP synthase subunit 9 [Silene sordida] Length = 56 Score = 38.7 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 VGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|193891060|gb|ACF28683.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 38.7 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 31/83 (37%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A A + A V G A L + + G R P A + +L Sbjct: 57 AALADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 117 LSLAFMESLTIYGLVIALVLLFA 139 >gi|258652332|ref|YP_003201488.1| ATP synthase F0 subunit C [Nakamurella multipartita DSM 44233] gi|258555557|gb|ACV78499.1| ATP synthase F0, C subunit [Nakamurella multipartita DSM 44233] Length = 76 Score = 38.7 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 25/56 (44%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L + V ++ Y+S R P +A +T + ++E+L L +V +L Sbjct: 20 LSAIGPGIGVGIVWAAYISSTARQPESAGLTRTYAFLGFAVSEALALLGFVVPFIL 75 >gi|296199001|ref|XP_002747046.1| PREDICTED: ATP synthase lipid-binding protein, mitochondrial-like [Callithrix jacchus] Length = 165 Score = 38.7 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ L + + G NP L+ ++E++GLF Sbjct: 98 AAKFIGAGAATVGVVGSGLGLGLGLCLGIIGYTGNPSLKQQLFC-ALLGIALSEAMGLFC 156 Query: 81 LLVVMLLLF 89 L+V L F Sbjct: 157 LMVANFLYF 165 >gi|95928948|ref|ZP_01311693.1| ATP synthase F0, C subunit [Desulfuromonas acetoxidans DSM 684] gi|95134849|gb|EAT16503.1| ATP synthase F0, C subunit [Desulfuromonas acetoxidans DSM 684] Length = 92 Score = 38.7 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 26/60 (43%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL + L+ + P +AS + + + ES ++ +V M++LF Sbjct: 20 AIGSIGSALGEGRAVASALTSLAQQPDSASTITRTLFVGLAMVESTAIYCFVVSMIVLFA 79 >gi|118579039|ref|YP_900289.1| ATP synthase F0 subunit C [Pelobacter propionicus DSM 2379] gi|224487615|sp|A1ALL1|ATPL1_PELPD RecName: Full=ATP synthase subunit c 1; AltName: Full=ATP synthase F(0) sector subunit c 1; AltName: Full=F-type ATPase subunit c 1; Short=F-ATPase subunit c 1; AltName: Full=Lipid-binding protein 1 gi|118501749|gb|ABK98231.1| ATP synthase F0 subcomplex C subunit [Pelobacter propionicus DSM 2379] Length = 91 Score = 38.7 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 31/61 (50%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G A+ + + G RNP AAS T ++I + ESL ++ L+V +++LF Sbjct: 15 MAIGTLGTAIGQGMAVKSAVEGVARNPGAASKIMTTMMIGLAMIESLAIYALVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|193891066|gb|ACF28686.1| chloroplast ATP synthase [Amphidinium carterae] Length = 144 Score = 38.7 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 31/83 (37%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A FA + A V G A L + + G R P A + +L Sbjct: 57 AAFADEGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 116 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++L F Sbjct: 117 LSLAFMESLTIYGLVIALVLPFA 139 >gi|209525761|ref|ZP_03274297.1| ATP synthase F0, C subunit [Arthrospira maxima CS-328] gi|284051763|ref|ZP_06381973.1| F0F1 ATP synthase subunit C [Arthrospira platensis str. Paraca] gi|146186464|gb|ABQ09284.1| AtpH [Arthrospira platensis HN01] gi|209493734|gb|EDZ94053.1| ATP synthase F0, C subunit [Arthrospira maxima CS-328] gi|291566395|dbj|BAI88667.1| ATP synthase c chain [Arthrospira platensis NIES-39] Length = 82 Score = 38.7 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G L + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 20 IGSIGPGLGQGQAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 78 >gi|160914783|ref|ZP_02076997.1| hypothetical protein EUBDOL_00790 [Eubacterium dolichum DSM 3991] gi|158433323|gb|EDP11612.1| hypothetical protein EUBDOL_00790 [Eubacterium dolichum DSM 3991] Length = 80 Score = 38.7 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 14/76 (18%), Positives = 34/76 (44%) Query: 15 NGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAE 74 N + + G+A + + + RNP AA ++ +++ +AE Sbjct: 3 NEEFVKGMAMLGAGIAMIAGLGPGIGQGIAASKGAEAVGRNPEAAGKIRSIMVLGIAMAE 62 Query: 75 SLGLFLLLVVMLLLFV 90 + G++ L++ ++L+F Sbjct: 63 TTGIYALVIALILIFT 78 >gi|72162811|ref|YP_290468.1| ATP synthase F0 subunit C [Thermobifida fusca YX] gi|71916543|gb|AAZ56445.1| ATP synthase F0, C subunit [Thermobifida fusca YX] Length = 68 Score = 38.7 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 22/56 (39%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 + + + V +F + R P A +T + I + E+L L ++ L Sbjct: 12 ISVIGAGIGVGIVFGLGMQAIARQPEARGPLQTNIYIGFALIEALALLGFVLAFAL 67 >gi|167755043|ref|ZP_02427170.1| hypothetical protein CLORAM_00547 [Clostridium ramosum DSM 1402] gi|237735232|ref|ZP_04565713.1| predicted protein [Mollicutes bacterium D7] gi|167705093|gb|EDS19672.1| hypothetical protein CLORAM_00547 [Clostridium ramosum DSM 1402] gi|229380977|gb|EEO31068.1| predicted protein [Coprobacillus sp. D7] Length = 75 Score = 38.7 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 29/66 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A + + + RNP +T +++ + E+ ++ LL+ Sbjct: 9 IGAGIAVCAGLGTGIGEGICASKAVEALGRNPEMEGKIRTLMILGIALTETAAIYGLLIS 68 Query: 85 MLLLFV 90 ++LLFV Sbjct: 69 LILLFV 74 >gi|119484693|ref|ZP_01619175.1| ATP synthase subunit C [Lyngbya sp. PCC 8106] gi|119457511|gb|EAW38635.1| ATP synthase subunit C [Lyngbya sp. PCC 8106] Length = 81 Score = 38.7 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVSLVLLFA 77 >gi|158340804|ref|YP_001521972.1| F0F1 ATP synthase subunit C [Acaryochloris marina MBIC11017] gi|158311045|gb|ABW32658.1| ATP synthase C chain [Acaryochloris marina MBIC11017] Length = 95 Score = 38.7 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 25/60 (41%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL + LS + P A+ + + + ES ++ ++ ++L+F Sbjct: 20 AIGSIGPALGEGRALSQALSALAQQPDEANTITRVLFVGMALVESTAIYCFVITLILIFA 79 >gi|332146786|dbj|BAK19942.1| ApH+ATPase c subunit [Aphanothece halophytica] Length = 81 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L N L G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGLGQGNASGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|320532879|ref|ZP_08033650.1| ATP synthase F0, C subunit [Actinomyces sp. oral taxon 171 str. F0337] gi|325068180|ref|ZP_08126853.1| H+transporting two-sector ATPase C subunit [Actinomyces oris K20] gi|320134909|gb|EFW27086.1| ATP synthase F0, C subunit [Actinomyces sp. oral taxon 171 str. F0337] Length = 69 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 S A YV G+A LG + + + G R P A T ++I A + E+L L Sbjct: 3 SAALAYVGYGLATLG---PGIGIGIMVGKTQEGTARQPEVAGRLFTNMIIGAGMVEALAL 59 Query: 79 FLLLVVMLL 87 ++ ++ Sbjct: 60 IGFVIPFVV 68 >gi|289548957|ref|YP_003473945.1| ATP synthase F0 C subunit [Thermocrinis albus DSM 14484] gi|289182574|gb|ADC89818.1| ATP synthase F0, C subunit [Thermocrinis albus DSM 14484] Length = 101 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 24 YVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ G+A L + + + G RNP +T + I E+L L+ LL Sbjct: 33 YLGAGLAIGLAALGTGIGMGHAVRGTQEGIARNPTVGGRLQTVMFIGLAFIETLALYALL 92 Query: 83 VVMLLLFV 90 V ++LLFV Sbjct: 93 VAIILLFV 100 >gi|291534222|emb|CBL07335.1| ATP synthase F0 subcomplex C subunit [Megamonas hypermegale ART12/1] Length = 83 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 11/72 (15%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 + A + G+ L + + + ++ G R P A + LI + E++ + Sbjct: 7 VMAALIGAGITMGLASIGAGIGDGLVTSKFIEGIARQPEAKNTLFMNTLISVGLIEAMPI 66 Query: 79 FLLLVVMLLLFV 90 ++ +++L+ Sbjct: 67 IATVIALIMLYA 78 >gi|215400708|ref|YP_002327469.1| ATP synthase CF0 subunit III [Vaucheria litorea] gi|194441158|gb|ACF70886.1| ATP synthase CF0 subunit III [Vaucheria litorea] Length = 82 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A LG + N + G R P A + + +L+ E+L ++ Sbjct: 7 AASVLAAGLAVGLGAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALSLLFA 77 >gi|148378157|ref|YP_001252698.1| F0F1 ATP synthase subunit C [Clostridium botulinum A str. ATCC 3502] gi|153933562|ref|YP_001382558.1| F0F1 ATP synthase subunit C [Clostridium botulinum A str. ATCC 19397] gi|153934640|ref|YP_001386110.1| F0F1 ATP synthase subunit C [Clostridium botulinum A str. Hall] gi|153938069|ref|YP_001389514.1| F0F1 ATP synthase subunit C [Clostridium botulinum F str. Langeland] gi|168177484|ref|ZP_02612148.1| ATP synthase F0, C subunit [Clostridium botulinum NCTC 2916] gi|168182239|ref|ZP_02616903.1| ATP synthase F0, C subunit [Clostridium botulinum Bf] gi|170756560|ref|YP_001779779.1| F0F1 ATP synthase subunit C [Clostridium botulinum B1 str. Okra] gi|170758436|ref|YP_001785480.1| F0F1 ATP synthase subunit C [Clostridium botulinum A3 str. Loch Maree] gi|226947375|ref|YP_002802466.1| ATP synthase F0, C subunit [Clostridium botulinum A2 str. Kyoto] gi|237793470|ref|YP_002861022.1| ATP synthase F0, C subunit [Clostridium botulinum Ba4 str. 657] gi|224487636|sp|A7FQH4|ATPL_CLOB1 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487639|sp|A5HY47|ATPL_CLOBH RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487640|sp|B1IE29|ATPL_CLOBK RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487641|sp|A7G9Q4|ATPL_CLOBL RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487642|sp|B1KSS3|ATPL_CLOBM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|148287641|emb|CAL81706.1| ATP synthase c chain [Clostridium botulinum A str. ATCC 3502] gi|152929606|gb|ABS35106.1| ATP synthase F0, C subunit [Clostridium botulinum A str. ATCC 19397] gi|152930554|gb|ABS36053.1| ATP synthase F0, C subunit [Clostridium botulinum A str. Hall] gi|152933965|gb|ABS39463.1| ATP synthase F0, C subunit [Clostridium botulinum F str. Langeland] gi|169121772|gb|ACA45608.1| ATP synthase F0, C subunit [Clostridium botulinum B1 str. Okra] gi|169405425|gb|ACA53836.1| ATP synthase F0, C subunit [Clostridium botulinum A3 str. Loch Maree] gi|182670615|gb|EDT82589.1| ATP synthase F0, C subunit [Clostridium botulinum NCTC 2916] gi|182674589|gb|EDT86550.1| ATP synthase F0, C subunit [Clostridium botulinum Bf] gi|226842629|gb|ACO85295.1| ATP synthase F0, C subunit [Clostridium botulinum A2 str. Kyoto] gi|229262581|gb|ACQ53614.1| ATP synthase F0, C subunit [Clostridium botulinum Ba4 str. 657] gi|295317614|gb|ADF97991.1| ATP synthase F0, C subunit [Clostridium botulinum F str. 230613] gi|322804421|emb|CBZ01971.1| ATP synthase C chain [Clostridium botulinum H04402 065] Length = 79 Score = 38.3 bits (88), Expect = 0.32, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 27/60 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 L + N + G R P A+ + ++I + +E+ ++ L++ + L+F I Sbjct: 20 LACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAFSEATAIYGLIIALFLIFKI 79 >gi|313896946|ref|ZP_07830493.1| ATP synthase F0, C subunit [Selenomonas sp. oral taxon 137 str. F0430] gi|320529509|ref|ZP_08030594.1| ATP synthase F0, C subunit [Selenomonas artemidis F0399] gi|312974393|gb|EFR39861.1| ATP synthase F0, C subunit [Selenomonas sp. oral taxon 137 str. F0430] gi|320138220|gb|EFW30117.1| ATP synthase F0, C subunit [Selenomonas artemidis F0399] Length = 83 Score = 38.3 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 14/72 (19%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AA + G+ L + + + ++ G R P A T LI + E++ + Sbjct: 7 VAAALIGAGITMGLAAIGAGIGDGLVTSKFIEGITRQPEAKGVLFTNTLISVGLIEAMAI 66 Query: 79 FLLLVVMLLLFV 90 +V +++L+ Sbjct: 67 IATVVALIMLYA 78 >gi|56791399|gb|AAW30239.1| ATP synthase F0 subunit 9 [Berberis bealei] Length = 66 Score = 38.3 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 24/52 (46%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N+ ++ + RNP A ++ + E++ F ++ L+ FV Sbjct: 14 VGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIASFAPMMAFLISFV 65 >gi|166895630|ref|YP_001661424.1| ATPase subunit 9 [Cycas taitungensis] gi|166706962|dbj|BAF98426.1| ATPase subunit 9 [Cycas taitungensis] Length = 74 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 29/67 (43%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AK + G A + A+ + N+ ++ + RNP A + + E++ LF Sbjct: 4 GAKLIGAGAATIASAGAAVGIGNVLSSSIHPVARNPSLAKQSFGHAISGFALTEAIALFA 63 Query: 81 LLVVMLL 87 ++ L+ Sbjct: 64 SMMAFLI 70 >gi|193891041|gb|ACF28674.1| chloroplast ATP synthase [Amphidinium carterae] gi|193891051|gb|ACF28679.1| chloroplast ATP synthase [Amphidinium carterae] gi|193891064|gb|ACF28685.1| chloroplast ATP synthase [Amphidinium carterae] Length = 143 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 68 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 127 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 128 GLVIALVLLFA 138 >gi|119510743|ref|ZP_01629870.1| ATP synthase subunit C [Nodularia spumigena CCY9414] gi|119464607|gb|EAW45517.1| ATP synthase subunit C [Nodularia spumigena CCY9414] Length = 81 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|56791418|gb|AAW30248.1| ATP synthase F0 subunit 9 [Aloe vera] Length = 59 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 23/46 (50%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+F++ + RNP A ++ + E++ LF L++ Sbjct: 14 VGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMA 59 >gi|56791405|gb|AAW30242.1| ATP synthase F0 subunit 9 [Piper betle] Length = 59 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 23/46 (50%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+F++ + RNP A ++ + E++ LF L++ Sbjct: 14 VGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMA 59 >gi|17227505|ref|NP_484053.1| F0F1 ATP synthase subunit C [Nostoc sp. PCC 7120] gi|75908829|ref|YP_323125.1| F0F1 ATP synthase subunit C [Anabaena variabilis ATCC 29413] gi|114662|sp|P12409|ATPL_ANASP RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123745125|sp|Q3M9V6|ATPL_ANAVT RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|79756|pir||C31090 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - Anabaena sp gi|141999|gb|AAA21987.1| ATP synthase subunit c [Nostoc sp. PCC 7120] gi|17134987|dbj|BAB77533.1| ATP synthase subunit c [Nostoc sp. PCC 7120] gi|75702554|gb|ABA22230.1| ATP synthase F0 subcomplex C subunit [Anabaena variabilis ATCC 29413] Length = 81 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|193891049|gb|ACF28678.1| chloroplast ATP synthase [Amphidinium carterae] Length = 143 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 68 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 127 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 128 GLVIALVLLFA 138 >gi|158520817|ref|YP_001528687.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] gi|158509643|gb|ABW66610.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] Length = 321 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 +A A + G+A L A+ T G R P AA + +L+ Sbjct: 161 SAQPVCPTWAAVIGAGLAVGLAAIGPAIGEGRAAQTACEGIARKPQAAVQITSLMLLGMA 220 Query: 72 IAESLGLFLLLVVMLLLF 89 + ES G++ LL+ ++L+F Sbjct: 221 VTESTGVYGLLISIILVF 238 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/72 (20%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Query: 21 AAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A + G+ LG + + RN A +L+ ++ES G++ Sbjct: 250 AMSLLGAGLCMGLGAIGPGIGEGFAAGEAIKWVGRNEQHAGVLTRTMLVGQAVSESTGIY 309 Query: 80 LLLVVMLLLFVI 91 L+V +++FV+ Sbjct: 310 ALVVAFVMIFVV 321 >gi|113475844|ref|YP_721905.1| F0F1 ATP synthase subunit C [Trichodesmium erythraeum IMS101] gi|123056698|sp|Q112Z2|ATPL_TRIEI RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|110166892|gb|ABG51432.1| ATP synthase F0, C subunit [Trichodesmium erythraeum IMS101] Length = 81 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVSLVLLFA 77 >gi|22297974|ref|NP_681221.1| F0F1 ATP synthase subunit C [Thermosynechococcus elongatus BP-1] gi|22294152|dbj|BAC07983.1| ATP synthase subunit c [Thermosynechococcus elongatus BP-1] Length = 99 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LA N L G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 40 GPGLAQGNASGQALEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFA 94 >gi|56791401|gb|AAW30240.1| ATP synthase F0 subunit 9 [Amborella trichopoda] Length = 59 Score = 38.3 bits (88), Expect = 0.38, Method: Composition-based stats. Identities = 9/46 (19%), Positives = 22/46 (47%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+F++ + RNP A ++ + E++ LF ++ Sbjct: 14 VGIGNVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMA 59 >gi|126653446|ref|ZP_01725542.1| F0F1 ATP synthase subunit C [Bacillus sp. B14905] gi|126589802|gb|EAZ83935.1| F0F1 ATP synthase subunit C [Bacillus sp. B14905] Length = 90 Score = 38.3 bits (88), Expect = 0.38, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 22/47 (46%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 I + + G R P A +T + I + E+L + ++V +++ Sbjct: 42 GLIVSKTVEGIARQPEARGVLQTTMFIGVALVEALPIIAVVVAFIVM 88 >gi|16329331|ref|NP_440059.1| F0F1 ATP synthase subunit C [Synechocystis sp. PCC 6803] gi|114677|sp|P27182|ATPL_SYNY3 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|47509|emb|CAA41131.1| ATPase subunit c [Synechocystis sp. PCC 6803] gi|1651812|dbj|BAA16739.1| ATP synthase subunit c [Synechocystis sp. PCC 6803] Length = 81 Score = 38.3 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 25/56 (44%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLFA 77 >gi|282898195|ref|ZP_06306186.1| ATP synthase F0, C subunit [Raphidiopsis brookii D9] gi|282901086|ref|ZP_06309019.1| ATP synthase subunit c [Cylindrospermopsis raciborskii CS-505] gi|281194177|gb|EFA69141.1| ATP synthase subunit c [Cylindrospermopsis raciborskii CS-505] gi|281196726|gb|EFA71631.1| ATP synthase F0, C subunit [Raphidiopsis brookii D9] Length = 81 Score = 38.3 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|307155271|ref|YP_003890655.1| ATP synthase F0 subunit C [Cyanothece sp. PCC 7822] gi|306985499|gb|ADN17380.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7822] Length = 81 Score = 38.3 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 25/56 (44%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVISLVLLFA 77 >gi|282851607|ref|ZP_06260972.1| ATP synthase F0, C subunit [Lactobacillus gasseri 224-1] gi|300361417|ref|ZP_07057594.1| ATP synthase F0 sector subunit C [Lactobacillus gasseri JV-V03] gi|282557575|gb|EFB63172.1| ATP synthase F0, C subunit [Lactobacillus gasseri 224-1] gi|300354036|gb|EFJ69907.1| ATP synthase F0 sector subunit C [Lactobacillus gasseri JV-V03] Length = 70 Score = 38.3 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 26/51 (50%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P +A+ ++ + I + E++ + +++ L+LF+ Sbjct: 20 GNGKVISKTIEGIARQPESANNLRSTMFIGVGLIEAVPILAIVIGFLILFL 70 >gi|260886474|ref|ZP_05897737.1| ATP synthase F0, C subunit [Selenomonas sputigena ATCC 35185] gi|330839678|ref|YP_004414258.1| ATP synthase F0, C subunit [Selenomonas sputigena ATCC 35185] gi|260863617|gb|EEX78117.1| ATP synthase F0, C subunit [Selenomonas sputigena ATCC 35185] gi|329747442|gb|AEC00799.1| ATP synthase F0, C subunit [Selenomonas sputigena ATCC 35185] Length = 84 Score = 37.9 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 15/72 (20%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +AA + G+ L + + ++ G R P A +A T LI + E++ + Sbjct: 7 VAAALIGAGITMGLAAIGAGIGDGLVTARFIEGITRQPEAKNALFTNTLISVGLIEAMAI 66 Query: 79 FLLLVVMLLLFV 90 +V +++L+ Sbjct: 67 IATVVALIMLYA 78 >gi|222053565|ref|YP_002535927.1| ATP synthase F0, C subunit [Geobacter sp. FRC-32] gi|254809993|sp|B9LZL2|ATPL_GEOSF RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|221562854|gb|ACM18826.1| ATP synthase F0, C subunit [Geobacter sp. FRC-32] Length = 91 Score = 37.9 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG + + + G RNP A+ T ++I + ESL ++ L+V +++LF Sbjct: 15 MALGTLGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYALVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|461591|sp|Q05366|ATPL_SYNP1 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|480488|pir||S36961 H+-transporting two-sector ATPase (EC 3.6.3.14) chain c - Synechococcus sp gi|49215|emb|CAA49871.1| ATP synthase (c) [Synechococcus sp.] Length = 82 Score = 37.9 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 24/55 (43%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 23 GPGIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLFA 77 >gi|189501406|ref|YP_001960876.1| ATP synthase F0, C subunit [Chlorobium phaeobacteroides BS1] gi|189496847|gb|ACE05395.1| ATP synthase F0, C subunit [Chlorobium phaeobacteroides BS1] Length = 78 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Query: 21 AAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A Y+ G+ A L + L + I + G RNP A + +T ++I A + E + LF Sbjct: 8 ALGYLGAGIGAGLAVLGAGLGIGQIAGSACEGTARNPEATADIRTTMIIAAALIEGVALF 67 Query: 80 LLLVVMLLL 88 ++ +LL+ Sbjct: 68 GEVIAVLLV 76 >gi|255614207|ref|XP_002539573.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] gi|223504793|gb|EEF22810.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] Length = 61 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 26/56 (46%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 AK + G A + + A+ + N+F++ + RNP A ++ + E++ Sbjct: 4 GAKSIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAI 59 >gi|58618212|gb|AAW80671.1| chloroplast ATPH isoform 1 [Heterocapsa triquetra] Length = 135 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A +G + A V G A L + + G R P A + +L+ Sbjct: 52 ADDGVWVPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLA 111 Query: 72 IAESLGLFLLLVVMLLLFV 90 ESL ++ L++ ++LLF Sbjct: 112 FMESLTIYGLVIALVLLFA 130 >gi|189095365|ref|YP_001936378.1| ATP synthase CF0 C subunit [Heterosigma akashiwo] gi|223634972|sp|B2XT86|ATPH_HETA2 RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634973|sp|B2XTP2|ATPH_HETA4 RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|157694708|gb|ABV65984.1| ATP synthase CF0 C chain [Heterosigma akashiwo] gi|157777939|gb|ABV70125.1| ATP synthase CF0 C chain [Heterosigma akashiwo] Length = 82 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G++ L + N + G R P A + + +L+ E+L ++ Sbjct: 7 AASVIAAGLSVGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALSLLFA 77 >gi|4713918|gb|AAC45088.2| F1FO ATPase c2 subunit [Acetobacterium woodii DSM 1030] gi|6014715|gb|AAF01475.1| F1FO ATPase c3 subunit [Acetobacterium woodii DSM 1030] Length = 82 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 30/70 (42%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G+A + + R P A S +L+ A +AE+ G++ Sbjct: 9 ACSAIGAGIAMIAGVGPGIGQGFAAGKGAEAVGRQPEAQSDIIRTMLLGAAVAETTGIYG 68 Query: 81 LLVVMLLLFV 90 L+V ++LLF Sbjct: 69 LIVALILLFA 78 >gi|11467019|ref|NP_041926.1| ATP synthase CF0 C subunit [Euglena gracilis] gi|231611|sp|P10603|ATPH_EUGGR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|14380|emb|CAA77930.1| ATP synthase CFo subunit III [Euglena gracilis] gi|415769|emb|CAA50113.1| ATP synthase, CF0-subunit III [Euglena gracilis] Length = 81 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G+A LG + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIGAGLAIGLGAIGPGIGQGTASGKAIEGLARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + ++F Sbjct: 67 GLVVALAIIFA 77 >gi|82702780|ref|YP_412346.1| F0F1 ATP synthase subunit C [Nitrosospira multiformis ATCC 25196] gi|82410845|gb|ABB74954.1| ATP synthase F0 subcomplex C subunit [Nitrosospira multiformis ATCC 25196] Length = 93 Score = 37.9 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 26/59 (44%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ AL T L+ + P A + + I ESL ++ +V M+L+F Sbjct: 21 IGVIGPALGEGKAVATALTSLAQQPDVAGTIARTLFVGLAIIESLAIYCFVVSMILIFA 79 >gi|226968662|ref|YP_002808622.1| ATP synthase CF0 subunit C [Micromonas sp. RCC299] gi|223635056|sp|Q0P3K7|ATPH_OSTTA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|226431140|gb|ACO55546.1| ATP synthase CF0 subunit C [Micromonas sp. RCC299] Length = 82 Score = 37.9 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA V G+A LG + + G R P A + +L+ E+L ++ Sbjct: 7 AASVVGAGLAIGLGAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + L+F Sbjct: 67 GLVVALALMFA 77 >gi|187777258|ref|ZP_02993731.1| hypothetical protein CLOSPO_00810 [Clostridium sporogenes ATCC 15579] gi|187774186|gb|EDU37988.1| hypothetical protein CLOSPO_00810 [Clostridium sporogenes ATCC 15579] Length = 80 Score = 37.9 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 26/57 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 L + N + G R P A+ + +LI + +E+ ++ L+V ++L+ Sbjct: 20 LACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLLIGSAFSEATAIYGLIVALILI 76 >gi|313764224|gb|EFS35588.1| ATP synthase subunit C [Propionibacterium acnes HL013PA1] gi|313791916|gb|EFS40017.1| ATP synthase subunit C [Propionibacterium acnes HL110PA1] gi|313812719|gb|EFS50433.1| ATP synthase subunit C [Propionibacterium acnes HL025PA1] gi|313816317|gb|EFS54031.1| ATP synthase subunit C [Propionibacterium acnes HL059PA1] gi|313822641|gb|EFS60355.1| ATP synthase subunit C [Propionibacterium acnes HL036PA2] gi|314915702|gb|EFS79533.1| ATP synthase subunit C [Propionibacterium acnes HL005PA4] gi|314960556|gb|EFT04658.1| ATP synthase subunit C [Propionibacterium acnes HL002PA2] gi|314962572|gb|EFT06672.1| ATP synthase subunit C [Propionibacterium acnes HL082PA1] gi|314978727|gb|EFT22821.1| ATP synthase subunit C [Propionibacterium acnes HL072PA2] gi|314987895|gb|EFT31986.1| ATP synthase subunit C [Propionibacterium acnes HL005PA2] gi|314989706|gb|EFT33797.1| ATP synthase subunit C [Propionibacterium acnes HL005PA3] gi|315077786|gb|EFT49837.1| ATP synthase subunit C [Propionibacterium acnes HL053PA2] gi|315080413|gb|EFT52389.1| ATP synthase subunit C [Propionibacterium acnes HL078PA1] gi|315084742|gb|EFT56718.1| ATP synthase subunit C [Propionibacterium acnes HL027PA2] gi|315085426|gb|EFT57402.1| ATP synthase subunit C [Propionibacterium acnes HL002PA3] gi|315101467|gb|EFT73443.1| ATP synthase subunit C [Propionibacterium acnes HL046PA1] gi|315105840|gb|EFT77816.1| ATP synthase subunit C [Propionibacterium acnes HL030PA1] gi|315108759|gb|EFT80735.1| ATP synthase subunit C [Propionibacterium acnes HL030PA2] gi|327331715|gb|EGE73452.1| ATP synthase C chain [Propionibacterium acnes HL096PA3] gi|327443491|gb|EGE90145.1| ATP synthase subunit C [Propionibacterium acnes HL013PA2] gi|327445694|gb|EGE92348.1| ATP synthase subunit C [Propionibacterium acnes HL043PA2] gi|327450553|gb|EGE97207.1| ATP synthase subunit C [Propionibacterium acnes HL087PA3] gi|328753970|gb|EGF67586.1| ATP synthase subunit C [Propionibacterium acnes HL087PA1] gi|328754703|gb|EGF68319.1| ATP synthase subunit C [Propionibacterium acnes HL020PA1] gi|328760899|gb|EGF74464.1| ATP synthase C chain [Propionibacterium acnes HL099PA1] Length = 70 Score = 37.9 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L AL V+ IF ++G R P A A T I + E+L LF ++ ++ Sbjct: 14 LAALGPALGVAWIFAAVINGTARQPEARPAMMTTAFIGFAVVEALALFGFILAFIV 69 >gi|266620422|ref|ZP_06113357.1| ATP synthase F0, C subunit [Clostridium hathewayi DSM 13479] gi|288867999|gb|EFD00298.1| ATP synthase F0, C subunit [Clostridium hathewayi DSM 13479] Length = 72 Score = 37.9 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 10/64 (15%), Positives = 27/64 (42%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + + + R P A +L+ +AE+ ++ ++ Sbjct: 5 IGAGIAVLTGVGAGVGIGLATSKAVDAIARQPEAEGKISKSLLLGCALAEATAIYGFVIA 64 Query: 85 MLLL 88 +L++ Sbjct: 65 LLII 68 >gi|193891047|gb|ACF28677.1| chloroplast ATP synthase [Amphidinium carterae] gi|193891053|gb|ACF28680.1| chloroplast ATP synthase [Amphidinium carterae] Length = 143 Score = 37.9 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 68 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 127 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 128 GLVIALVLLFA 138 >gi|224178031|ref|YP_002600943.1| CF0 subunit III of ATP synthase [Pyramimonas parkeae] gi|215882698|gb|ACJ71071.1| CF0 subunit III of ATP synthase [Pyramimonas parkeae] Length = 82 Score = 37.9 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G+A LG + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIGAGLAIGLGAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + ++F Sbjct: 67 GLVVALAIIFA 77 >gi|33329382|gb|AAQ10085.1| ATP synthase subunit c [Bacillus sp. TA2.A1] Length = 70 Score = 37.9 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 25/53 (47%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + VSNI + + G R P + +T + I + E++ + +++ + L Sbjct: 16 GASFGVSNIVSRTIEGIARQPESRGVLQTTMFIGIGLVEAIPIMAVVIAFIAL 68 >gi|91203668|emb|CAJ71321.1| strongly similar to ATPE gene encoding subunit c of ATP synthase [Candidatus Kuenenia stuttgartiensis] Length = 88 Score = 37.9 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 29/65 (44%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 A + +G A A+ N T L R P A+ + + + ES+ ++ ++ + Sbjct: 15 AAFVMAIGGYGPAKALGNALTEALDATARQPEASDKIMRVLFVGMALIESIAIYAFVIAL 74 Query: 86 LLLFV 90 ++LF Sbjct: 75 IVLFA 79 >gi|148266259|ref|YP_001232965.1| ATP synthase F0, C subunit [Geobacter uraniireducens Rf4] gi|224487649|sp|A5G9C4|ATPL_GEOUR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|146399759|gb|ABQ28392.1| ATP synthase F0 subcomplex C subunit [Geobacter uraniireducens Rf4] Length = 91 Score = 37.9 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG + + + G RNP A+ T ++I + ESL ++ L+V +++LF Sbjct: 15 MALGTLGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYALVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|239917338|ref|YP_002956896.1| ATP synthase subunit C [Micrococcus luteus NCTC 2665] gi|281414182|ref|ZP_06245924.1| ATP synthase subunit C [Micrococcus luteus NCTC 2665] gi|289706363|ref|ZP_06502721.1| ATP synthase subunit C [Micrococcus luteus SK58] gi|259585523|sp|C5CA73|ATPL_MICLC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|239838545|gb|ACS30342.1| ATP synthase subunit C [Micrococcus luteus NCTC 2665] gi|289556858|gb|EFD50191.1| ATP synthase subunit C [Micrococcus luteus SK58] Length = 71 Score = 37.9 bits (87), Expect = 0.49, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 + + G+A +G A+ V IF Y++G R P A + L+ +AE+L + Sbjct: 6 SLNMIGYGLAAIG---SAIGVGLIFAAYINGVARQPEAQRILQPIALLGFALAEALAILG 62 Query: 81 LLVVMLL 87 L+ ++ Sbjct: 63 LVFAFVI 69 >gi|118579924|ref|YP_901174.1| ATP synthase F0 subunit C [Pelobacter propionicus DSM 2379] gi|224487617|sp|A1AP46|ATPL2_PELPD RecName: Full=ATP synthase subunit c 2; AltName: Full=ATP synthase F(0) sector subunit c 2; AltName: Full=F-type ATPase subunit c 2; Short=F-ATPase subunit c 2; AltName: Full=Lipid-binding protein 2 gi|118502634|gb|ABK99116.1| ATP synthase F0 subcomplex C subunit [Pelobacter propionicus DSM 2379] Length = 91 Score = 37.9 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G + + + G RNP A+ T ++I + ESL ++ L++ +++LF Sbjct: 15 MAIGTLGTGIGQGLAVKSAVEGVSRNPGASGKIMTTMMIGLAMIESLAIYALVICLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|254488513|ref|ZP_05101718.1| ATP synthase F0, C subunit [Roseobacter sp. GAI101] gi|214045382|gb|EEB86020.1| ATP synthase F0, C subunit [Roseobacter sp. GAI101] Length = 95 Score = 37.9 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 27/60 (45%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 C G AL + L+ + P AAS+ + + + ES ++ +V M+LLF Sbjct: 20 CFGAIGPALGEGRTASAALTAIAQQPDAASSISRTLFVSLAMIESTAIYCFVVAMILLFA 79 >gi|300867814|ref|ZP_07112456.1| ATP synthase subunit c [Oscillatoria sp. PCC 6506] gi|300334145|emb|CBN57628.1| ATP synthase subunit c [Oscillatoria sp. PCC 6506] Length = 81 Score = 37.9 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 26/59 (44%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG + N + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 19 LGAIGPGIGQGNASGQAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFA 77 >gi|171187521|gb|ACB41364.1| ATPase subunit 9 [Mimulus guttatus] Length = 59 Score = 37.9 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 28/59 (47%) Query: 28 GMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 G A + + A+ + N+ ++ + RNP A ++ + E++ LF L++ L Sbjct: 1 GAATIALAGAAVGIGNVSSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFL 59 >gi|332687033|ref|YP_004456807.1| ATP synthase subunit C [Melissococcus plutonius ATCC 35311] gi|332371042|dbj|BAK21998.1| ATP synthase C chain [Melissococcus plutonius ATCC 35311] Length = 70 Score = 37.9 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 11/67 (16%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 24 YVAVGMACLGMG-LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 ++ + LG A + + + R P + +T + I + E++ + ++ Sbjct: 3 FIGAAITVLGAAIGAAYGNGQVISKTIESMTRQPEMSGQLRTTMFIGVALIEAVPILGVV 62 Query: 83 VVMLLLF 89 + +LL+F Sbjct: 63 IALLLVF 69 >gi|197294117|ref|YP_002149738.1| ATP synthase CF0 subunit III [Cicer arietinum] gi|223634958|sp|B5LMM9|ATPH_CICAR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|197089805|gb|ACH41075.1| ATP synthase CF0 subunit III [Cicer arietinum] Length = 81 Score = 37.9 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|300812483|ref|ZP_07092909.1| ATP synthase F0, C subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|300496544|gb|EFK31640.1| ATP synthase F0, C subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] Length = 74 Score = 37.9 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 8/51 (15%), Positives = 24/51 (47%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + R P +A ++ + I + E++ + +++ L+LF+ Sbjct: 24 GNGKVISKTIESIARQPESAGNLRSTMFIGVGLIEAVPILAIVIAFLILFL 74 >gi|255708784|gb|ACU30297.1| ATP synthase subunit 9 [Silene vittata] Length = 56 Score = 37.5 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F+ ++ RNP A ++ + E++ LF L Sbjct: 14 VGIGNVFSALINSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|187764077|ref|YP_001876526.1| ATPase subunit 9 [Dictyostelium fasciculatum] gi|160688785|gb|ABX45200.1| ATPase subunit 9 [Dictyostelium fasciculatum] Length = 87 Score = 37.5 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 31/68 (45%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K V G+A +G+ + V +F ++ NP ++ + E++GL L Sbjct: 19 GKKVGAGLAAIGLAGAGVGVGVVFAAFVLAVSTNPSVRGELFKLAMLGFALTEAVGLLAL 78 Query: 82 LVVMLLLF 89 ++ L+L+ Sbjct: 79 MMSFLILY 86 >gi|154509267|ref|ZP_02044909.1| hypothetical protein ACTODO_01792 [Actinomyces odontolyticus ATCC 17982] gi|293189729|ref|ZP_06608445.1| ATP synthase F0, C subunit [Actinomyces odontolyticus F0309] gi|315604639|ref|ZP_07879702.1| ATP synthase F0 sector subunit C [Actinomyces sp. oral taxon 180 str. F0310] gi|153798901|gb|EDN81321.1| hypothetical protein ACTODO_01792 [Actinomyces odontolyticus ATCC 17982] gi|292821319|gb|EFF80262.1| ATP synthase F0, C subunit [Actinomyces odontolyticus F0309] gi|315313651|gb|EFU61705.1| ATP synthase F0 sector subunit C [Actinomyces sp. oral taxon 180 str. F0310] Length = 69 Score = 37.5 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A Y+ G+A LG L + + R P A T ++I A + E+LGL Sbjct: 5 AFAYIGYGLATLG---PGLGIGLMVGKTQEATARQPEVAGRLFTNMIIGAGMVEALGLIG 61 Query: 81 LLVVMLL 87 ++ +++ Sbjct: 62 FVLPLIV 68 >gi|224368885|ref|YP_002603047.1| AtpE2 [Desulfobacterium autotrophicum HRM2] gi|223691602|gb|ACN14885.1| AtpE2 [Desulfobacterium autotrophicum HRM2] Length = 89 Score = 37.5 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 26/55 (47%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G RNP ++ +LI + ESL ++ L+V ++L++ Sbjct: 21 GCGIGQGMGLSGAVQGIARNPESSGKVTVTLLIGLAMIESLCIYALVVALILIYA 75 >gi|153012208|ref|YP_001381723.1| ATP synthase CF0 subunit III [Medicago truncatula] Length = 81 Score = 37.5 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|186684953|ref|YP_001868149.1| F0F1 ATP synthase subunit C [Nostoc punctiforme PCC 73102] gi|224487655|sp|B2J054|ATPL_NOSP7 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|186467405|gb|ACC83206.1| ATP synthase F0, C subunit [Nostoc punctiforme PCC 73102] Length = 81 Score = 37.5 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 25 GIGQGNAAGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLFA 77 >gi|110598589|ref|ZP_01386857.1| ATP synthase F0, C subunit [Chlorobium ferrooxidans DSM 13031] gi|110339823|gb|EAT58330.1| ATP synthase F0, C subunit [Chlorobium ferrooxidans DSM 13031] Length = 75 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 L Y+ G+ A L + L + NI + G R P AAS +T ++I A + E +GL Sbjct: 4 LGLAYLGAGIGAGLAVIGAGLGIGNIAASATEGTARQPEAASDIRTTMIIAAALIEGVGL 63 Query: 79 FLLLVVMLL 87 F ++ +LL Sbjct: 64 FGEVICVLL 72 >gi|304373016|ref|YP_003856225.1| ATP synthase C chain, sodium ion specific lipid-binding protein [Mycoplasma hyorhinis HUB-1] gi|304309207|gb|ADM21687.1| ATP synthase C chain, sodium ion specific lipid-binding protein [Mycoplasma hyorhinis HUB-1] gi|330723372|gb|AEC45742.1| ATP synthase C chain, sodium ion specific lipid-binding protein [Mycoplasma hyorhinis MCLD] Length = 109 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G + + + RNP + ++I A I+E+ ++ L++ Sbjct: 42 VGAGLAMIGGIGAGVGQGFSASKAIESVGRNPESEKTVFKFMIIGAAISETSAIYSLVIS 101 Query: 85 MLLLFV 90 +LL FV Sbjct: 102 ILLQFV 107 >gi|291518500|emb|CBK73721.1| ATP synthase F0 subcomplex C subunit [Butyrivibrio fibrisolvens 16/4] Length = 73 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 31/67 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A + + + G R P A S + +++ +AE+ ++ ++ Sbjct: 7 VGAGIAVVTGLGAGIGIGIATGKACEGIARQPEAESKIQKNLILGCALAEATAIYGFVIA 66 Query: 85 MLLLFVI 91 ++++FV+ Sbjct: 67 LMIMFVL 73 >gi|218782141|ref|YP_002433459.1| ATP synthase F0 subunit C [Desulfatibacillum alkenivorans AK-01] gi|218763525|gb|ACL05991.1| ATP synthase F0, C subunit [Desulfatibacillum alkenivorans AK-01] Length = 82 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G++ LG + RNP A +L+ ++ES G++ Sbjct: 11 AAGLLGAGISMGLGAIGPGVGEGMAAAKACEAIGRNPKEAGLLTRTMLVGQAVSESTGIY 70 Query: 80 LLLVVMLLLFVI 91 L++ +LLLFV+ Sbjct: 71 SLVIALLLLFVV 82 >gi|322421856|ref|YP_004201079.1| ATP synthase F0 subunit C [Geobacter sp. M18] gi|320128243|gb|ADW15803.1| ATP synthase F0, C subunit [Geobacter sp. M18] Length = 91 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG + + + G RNP A+ T ++I + ESL ++ L+V +++LF Sbjct: 15 MALGTLGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYALVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|157092929|gb|ABV22119.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] Length = 148 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 73 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 132 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 133 GLVIALVLLFA 143 >gi|194476682|ref|YP_002048861.1| ATP synthase subunit C [Paulinella chromatophora] gi|223634990|sp|B1X3Y2|ATPH_PAUCH RecName: Full=ATP synthase subunit C, organellar chromatophore; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|171191689|gb|ACB42651.1| ATP synthase subunit C [Paulinella chromatophora] Length = 82 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGTAAGSAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|161350041|ref|NP_895298.2| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. MIT 9313] gi|224487713|sp|Q7V5S3|ATPL_PROMM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487715|sp|A2C6X1|ATPL_PROM3 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein Length = 82 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A LG + + G R P A + +L+ ESL ++ Sbjct: 7 AASVVAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 GLVVALVLLFA 77 >gi|11466660|ref|NP_066343.1| ATP synthase F0 subunit 9 [Malawimonas jakobiformis] gi|10178698|gb|AAG13710.1|AF295546_36 ATP synthase F0 subunit 9 [Malawimonas jakobiformis] Length = 75 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +AK + G+A +G+ + ++F ++ RNP ++ + E++ F Sbjct: 5 SAKLIGAGLATIGLAGAGAGIGSVFAALINSMARNPSLQKQLFAYAILGFALTEAIAPFA 64 Query: 81 LLVVMLLLFV 90 L++ L+ F Sbjct: 65 LMMASLISFT 74 >gi|58618216|gb|AAW80673.1| chloroplast ATPH isoform 3 [Heterocapsa triquetra] Length = 140 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A +G + A V G A L + + G R P A + +L+ Sbjct: 57 ADDGVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLA 116 Query: 72 IAESLGLFLLLVVMLLLFV 90 ESL ++ L++ ++LLF Sbjct: 117 FMESLTIYGLVIALVLLFA 135 >gi|95929953|ref|ZP_01312693.1| ATP synthase F0, C subunit [Desulfuromonas acetoxidans DSM 684] gi|95133922|gb|EAT15581.1| ATP synthase F0, C subunit [Desulfuromonas acetoxidans DSM 684] Length = 88 Score = 37.5 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G L + + G RNP A+ T ++I + ESL +++ +V M++LF Sbjct: 15 MAIGSFGTGLGQGLAIKSAVEGVARNPSASGKILTTMMIGLAMIESLAIYVFVVAMIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|157166509|gb|ABV25257.1| ATP synthase subunit 9 [Silene vulgaris] Length = 56 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLIXSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|284046071|ref|YP_003396411.1| ATP synthase F0 C subunit [Conexibacter woesei DSM 14684] gi|283950292|gb|ADB53036.1| ATP synthase F0, C subunit [Conexibacter woesei DSM 14684] Length = 92 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 12/82 (14%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Query: 10 TFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLI 68 AA A + + +G+ L + + IF + R P ++ + Sbjct: 11 ALDAARATGETAGRAIGLGLGTGLAALGTGVGLGFIFGKTIEAVSRQPELRDDIQSIQWL 70 Query: 69 FAVIAESLGLFLLLVVMLLLFV 90 + E+ + + ++ FV Sbjct: 71 GFALTEATVFYGFIAGLIAFFV 92 >gi|331701224|ref|YP_004398183.1| ATP synthase subunit c [Lactobacillus buchneri NRRL B-30929] gi|329128567|gb|AEB73120.1| ATP synthase subunit c [Lactobacillus buchneri NRRL B-30929] Length = 70 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 8/50 (16%), Positives = 23/50 (46%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + + + L G R P + ++ + I + E++ + +V +L++ Sbjct: 19 VGDGILISKMLEGMARQPELSGQLRSNMFIGVGLVEAMPIIAFVVALLVM 68 >gi|260586969|ref|ZP_05852882.1| ATP synthase F0, C subunit [Blautia hansenii DSM 20583] gi|331083916|ref|ZP_08333025.1| ATP synthase F0 [Lachnospiraceae bacterium 6_1_63FAA] gi|260542653|gb|EEX23222.1| ATP synthase F0, C subunit [Blautia hansenii DSM 20583] gi|330403341|gb|EGG82901.1| ATP synthase F0 [Lachnospiraceae bacterium 6_1_63FAA] Length = 70 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 29/66 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +A L L + + + R P A S +L+ +AE+ ++ ++ Sbjct: 5 IGASIAVLTGIGAGLGIGHATAKAVEAIARQPEAESKISKALLLGCALAEATAIYGFVIG 64 Query: 85 MLLLFV 90 +L+LF+ Sbjct: 65 LLILFL 70 >gi|320353384|ref|YP_004194723.1| ATP synthase F0 subcomplex subunit C [Desulfobulbus propionicus DSM 2032] gi|320121886|gb|ADW17432.1| ATP synthase F0 subcomplex C subunit [Desulfobulbus propionicus DSM 2032] Length = 92 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 25/60 (41%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG AL + +S + P A+ + + + ES ++ +V M+L+F Sbjct: 20 ALGSIGPALGEARAVAQAISAIAQQPDEANTITRTLFVGLAMIESTAIYCFVVSMILIFA 79 >gi|318042278|ref|ZP_07974234.1| F0F1 ATP synthase subunit C [Synechococcus sp. CB0101] Length = 82 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A LG + + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLGAIGPGIGQGTAAGSAVEGIARQPEADGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 GLVVALVLLFA 77 >gi|126464839|ref|YP_001041815.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides ATCC 17029] gi|221634548|ref|YP_002523236.1| ATP synthase F0, C subunit [Rhodobacter sphaeroides KD131] gi|332561373|ref|ZP_08415688.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides WS8N] gi|224487618|sp|A3PS63|ATPL2_RHOS1 RecName: Full=ATP synthase subunit c 2; AltName: Full=ATP synthase F(0) sector subunit c 2; AltName: Full=F-type ATPase subunit c 2; Short=F-ATPase subunit c 2; AltName: Full=Lipid-binding protein 2 gi|126106654|gb|ABN79179.1| ATP synthase F0, C subunit [Rhodobacter sphaeroides ATCC 17029] gi|221163421|gb|ACM04383.1| ATP synthase F0, C subunit [Rhodobacter sphaeroides KD131] gi|332274172|gb|EGJ19489.1| F0F1 ATP synthase subunit C [Rhodobacter sphaeroides WS8N] Length = 83 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 28/70 (40%), Gaps = 1/70 (1%) Query: 22 AKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + A +G AL + R P AA + + + E++ ++ Sbjct: 9 ASILGAAFAVGIGSLGPALGEGRAVAAAMEAIARQPEAAGTLSRTLFVGLAMIETMAIYC 68 Query: 81 LLVVMLLLFV 90 L++ +LLLF Sbjct: 69 LVIALLLLFA 78 >gi|292491966|ref|YP_003527405.1| alternate F1F0 ATPase, F0 subunit C [Nitrosococcus halophilus Nc4] gi|291580561|gb|ADE15018.1| alternate F1F0 ATPase, F0 subunit C [Nitrosococcus halophilus Nc4] Length = 92 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Query: 25 VAVGMA-CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + G+ +G A+ L + P A + + + ES ++ +V Sbjct: 13 ITAGLTIAIGSIAPAIGEGRAVAQALMAIAQQPDEAGTITRTLFVGLAMVESTAIYCFVV 72 Query: 84 VMLLLFV 90 M+L+F Sbjct: 73 SMILIFA 79 >gi|255016865|ref|ZP_05288991.1| F0F1 ATP synthase subunit C [Listeria monocytogenes FSL F2-515] Length = 59 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 26/57 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 LG + I + + G R P A S ++ + + + E+L + +++ ++L Sbjct: 1 LGALGAGIGNGLIVSKTVEGVARQPEARSMLQSIMFVGVALVEALPIIAVVIAFMVL 57 >gi|256390415|ref|YP_003111979.1| ATP synthase F0 C subunit [Catenulispora acidiphila DSM 44928] gi|256356641|gb|ACU70138.1| ATP synthase F0, C subunit [Catenulispora acidiphila DSM 44928] Length = 81 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G++ +G + V IF + R P AA +T + I + E+L L + Sbjct: 20 FLGYGLSAIG---PGIGVGLIFGNGVQAMARQPEAAGMIRTNMFIGFALTEALALLGFVA 76 Query: 84 VMLL 87 +L Sbjct: 77 PFVL 80 >gi|213964533|ref|ZP_03392733.1| F0F1 ATP synthase subunit C [Corynebacterium amycolatum SK46] gi|213952726|gb|EEB64108.1| F0F1 ATP synthase subunit C [Corynebacterium amycolatum SK46] Length = 84 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 K + G++ LG L + + + G R P A +T + + E+L L Sbjct: 20 GLKTIGYGLSTLG---PGLGIGIVAGKTVEGMARQPEMAGQLRTTMFLGIAFTEALALIG 76 Query: 81 LLVVMLLL 88 L+ + + Sbjct: 77 LVAGFVFV 84 >gi|37522478|ref|NP_925855.1| F0F1 ATP synthase subunit C [Gloeobacter violaceus PCC 7421] gi|81708059|sp|Q7NCR9|ATPL_GLOVI RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|35213479|dbj|BAC90850.1| ATP synthase C chain of CF(0) [Gloeobacter violaceus PCC 7421] Length = 82 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ ESL ++ LLV ++LLF Sbjct: 22 IGPGIGQGNAASKAAEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLLVSIVLLFA 77 >gi|313673431|ref|YP_004051542.1| ATP synthase f0 subcomplex c subunit [Calditerrivibrio nitroreducens DSM 19672] gi|312940187|gb|ADR19379.1| ATP synthase F0 subcomplex C subunit [Calditerrivibrio nitroreducens DSM 19672] Length = 105 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 22 AKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A Y+A G+ + L + + G RNP A+ T ++I + ESL ++ Sbjct: 35 AIYLAAGLGMGIAAFGTGLGQGKAVASAVEGISRNPGASGKIMTPMIIGLAMIESLAIYA 94 Query: 81 LLVVMLLLFVI 91 L++ ++LLFV+ Sbjct: 95 LVISLILLFVV 105 >gi|254422367|ref|ZP_05036085.1| ATP synthase F0, C subunit [Synechococcus sp. PCC 7335] gi|196189856|gb|EDX84820.1| ATP synthase F0, C subunit [Synechococcus sp. PCC 7335] Length = 81 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 25 GIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|28378943|ref|NP_785835.1| F0F1 ATP synthase subunit C [Lactobacillus plantarum WCFS1] gi|254557148|ref|YP_003063565.1| F0F1 ATP synthase subunit C [Lactobacillus plantarum JDM1] gi|300769656|ref|ZP_07079539.1| ATP synthase F0 sector subunit C [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|308181151|ref|YP_003925279.1| F0F1 ATP synthase subunit C [Lactobacillus plantarum subsp. plantarum ST-III] gi|81631033|sp|Q88UT8|ATPL_LACPL RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|28271780|emb|CAD64686.1| H(+)-transporting two-sector ATPase, C subunit [Lactobacillus plantarum WCFS1] gi|254046075|gb|ACT62868.1| F0F1 ATP synthase subunit C [Lactobacillus plantarum JDM1] gi|300492699|gb|EFK27884.1| ATP synthase F0 sector subunit C [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|308046642|gb|ADN99185.1| F0F1 ATP synthase subunit C [Lactobacillus plantarum subsp. plantarum ST-III] Length = 70 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Query: 25 VAVGMACLGMG-LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 +A G+A G + + + L G R P + +T + I + ES+ + +V Sbjct: 4 IAAGIAMFGAALGAGIGNGLVISKMLEGMARQPELSGQLRTNMFIGVGLIESMPIISFVV 63 Query: 84 VMLLL 88 ++++ Sbjct: 64 ALMVM 68 >gi|116328618|ref|YP_798338.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116331347|ref|YP_801065.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] gi|116121362|gb|ABJ79405.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116125036|gb|ABJ76307.1| C subunit of the H(+)-transporting two-sector ATPase, F0 sector [Leptospira borgpetersenii serovar Hardjo-bovis JB197] Length = 100 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 24 YVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ VG+A + + AL + I + G R P A +T ++I A + E LF L+ Sbjct: 7 YIGVGIAAGVAILGAALGIGRIGGSATEGISRQPEAGGKIQTAMIIAAALIEGAALFALV 66 Query: 83 VVM 85 + Sbjct: 67 IAF 69 >gi|8708911|gb|AAF78802.1| Fo ATP synthase subunit C [Bradyrhizobium japonicum] Length = 76 Score = 37.1 bits (85), Expect = 0.71, Method: Composition-based stats. Identities = 30/72 (41%), Positives = 42/72 (58%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AAK + G+AC+GMG + V IF YL+ A NP AA ++ + E+LG+ Sbjct: 3 PAAAKLIGAGIACIGMGGAGVGVGVIFGNYLAAAALNPSAAQGQFGNLIFGFAVTEALGI 62 Query: 79 FLLLVVMLLLFV 90 F LL+ +LLLFV Sbjct: 63 FSLLIALLLLFV 74 >gi|157092931|gb|ABV22120.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] Length = 149 Score = 37.1 bits (85), Expect = 0.71, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 74 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 133 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 134 GLVIALVLLFA 144 >gi|123351550|sp|Q0ZS24|ATPL_CLOPD RecName: Full=ATP synthase subunit c, sodium ion specific; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|77964176|gb|ABB13421.1| ATP synthase subunit c [Clostridium paradoxum] Length = 84 Score = 37.1 bits (85), Expect = 0.71, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 31/71 (43%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LAA + G+A + + + P A +L+ A +AES G++ Sbjct: 7 LAASAIGAGLAMIAGIGPGIGQGFAAGKGAEAVGKQPEAQGDILRTMLLGAAVAESTGIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 ALVVALILLFA 77 >gi|298491948|ref|YP_003722125.1| ATP synthase F0 subunit C ['Nostoc azollae' 0708] gi|298233866|gb|ADI65002.1| ATP synthase F0, C subunit ['Nostoc azollae' 0708] Length = 81 Score = 37.1 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 25 GIGQGNAAGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLFA 77 >gi|269991253|emb|CAX12431.1| ATP synthase CF0 C chain subunit III [Fucus vesiculosus] Length = 82 Score = 37.1 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 24/59 (40%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L + + G R P A + + +L+ E+L ++ L+V + LLF Sbjct: 19 LAAIGPGIGQGTAAGQAVEGIARQPEAENKIRGTLLLSFAFMEALTIYGLVVALALLFA 77 >gi|313606753|gb|EFR83454.1| ATP synthase F0, C subunit [Listeria monocytogenes FSL F2-208] Length = 58 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 25/56 (44%) Query: 33 GMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 G + I + + G R P A S +T + I + E+L + +++ ++L Sbjct: 1 GALGAGIGNGLIVSKTVEGVARQPEARSMLQTIMFIGIGLVEALPIIAVVIAFMVL 56 >gi|219673975|ref|YP_002456460.1| ATP synthase CF0 subunit III [Trifolium subterraneum] gi|193788944|gb|ACF20540.1| ATP synthase CF0 subunit III [Trifolium subterraneum] Length = 81 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|255708764|gb|ACU30287.1| ATP synthase subunit 9 [Silene repens] Length = 56 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 20/43 (46%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F+ + RNP A ++ + E++ LF L Sbjct: 14 VGIGNVFSALIHSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|56791414|gb|AAW30246.1| ATP synthase F0 subunit 9 [Kadsura japonica] Length = 60 Score = 37.1 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 26/59 (44%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 G A + A+ + N+ ++ + RNP A ++ + E++ LF L++ Sbjct: 1 GAGAATIASAGGAVGIGNVLSSSIHSVARNPSLAKQSFGYAILXFALTEAIALFALMMA 59 >gi|315320533|ref|YP_004072589.1| ATP synthase CF0 subunit III C chain [Thalassiosira oceanica CCMP1005] gi|283569006|gb|ADB27543.1| ATP synthase CF0 subunit III C chain [Thalassiosira oceanica CCMP1005] Length = 82 Score = 37.1 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G++ L + N + G R P A + + +L+ E+L ++ Sbjct: 7 AASVIAAGLSIGLAAIGPGIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|297570480|ref|YP_003691824.1| ATP synthase F0, C subunit [Desulfurivibrio alkaliphilus AHT2] gi|296926395|gb|ADH87205.1| ATP synthase F0, C subunit [Desulfurivibrio alkaliphilus AHT2] Length = 116 Score = 37.1 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 27/59 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L + + + +G RNP + +++ AESL +F L++ ++LL+ Sbjct: 49 LAALGCGIGIGVVSGNACAGIARNPEISGKITVTMILGIAFAESLTIFGLVISLILLYA 107 >gi|220906908|ref|YP_002482219.1| F0F1 ATP synthase subunit C [Cyanothece sp. PCC 7425] gi|254809782|sp|B8HPJ7|ATPL_CYAP4 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|219863519|gb|ACL43858.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7425] Length = 82 Score = 37.1 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 25 GIGQGNASGQAVEGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVIALVLLFA 77 >gi|321445270|gb|EFX60642.1| hypothetical protein DAPPUDRAFT_342204 [Daphnia pulex] Length = 60 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 23/56 (41%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 A K + G A + + V + +F + A RNP A L+ + ES+ Sbjct: 4 ARKLIGAGSALIALAGVGAGIGIVFGALIQRARRNPQMAKRLMGYALLGFALCESV 59 >gi|313123402|ref|YP_004033661.1| ATP synthase subunit c [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312279965|gb|ADQ60684.1| ATP synthase subunit c [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|325684409|gb|EGD26577.1| ATP synthase F0 sector subunit C [Lactobacillus delbrueckii subsp. lactis DSM 20072] Length = 74 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 8/51 (15%), Positives = 23/51 (45%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + R P +A + + I + E++ + +++ L+LF+ Sbjct: 24 GNGKVISKTIESIARQPESAGNLRATMFIGVGLIEAVPILAIVIAFLILFL 74 >gi|295697752|ref|YP_003590990.1| ATP synthase F0, C subunit [Bacillus tusciae DSM 2912] gi|295413354|gb|ADG07846.1| ATP synthase F0, C subunit [Bacillus tusciae DSM 2912] Length = 73 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 23/53 (43%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + + + + G R P A +T++ I + E+L + L++ LL Sbjct: 18 GAGIGNGLVISRTIEGIARQPEARGMLQTQMFIGIGLVEALPVISLVMGFLLF 70 >gi|6014714|gb|AAF01474.1| F1FO ATPase c1 subunit [Acetobacterium woodii DSM 1030] Length = 182 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 31/66 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G+A + + +NP ++ +L+ A +AE+ G+F L++ Sbjct: 30 LGIGLAMVAGVGPGIGQGFAAGKGAEAVGKNPTKSNDIVMIMLLGAAVAETSGIFSLVIA 89 Query: 85 MLLLFV 90 ++LLF Sbjct: 90 LILLFA 95 >gi|320096088|ref|ZP_08027688.1| ATP synthase F0 sector subunit C [Actinomyces sp. oral taxon 178 str. F0338] gi|319976968|gb|EFW08711.1| ATP synthase F0 sector subunit C [Actinomyces sp. oral taxon 178 str. F0338] Length = 69 Score = 37.1 bits (85), Expect = 0.82, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A Y+ G+A LG AL + + R P A T ++I A + E+LGL Sbjct: 5 AFAYLGYGLATLG---PALGIGLLVGKTQDATARQPEVAGRLFTNMIIGAGMVEALGLIG 61 Query: 81 LLVVMLL 87 ++ +++ Sbjct: 62 FVLPLIV 68 >gi|301500932|ref|YP_003795397.1| ATP synthase CF0 C subunit [Alveolata sp. CCMP3155] gi|300069478|gb|ADJ66585.1| ATP synthase CF0 C subunit [Chromerida sp. RM11] Length = 86 Score = 37.1 bits (85), Expect = 0.82, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG + + L+G R P + +L+ ESL ++ L+V + LLF Sbjct: 23 LGAIGPGIGQGSAAGDALAGIARQPETEGRVRGVLLLGLAFMESLTIYGLVVALSLLFA 81 >gi|218439576|ref|YP_002377905.1| F0F1 ATP synthase subunit C [Cyanothece sp. PCC 7424] gi|254809783|sp|B7KKR8|ATPL_CYAP7 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|218172304|gb|ACK71037.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 7424] Length = 81 Score = 37.1 bits (85), Expect = 0.83, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 25/56 (44%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFMESLTIYGLVISLVLLFA 77 >gi|314983714|gb|EFT27806.1| ATP synthase subunit C [Propionibacterium acnes HL005PA1] Length = 70 Score = 37.1 bits (85), Expect = 0.86, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 25/56 (44%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L AL V+ IF ++G R P A A T I + E+L LF + ++ Sbjct: 14 LAALGPALGVAWIFAAVINGTARQPEARPAMMTTAFIGFAMVEALALFGFFLAFIV 69 >gi|157092941|gb|ABV22125.1| chloroplast ATP synthase subunit C [Alexandrium affine] gi|157092943|gb|ABV22126.1| chloroplast ATP synthase subunit C [Alexandrium affine] Length = 145 Score = 37.1 bits (85), Expect = 0.86, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 31/83 (37%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A A + A V G A L + + G R P A + +L Sbjct: 58 AAHADEGAIWVPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 117 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 118 LSLAFMESLTIYGLVIALVLLFA 140 >gi|332146779|dbj|BAK19936.1| ApNa+ATPase c subunit [Aphanothece halophytica] Length = 96 Score = 37.1 bits (85), Expect = 0.87, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 22/59 (37%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG A+ L + P A+ + + ES ++ ++ ++L+F Sbjct: 25 LGAIGPAIGEGLALANALRALAQQPDKANTITRTLFVGMAFVESTAIYCFVISIILIFA 83 >gi|218247502|ref|YP_002372873.1| F0F1 ATP synthase subunit C [Cyanothece sp. PCC 8801] gi|257061162|ref|YP_003139050.1| F0F1 ATP synthase subunit C [Cyanothece sp. PCC 8802] gi|254809784|sp|B7K5I4|ATPL_CYAP8 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|218167980|gb|ACK66717.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 8801] gi|256591328|gb|ACV02215.1| ATP synthase F0, C subunit [Cyanothece sp. PCC 8802] Length = 81 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 N +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGFGQGNASGEAVSGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFA 77 >gi|223603|prf||0903182A ATPase DCCD binding subunit Length = 71 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 25/52 (48%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + + G R P + +T + I + E++ + +++ ++L+F + Sbjct: 20 GNGQVISKTIEGMARQPEMSGQLRTTMFIGVALVEAVPILGVVIALILVFAV 71 >gi|238853679|ref|ZP_04644047.1| ATP synthase F0, C subunit [Lactobacillus gasseri 202-4] gi|238833717|gb|EEQ25986.1| ATP synthase F0, C subunit [Lactobacillus gasseri 202-4] Length = 70 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 26/51 (50%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P +A+ ++ + I + E++ + +++ L+LF+ Sbjct: 20 GNGKVISKTIEGIARQPESANNLRSTMFIGVGLIEAVPILAIVMGFLILFL 70 >gi|161507271|ref|YP_001577225.1| F0F1 ATP synthase subunit C [Lactobacillus helveticus DPC 4571] gi|254810005|sp|A8YUJ6|ATPL_LACH4 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|160348260|gb|ABX26934.1| H+-transporting ATP synthase subunit c [Lactobacillus helveticus DPC 4571] Length = 77 Score = 37.1 bits (85), Expect = 0.89, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 24/51 (47%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + L G R P +A + + I + E++ + ++V L+LF+ Sbjct: 27 GNGKVISKTLEGMARQPESADNLRATMFIGVGLIEAVPILAIVVAFLILFL 77 >gi|104773790|ref|YP_618770.1| F0F1 ATP synthase subunit C [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|116513796|ref|YP_812702.1| F0F1 ATP synthase subunit C [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|103422871|emb|CAI97533.1| H+ transporting ATPase / ATP synthase, C subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|116093111|gb|ABJ58264.1| ATP synthase F0 subcomplex C subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|325125454|gb|ADY84784.1| F1F0-ATPase subunit C [Lactobacillus delbrueckii subsp. bulgaricus 2038] Length = 74 Score = 37.1 bits (85), Expect = 0.89, Method: Composition-based stats. Identities = 8/50 (16%), Positives = 22/50 (44%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 + + + R P +A + + I + E++ + +++ L+LF Sbjct: 24 GNGKVISKTIESIARQPESAGNLRATMFIGVGLIEAVPILAIVIAFLILF 73 >gi|322436130|ref|YP_004218342.1| alternate F1F0 ATPase, F0 subunit C [Acidobacterium sp. MP5ACTX9] gi|321163857|gb|ADW69562.1| alternate F1F0 ATPase, F0 subunit C [Acidobacterium sp. MP5ACTX9] Length = 94 Score = 37.1 bits (85), Expect = 0.91, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 27/59 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL T L+ + P A++ + + + ESL ++ +V M+L+F Sbjct: 21 IGCLAPALGEGKSVATALTSLAQQPDASATITRTLFVGLAMIESLAIYCFVVSMILIFA 79 >gi|157166477|gb|ABV25241.1| ATP synthase subunit 9 [Silene vulgaris] Length = 56 Score = 36.7 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLIHSVARNPSLAKLLFGYAILGFALTEAIALFAL 56 >gi|229915402|gb|ACQ90747.1| CF0 subunit III of ATP synthase [Oocystis solitaria] Length = 82 Score = 36.7 bits (84), Expect = 0.92, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G+A L + + G R P A + +L+ ESL ++ Sbjct: 7 AASVIGAGLAVGLAAIGPGVGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 GLVVALVLLFA 77 >gi|227892675|ref|ZP_04010480.1| F0F1 ATP synthase subunit C [Lactobacillus ultunensis DSM 16047] gi|227865546|gb|EEJ72967.1| F0F1 ATP synthase subunit C [Lactobacillus ultunensis DSM 16047] Length = 70 Score = 36.7 bits (84), Expect = 0.92, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 25/53 (47%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + L G R P +A + + I + E++ + ++V L+LF+ Sbjct: 18 SFGNGKVISKTLEGMARQPESAGNLRATMFIGVGLIEAVPILSVVVAFLILFL 70 >gi|150388187|ref|YP_001318236.1| ATP synthase F0, C subunit [Alkaliphilus metalliredigens QYMF] gi|149948049|gb|ABR46577.1| ATP synthase F0, C subunit [Alkaliphilus metalliredigens QYMF] Length = 184 Score = 36.7 bits (84), Expect = 0.92, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 34/71 (47%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA+ +A G+A + + A NP +A + +L+ A +AE+ G+ Sbjct: 24 LASTAIAAGLAMIAGIGPGIGQGFAAGKGAEAASLNPKSAKSASMVMLLGAAVAETSGIL 83 Query: 80 LLLVVMLLLFV 90 L+V +++L+ Sbjct: 84 SLVVALIMLYA 94 >gi|109898984|ref|YP_662239.1| F0F1 ATP synthase subunit C [Pseudoalteromonas atlantica T6c] gi|109701265|gb|ABG41185.1| ATP synthase F0 subcomplex C subunit [Pseudoalteromonas atlantica T6c] Length = 92 Score = 36.7 bits (84), Expect = 0.92, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 25 VAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + G+ +G+ +LA + + L + P A+S + + + ES ++ +V Sbjct: 13 ITAGLTIGIGVLGPSLAEGSAVASALKALAQQPDASSTITRTLFVGLAMIESTAIYCFVV 72 Query: 84 VMLLLF 89 M+LLF Sbjct: 73 SMILLF 78 >gi|260102575|ref|ZP_05752812.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075] gi|260083602|gb|EEW67722.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075] gi|328468719|gb|EGF39701.1| F0F1 ATP synthase subunit C [Lactobacillus helveticus MTCC 5463] Length = 77 Score = 36.7 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 24/51 (47%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + L G R P +A + + I + E++ + +++ L+LF+ Sbjct: 27 GNGKVISKTLEGMARQPESADNLRATMFIGVGLIEAVPILAIVIAFLILFL 77 >gi|89899962|ref|YP_522433.1| F0F1 ATP synthase subunit C [Rhodoferax ferrireducens T118] gi|89344699|gb|ABD68902.1| H+-transporting two-sector ATPase, C subunit [Rhodoferax ferrireducens T118] Length = 93 Score = 36.7 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 16/72 (22%), Positives = 32/72 (44%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 ++A+ +A G ALA T L+ + P A++ + + + ES + Sbjct: 8 AVASIVIAGITTGFGCMGPALAEGRAVATALTALSQQPDASATITRTLFVGLAMIESTAI 67 Query: 79 FLLLVVMLLLFV 90 + +V M+L+F Sbjct: 68 YCFVVSMILIFA 79 >gi|256832998|ref|YP_003161725.1| ATP synthase F0, C subunit [Jonesia denitrificans DSM 20603] gi|256686529|gb|ACV09422.1| ATP synthase F0, C subunit [Jonesia denitrificans DSM 20603] Length = 77 Score = 36.7 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 19/55 (34%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 LG + + + + G R P A +T + I E L L + L Sbjct: 21 LGTLGPGIGLGILIGKTVEGMARQPEVAGQLRTTMFIGVAFVELLALLGFVAGFL 75 >gi|118579284|ref|YP_900534.1| ATP synthase F0 subunit C [Pelobacter propionicus DSM 2379] gi|118501994|gb|ABK98476.1| ATP synthase F0 subcomplex C subunit [Pelobacter propionicus DSM 2379] Length = 88 Score = 36.7 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 20/77 (25%), Positives = 38/77 (49%) Query: 13 AANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVI 72 +A ++ A+ VA+ +G+ A A+ T L R P A + + I + Sbjct: 2 SALFWFVFASTVVALIAMAIGIIAPAKAMGQAICTALESLARQPEAEKSLTRTLFIGLAM 61 Query: 73 AESLGLFLLLVVMLLLF 89 ESL ++ L++V+++LF Sbjct: 62 IESLAIYCLVIVLIVLF 78 >gi|118411027|ref|YP_874422.1| ATP synthase CF0 C chain subunit III [Phaeodactylum tricornutum] gi|223634991|sp|A0T0E7|ATPH_PHATC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|116739774|gb|ABK20645.1| ATP synthase CF0 C chain subunit III [Phaeodactylum tricornutum] Length = 82 Score = 36.7 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G++ L + + G R P A + + +L+ E+L ++ Sbjct: 7 AASVIGAGLSIGLAAIGPGIGQGTAAGQAVEGIARQPEAENKIRGVLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|39995442|ref|NP_951393.1| ATP synthase F0 subunit C [Geobacter sulfurreducens PCA] gi|81703483|sp|Q74GB3|ATPL_GEOSL RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|39982205|gb|AAR33666.1| ATP synthase F0, C subunit [Geobacter sulfurreducens PCA] gi|298504441|gb|ADI83164.1| ATP synthase F0, C subunit [Geobacter sulfurreducens KN400] Length = 91 Score = 36.7 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 29/61 (47%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G + + G RNP A+ T ++I + ESL +++L+V +++LF Sbjct: 15 MAIGAFGTGIGQGLAVKNAVEGVSRNPGASGKILTTMMIGLAMIESLAIYVLVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|33241057|ref|NP_875999.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|72382823|ref|YP_292178.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. NATL2A] gi|124026558|ref|YP_001015673.1| F0F1 ATP synthase subunit C [Prochlorococcus marinus str. NATL1A] gi|81712774|sp|Q7VA59|ATPL_PROMA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123759861|sp|Q46J53|ATPL_PROMT RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487658|sp|A2C4J9|ATPL_PROM1 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487716|sp|A9BCE3|ATPL_PROM4 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|33238586|gb|AAQ00652.1| ATP synthase subunit c [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|72002673|gb|AAZ58475.1| ATP synthase F0 subcomplex C subunit [Prochlorococcus marinus str. NATL2A] gi|123961626|gb|ABM76409.1| ATP synthase subunit c [Prochlorococcus marinus str. NATL1A] Length = 82 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A LG + + + G R P A + +L+ ESL ++ Sbjct: 7 AASVVAAGLAVGLGAIGPGIGQGSAAQGAVEGIARQPEAEGKIRGTLLLSFAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 GLVVALVLLFA 77 >gi|329767913|ref|ZP_08259426.1| hypothetical protein HMPREF0428_01123 [Gemella haemolysans M341] gi|328838619|gb|EGF88220.1| hypothetical protein HMPREF0428_01123 [Gemella haemolysans M341] Length = 71 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 7/47 (14%), Positives = 21/47 (44%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 +F ++ G R P K+ + + E++ + +++ ++L Sbjct: 23 GYLFGKFMEGVSRQPEVEPKLKSNAFVMFALVEAVPILAVVIAFIIL 69 >gi|332992893|gb|AEF02948.1| F0F1 ATP synthase subunit C [Alteromonas sp. SN2] Length = 92 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 25 VAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + G+ +G+ +LA + L+ + P A+ + + + ES ++ +V Sbjct: 13 ITAGLTIGIGVLGPSLAEGKAVASALNALAQQPDASPTITRTLFVGLAMIESTAIYCFVV 72 Query: 84 VMLLLF 89 M++LF Sbjct: 73 SMIVLF 78 >gi|268679241|ref|YP_003303672.1| ATP synthase F0 C subunit [Sulfurospirillum deleyianum DSM 6946] gi|268617272|gb|ACZ11637.1| ATP synthase F0, C subunit [Sulfurospirillum deleyianum DSM 6946] Length = 100 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 28/58 (48%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 L A+ + N + +SG RNP T + I + E+ ++ L++ ++LL+ Sbjct: 37 LAAFGAAIGMGNTASAAISGTARNPGIGGKLVTTMFIALAMIEAQVIYALVIALILLY 94 >gi|330469849|ref|YP_004407592.1| ATP synthase F0 subunit C [Verrucosispora maris AB-18-032] gi|328812820|gb|AEB46992.1| ATP synthase F0, C subunit [Verrucosispora maris AB-18-032] Length = 73 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V+ +F Y+ + R P +A ++T +++ + E+L LF L++ Sbjct: 14 IGYGLAAIG---PGIGVALVFAAYIQASARQPESAGYNRTWLVLGFALVEALALFGLVLA 70 Query: 85 M 85 Sbjct: 71 F 71 >gi|317495900|ref|ZP_07954263.1| ATP synthase subunit C [Gemella moribillum M424] gi|316914077|gb|EFV35560.1| ATP synthase subunit C [Gemella moribillum M424] Length = 71 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 7/47 (14%), Positives = 21/47 (44%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 +F ++ G R P K+ + + E++ + +++ ++L Sbjct: 23 GYLFGKFMEGVSRQPEVEPKLKSNAFVMFALVEAVPILAIVIAFIIL 69 >gi|317125560|ref|YP_004099672.1| ATP synthase F0 C subunit [Intrasporangium calvum DSM 43043] gi|315589648|gb|ADU48945.1| ATP synthase F0 subcomplex C subunit [Intrasporangium calvum DSM 43043] Length = 66 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 28/55 (50%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 L A+AV IF Y++G R P + + ++ +AE+L +F L++ L Sbjct: 12 LATIGPAIAVGLIFAAYINGVARQPESGKLLQPIAILGFALAEALAIFGLVLFFL 66 >gi|332701905|ref|ZP_08421993.1| ATP synthase subunit c [Desulfovibrio africanus str. Walvis Bay] gi|332552054|gb|EGJ49098.1| ATP synthase subunit c [Desulfovibrio africanus str. Walvis Bay] Length = 98 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 27/59 (45%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G A+ ++ LS + P S+ + + + ES ++ L+V M+L+F Sbjct: 21 IGAIGPAIGEGLAVSSALSAMAQQPDETSSITRTLFVGLAMIESTAIYCLVVAMILIFA 79 >gi|257094254|ref|YP_003167895.1| H+transporting two-sector ATPase subunit C [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257046778|gb|ACV35966.1| H+transporting two-sector ATPase C subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 88 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 28/52 (53%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 A+A+ T L R P A + + I + ESL +++L++V+++LF Sbjct: 27 AIAMGRAITQALEALSRQPEAEKSITRTLFIGLAMIESLAIYVLVIVLIILF 78 >gi|167768333|ref|ZP_02440386.1| hypothetical protein CLOSS21_02889 [Clostridium sp. SS2/1] gi|317497739|ref|ZP_07956053.1| ATP synthase subunit C [Lachnospiraceae bacterium 5_1_63FAA] gi|167709857|gb|EDS20436.1| hypothetical protein CLOSS21_02889 [Clostridium sp. SS2/1] gi|291560307|emb|CBL39107.1| ATP synthase F0 subcomplex C subunit [butyrate-producing bacterium SSC/2] gi|316894989|gb|EFV17157.1| ATP synthase subunit C [Lachnospiraceae bacterium 5_1_63FAA] Length = 87 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/73 (20%), Positives = 32/73 (43%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + L + G+A + + + RNP A + +L+ +AE+ G Sbjct: 8 FVLGCSAIGAGLALIAGIGPGVGQGYAAGQGAAAVGRNPGAKGDITSTMLLGQAVAETTG 67 Query: 78 LFLLLVVMLLLFV 90 L+ L++ ++LL+ Sbjct: 68 LYGLVIGLILLYA 80 >gi|2605824|gb|AAC38054.1| ATP synthase c subunit [Methanosarcina barkeri] Length = 91 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 A+ T LS + P A++ + + + ESL ++ +V M+L+F Sbjct: 30 AIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLAIYCFVVSMILIFA 82 >gi|218283207|ref|ZP_03489277.1| hypothetical protein EUBIFOR_01865 [Eubacterium biforme DSM 3989] gi|218216025|gb|EEC89563.1| hypothetical protein EUBIFOR_01865 [Eubacterium biforme DSM 3989] Length = 75 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 35/67 (52%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + VGMA L + L + ++ + + P A ++ +LI A +AE+ ++ ++ Sbjct: 8 IGVGMAALAVIGGGLGIGFATSSAVKAIAQQPEAHGKIRSTLLIGAALAEATAIYGFVLG 67 Query: 85 MLLLFVI 91 +L++ ++ Sbjct: 68 ILIILMV 74 >gi|170077361|ref|YP_001733999.1| F0F1 ATP synthase subunit C [Synechococcus sp. PCC 7002] gi|224487668|sp|B1XHZ2|ATPL_SYNP2 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|169885030|gb|ACA98743.1| ATP synthase C chain (Lipid-binding protein) [Synechococcus sp. PCC 7002] Length = 81 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGNAAGSAAEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|309322115|ref|YP_003933931.1| ATP synthase CF0 subunit III [Erodium texanum] gi|197132324|gb|ACH47680.1| ATP synthase CF0 subunit III [Erodium texanum] gi|300069208|gb|ADJ66330.1| ATP synthase CF0 subunit III [Erodium texanum] Length = 81 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + L G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQALEGISRQPSAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|308177042|ref|YP_003916448.1| H(+)-transporting two-sector ATPase subunit C [Arthrobacter arilaitensis Re117] gi|307744505|emb|CBT75477.1| H(+)-transporting two-sector ATPase, chain C [Arthrobacter arilaitensis Re117] Length = 70 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 + + G+A +G A+ V IF Y++G R P A + ++ +AE+L + Sbjct: 5 SLNMIGYGLAAIG---SAIGVGLIFAAYINGVARQPEAQRILQPIAMLGFALAEALAILG 61 Query: 81 LLVVMLL 87 L+ ++ Sbjct: 62 LVFAFVI 68 >gi|197107680|gb|ACH42420.1| ATP synthase subunit 9 [Saccorhiza dermatodea] Length = 45 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 8/45 (17%), Positives = 17/45 (37%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 + + +F + G RNP ++ + E++ LF Sbjct: 1 AGAGVGIGTVFGALVLGTARNPSLKDELFRIAILGFALTEAIALF 45 >gi|300785935|ref|YP_003766226.1| F-type H+-transporting ATPase subunit c [Amycolatopsis mediterranei U32] gi|299795449|gb|ADJ45824.1| F-type H+-transporting ATPase subunit c [Amycolatopsis mediterranei U32] Length = 81 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 LG + V IF ++G R P A +T V++E L L ++V + Sbjct: 23 LGAIGPGIGVGLIFAAVINGTARQPEARGKLQTMGYSTFVLSEVLALIGVVVYFI 77 >gi|242279699|ref|YP_002991828.1| F0F1 ATP synthase subunit C [Desulfovibrio salexigens DSM 2638] gi|242122593|gb|ACS80289.1| alternate F1F0 ATPase, F0 subunit C [Desulfovibrio salexigens DSM 2638] Length = 92 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 25 VAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 +A G+ +G A+ + LS + P + + + + ES ++ ++ Sbjct: 13 IAAGLCMGIGAIGPAIGEGMALSRALSSIAQQPDETNTIVKFLFVGMAMVESTAIYCFVL 72 Query: 84 VMLLLFV 90 M+LLF Sbjct: 73 AMILLFA 79 >gi|78224550|ref|YP_386297.1| ATP synthase F0 subunit C [Geobacter metallireducens GS-15] gi|123742765|sp|Q39QA2|ATPL_GEOMG RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|78195805|gb|ABB33572.1| ATP synthase F0 subcomplex C subunit [Geobacter metallireducens GS-15] Length = 91 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 30/61 (49%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G + + + G RNP A+ T ++I + ESL +++L+V +++LF Sbjct: 15 MAIGAFGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYVLVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|158312873|ref|YP_001505381.1| H+transporting two-sector ATPase C subunit [Frankia sp. EAN1pec] gi|158108278|gb|ABW10475.1| H+transporting two-sector ATPase C subunit [Frankia sp. EAN1pec] Length = 82 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 21/62 (33%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + V IF + R P A +LI + E+L L +V Sbjct: 19 IGTVAYGIATLGPGIGVGIIFGLGIQAIARQPEAEQVAFRYMLIGFAVVEALALIGFVVP 78 Query: 85 ML 86 + Sbjct: 79 FV 80 >gi|269101098|ref|YP_003289246.1| ATP synthase CF0, subunit C [Ectocarpus siliculosus] gi|266631606|emb|CAV31277.1| ATP synthase CF0, subunit C [Ectocarpus siliculosus] gi|270118736|emb|CAT18817.1| ATP synthase CF0, subunit C [Ectocarpus siliculosus] Length = 82 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + + +L+ E+L ++ L+V + LLF Sbjct: 22 IGPGIGQGTAAGQAVEGIARQPEAENKIRGTLLLSFAFMEALTIYGLVVALALLFA 77 >gi|157092933|gb|ABV22121.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] Length = 149 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 74 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 133 Query: 80 LLLVVMLLLFV 90 L++ ++LLF Sbjct: 134 GLVIALVLLFA 144 >gi|187763102|ref|YP_001876577.1| ATP synthase CF0 subunit III [Welwitschia mirabilis] gi|222084188|ref|YP_002519782.1| ATP synthase CF0 C chain [Gnetum parvifolium] gi|223634969|sp|A6BM12|ATPH_GNEPA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634998|sp|B2Y1W0|ATPH_WELMI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|149941380|dbj|BAF64857.1| ATP synthase CF0 C subunit [Gnetum parvifolium] gi|163311632|gb|ABY26790.1| ATP synthase CF0 subunit III [Welwitschia mirabilis] gi|220983525|dbj|BAH11293.1| ATP synthase CF0 C chain [Gnetum parvifolium] Length = 81 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + L G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|215434287|gb|ACJ66834.1| ATP synthase F0 C subunit [uncultured bacterium pSY1435] Length = 84 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 29/60 (48%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG ALA L R P AAS+ + + + ES+ +++L++ ++LLF Sbjct: 20 TLGTIGPALAEGKAVIAGLDAIARQPEAASSISRTLFVGLAMVESMAIYVLVITLVLLFA 79 >gi|194335034|ref|YP_002016894.1| ATP synthase F0 subunit C [Prosthecochloris aestuarii DSM 271] gi|194312852|gb|ACF47247.1| ATP synthase F0, C subunit [Prosthecochloris aestuarii DSM 271] Length = 78 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Query: 24 YVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ G+ A L + L + NI ++ G R P A S +T ++I A + E + LF + Sbjct: 11 YLGAGIGAGLAVIGAGLGIGNIASSAAEGTARQPEATSDIRTTMIIAAALIEGVALFGEV 70 Query: 83 VVMLL 87 + +LL Sbjct: 71 ICVLL 75 >gi|302869583|ref|YP_003838220.1| H+transporting two-sector ATPase subunit C [Micromonospora aurantiaca ATCC 27029] gi|315503955|ref|YP_004082842.1| h+transporting two-sector atpase c subunit [Micromonospora sp. L5] gi|302572442|gb|ADL48644.1| H+transporting two-sector ATPase C subunit [Micromonospora aurantiaca ATCC 27029] gi|315410574|gb|ADU08691.1| H+transporting two-sector ATPase C subunit [Micromonospora sp. L5] Length = 77 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V +F+ Y+ R P ++ V I + E+L L + Sbjct: 14 IGYGLAAIG---PGIGVGLVFSAYIQSTARQPESSRMTLPYVWIGFAVIEALALLGIAFG 70 Query: 85 ML 86 + Sbjct: 71 FI 72 >gi|119503560|ref|ZP_01625643.1| F-type H+-transporting ATPase c chain [marine gamma proteobacterium HTCC2080] gi|119460622|gb|EAW41714.1| F-type H+-transporting ATPase c chain [marine gamma proteobacterium HTCC2080] Length = 75 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 30/66 (45%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 A M LG A+ V + + G+ R P A + + A + +++ + + + M Sbjct: 8 AAIMMGLGGMGAAIGVGILGGKLIEGSARQPELAPKLQGTFFLGAGLVDAIPIIGVGIAM 67 Query: 86 LLLFVI 91 L+FV+ Sbjct: 68 YLIFVV 73 >gi|157092935|gb|ABV22122.1| chloroplast ATP synthase subunit C [Alexandrium tamarense] Length = 148 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 19/87 (21%), Positives = 33/87 (37%), Gaps = 1/87 (1%) Query: 5 MMEAATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHK 63 ++ A A + A V G A L + + G R P A + Sbjct: 57 VLPTAAHAEGGSVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLR 116 Query: 64 TEVLIFAVIAESLGLFLLLVVMLLLFV 90 +L+ ESL ++ L++ ++LLF Sbjct: 117 GVLLLSLAFMESLTIYGLVIALVLLFA 143 >gi|152995983|ref|YP_001340818.1| F0F1 ATP synthase subunit C [Marinomonas sp. MWYL1] gi|150836907|gb|ABR70883.1| ATP synthase F0, C subunit [Marinomonas sp. MWYL1] Length = 93 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 27/60 (45%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G+ +L T L+ + P A++ + + + ES ++ +V M+LLF Sbjct: 20 AIGVLGPSLGEGKAVATALTSLAQQPDASATITRTLFVGLAMIESTAIYCFVVSMILLFA 79 >gi|84494531|ref|ZP_00993650.1| ATP synthase C chain [Janibacter sp. HTCC2649] gi|84384024|gb|EAP99904.1| ATP synthase C chain [Janibacter sp. HTCC2649] Length = 70 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ G+A +G + V IF Y++G R P A +T I E+L + L+ Sbjct: 8 FLGYGLAAIG---PGIGVGLIFAAYINGVARQPEARGMLQTIAFTGMAITEALAILGLVF 64 Query: 84 VML 86 + Sbjct: 65 AFV 67 >gi|291280110|ref|YP_003496945.1| hypothetical protein DEFDS_1734 [Deferribacter desulfuricans SSM1] gi|290754812|dbj|BAI81189.1| hypothetical protein [Deferribacter desulfuricans SSM1] Length = 106 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKT 64 M A A G A Y+A G+ + L + + G RNP A+ T Sbjct: 19 MSAFASEGAAGGNYKWAIYLAAGLGIGIAAFGTGLGQGRAVGSAVEGISRNPSASGKIMT 78 Query: 65 EVLIFAVIAESLGLFLLLVVMLLLFVI 91 +++ + ESL ++ L++ ++LLFV+ Sbjct: 79 SMIVGLAMIESLAIYALVICLILLFVV 105 >gi|295136944|ref|YP_003587777.1| ATP synthase CFO C subunit [Lathyrus sativus] gi|295137016|ref|YP_003587563.1| ATP synthase CFO C subunit [Pisum sativum] gi|114651|sp|P08212|ATPH_PEA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|311714|emb|CAA29350.1| atpH protein [Pisum sativum] gi|552815|gb|AAA84541.1| ATP synthase CF0 subunit III [Pisum sativum] gi|293338588|gb|ADE43561.1| ATP synthase CFO C subunit [Pisum sativum] gi|293338666|gb|ADE43638.1| ATP synthase CFO C subunit [Lathyrus sativus] Length = 81 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|226944083|ref|YP_002799156.1| F0F1 ATP synthase subunit C [Azotobacter vinelandii DJ] gi|226719010|gb|ACO78181.1| ATP synthase F0, C subunit [Azotobacter vinelandii DJ] Length = 82 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 25 VAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + +A G ALA + R P AA + + + E++ ++ L+V Sbjct: 11 LGAALAVSFGALGPALAEGRAVAAAMDAIARQPEAAGTLSRTLFVGLAMIETMAIYCLVV 70 Query: 84 VMLLLFV 90 +LLLF Sbjct: 71 AVLLLFA 77 >gi|225378692|ref|ZP_03755913.1| hypothetical protein ROSEINA2194_04362 [Roseburia inulinivorans DSM 16841] gi|225209529|gb|EEG91883.1| hypothetical protein ROSEINA2194_04362 [Roseburia inulinivorans DSM 16841] Length = 84 Score = 36.4 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 21/71 (29%), Positives = 33/71 (46%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA + G+A + + + RNP A + +L+ +AE+ GL+ Sbjct: 10 LACSAIGAGLAVIAGIGPGIGQGIAAGHAAAAVGRNPGAKGDIMSTMLLGQAVAETTGLY 69 Query: 80 LLLVVMLLLFV 90 LL+ MLLLFV Sbjct: 70 GLLIAMLLLFV 80 >gi|162447841|ref|YP_001620973.1| F-type H+-transporting ATPase subunit C [Acholeplasma laidlawii PG-8A] gi|224487619|sp|A9NGW7|ATPL_ACHLI RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|161985948|gb|ABX81597.1| F-type H+-transporting ATPase c chain [Acholeplasma laidlawii PG-8A] Length = 86 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 12/71 (16%), Positives = 31/71 (43%) Query: 17 YYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESL 76 +++ Y+ G++ L GL + + R P A+ +++ + E+ Sbjct: 13 FFATGLAYLGAGISILAAGLAGIGQGLAAARAVEAVGRQPEASGKITVTMILGQAMVETS 72 Query: 77 GLFLLLVVMLL 87 G++ L++ +L Sbjct: 73 GIYALIIAFIL 83 >gi|58618214|gb|AAW80672.1| chloroplast ATPH isoform 2 [Heterocapsa triquetra] Length = 140 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A +G + A V G A L + + G R P A + +L+ Sbjct: 57 ADDGVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLA 116 Query: 72 IAESLGLFLLLVVMLLLFV 90 ESL ++ L++ ++LLF Sbjct: 117 FMESLTIYGLVIALVLLFA 135 >gi|294786381|ref|ZP_06751635.1| ATP synthase F0, C subunit [Parascardovia denticolens F0305] gi|315225942|ref|ZP_07867730.1| ATP synthase F0 sector subunit C [Parascardovia denticolens DSM 10105] gi|294485214|gb|EFG32848.1| ATP synthase F0, C subunit [Parascardovia denticolens F0305] gi|315120074|gb|EFT83206.1| ATP synthase F0 sector subunit C [Parascardovia denticolens DSM 10105] Length = 76 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A LG ++ + IF L R P ++ T + I + E LGL + Sbjct: 16 LGYGLATLG---PSIGLGMIFGKALESTARQPEVSNKLNTIMYIGFAVVEVLGLLGFVTF 72 Query: 85 ML 86 ++ Sbjct: 73 LM 74 >gi|224487711|sp|Q8DLP7|ATPL_THEEB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein Length = 82 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LA N L G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 23 GPGLAQGNASGQALEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVIALVLLFA 77 >gi|218194451|gb|EEC76878.1| hypothetical protein OsI_15082 [Oryza sativa Indica Group] Length = 548 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 29/62 (46%) Query: 29 MACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + LG ++ ++ + YL + R P + +T++ I A + ++ L + + +L Sbjct: 187 IVGLGAIGASIGIALMGGKYLEASARQPELINELQTKMFILAGLIDAAFLIGVAIALLFA 246 Query: 89 FV 90 F Sbjct: 247 FA 248 >gi|58613491|gb|AAW79332.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] Length = 140 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A +G + A V G A L + + G R P A + +L+ Sbjct: 57 ADDGVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLA 116 Query: 72 IAESLGLFLLLVVMLLLFV 90 ESL ++ L++ ++LLF Sbjct: 117 FMESLTIYGLVIALVLLFA 135 >gi|150251445|ref|YP_001312178.1| ATP synthase CF0 C chain [Cycas taitungensis] gi|223634965|sp|A6H5F3|ATPH_CYCTA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|149941495|dbj|BAF64919.1| ATP synthase CF0 C chain [Cycas taitungensis] gi|156597943|gb|ABU85239.1| ATP synthase CF0 subunit III [Cycas micronesica] Length = 81 Score = 36.4 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|114650|sp|P28530|ATPH_PAVLU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|12112|emb|CAA45997.1| ATPase subunit [Pavlova lutheri] gi|228856|prf||1813203B atpH gene Length = 83 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G++ L + + L G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLSVGLAAIGPGIGQGSAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALSLLFA 77 >gi|194033269|ref|YP_002000386.1| ATP synthase CF0 C subunit [Oedogonium cardiacum] gi|223634984|sp|B2X1U7|ATPH_OEDCA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|156618966|gb|ABU88160.1| ATP synthase CF0 subunit III [Oedogonium cardiacum] gi|186968886|gb|ACC97209.1| CF0 subunit III of ATP synthase [Oedogonium cardiacum] Length = 83 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P A + +L+ ESL ++ L+V + LLF Sbjct: 25 GVGQGTVAGNAVEGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVVALALLFA 77 >gi|108796777|ref|YP_636450.1| ATP synthase CF0 C subunit [Staurastrum punctulatum] gi|122226725|sp|Q32RS6|ATPH_STAPU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|61393545|gb|AAX45686.1| CF0 subunit III of ATP synthase [Staurastrum punctulatum] Length = 81 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|11466377|ref|NP_038380.1| ATP synthase CF0 C subunit [Mesostigma viride] gi|12585190|sp|Q9MUT0|ATPH_MESVI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|7259520|gb|AAF43821.1|AF166114_33 CF0 subunit III of ATP synthase [Mesostigma viride] Length = 82 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + L G R P A + +L+ ESL ++ Sbjct: 7 AASVLAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSFAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|189426192|ref|YP_001953369.1| ATP synthase F0 C subunit [Geobacter lovleyi SZ] gi|224487647|sp|B3E9X4|ATPL_GEOLS RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|189422451|gb|ACD96849.1| ATP synthase F0, C subunit [Geobacter lovleyi SZ] Length = 91 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 30/61 (49%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G + + + G RNP A+ T ++I + ESL +++L+V +++LF Sbjct: 15 MAIGAFGTGIGQGLAVKSAVEGVSRNPGASGKILTTMMIGLAMIESLAIYVLVVCLIILF 74 Query: 90 V 90 Sbjct: 75 A 75 >gi|284992521|ref|YP_003411075.1| ATP synthase F0 subunit C [Geodermatophilus obscurus DSM 43160] gi|284065766|gb|ADB76704.1| ATP synthase F0, C subunit [Geodermatophilus obscurus DSM 43160] Length = 75 Score = 36.4 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G + V ++ Y+ R P +A +T + A ++E+L L L+V Sbjct: 14 VGYGLAAIG---PGIGVGIVWAAYIQATARQPESAGLTRTYAFLGAALSEALALIGLVVP 70 Query: 85 ML 86 + Sbjct: 71 FI 72 >gi|317968978|ref|ZP_07970368.1| F0F1 ATP synthase subunit C [Synechococcus sp. CB0205] Length = 82 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A LG + + G R P A + +L+ E+L ++ Sbjct: 7 AASVVAAGLAVGLGAIGPGIGQGTAAGGAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V ++LLF Sbjct: 67 GLVVALVLLFA 77 >gi|158334076|ref|YP_001515248.1| F0F1 ATP synthase subunit C [Acaryochloris marina MBIC11017] gi|158304317|gb|ABW25934.1| ATP synthase F0, C subunit [Acaryochloris marina MBIC11017] Length = 81 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 +G++ +G ALA N + G R P A + +L+ ESL ++ L++ + Sbjct: 16 GIGISTIG---PALAQGNAAGKAVEGIARQPEAEGKIRGTLLLCLAFMESLTIYGLVIAL 72 Query: 86 LLLFV 90 +LLF Sbjct: 73 VLLFA 77 >gi|313904299|ref|ZP_07837677.1| ATP synthase F0, C subunit [Eubacterium cellulosolvens 6] gi|313470849|gb|EFR66173.1| ATP synthase F0, C subunit [Eubacterium cellulosolvens 6] Length = 73 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 25/57 (43%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 L + + R P A +L+ + +AE+ ++ ++ +L++F++ Sbjct: 16 IGAGLGIGIATAHAVDAIARQPEADGKIMKNLLLGSALAEATAIYGFVLGVLIIFMV 72 >gi|222139888|ref|YP_002519955.1| ATP synthase CF0 C chain [Ephedra equisetina] gi|220983556|dbj|BAH11323.1| ATP synthase CF0 C chain [Ephedra equisetina] Length = 81 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + L G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQALEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|227874293|ref|ZP_03992481.1| sodium-transporting two-sector ATPase [Oribacterium sinus F0268] gi|227839867|gb|EEJ50309.1| sodium-transporting two-sector ATPase [Oribacterium sinus F0268] Length = 93 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N L R P + +L+ IAE+ G++ + +LL+FV Sbjct: 28 IGPGIGEGNAVAKALEAIGRQPECKGDVTSTMLLGCAIAETTGIYGFVTGLLLIFV 83 >gi|108773237|ref|YP_635717.1| ATP synthase CF0 C subunit [Chara vulgaris] gi|122224970|sp|Q1ACN0|ATPH_CHAVU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|77157893|gb|ABA61934.1| CF0 subunit III of ATP synthase [Chara vulgaris] gi|290490338|gb|ADD31576.1| ATP synthase CF0 subunit III protein [Ximenia americana] Length = 81 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLSSIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|288922990|ref|ZP_06417147.1| H+transporting two-sector ATPase C subunit [Frankia sp. EUN1f] gi|288345666|gb|EFC80038.1| H+transporting two-sector ATPase C subunit [Frankia sp. EUN1f] Length = 82 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 21/62 (33%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + V IF + R P A +LI + E+L L +V Sbjct: 19 IGTVAYGIATLGPGIGVGIIFGLGVQAIARQPEAEQVAFRYMLIGFAVVEALALIGFVVP 78 Query: 85 ML 86 + Sbjct: 79 FV 80 >gi|224179487|ref|YP_002601012.1| CF0 subunit III of ATP synthase [Monomastix sp. OKE-1] gi|217314530|gb|ACK36873.1| CF0 subunit III of ATP synthase [Monomastix sp. OKE-1] Length = 82 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA V G+A LG + + G R P A + +L+ E+L ++ Sbjct: 7 AASVVGAGLAIGLGAIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|157092951|gb|ABV22130.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] Length = 140 Score = 36.4 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A +G + A V G A L + + G R P A + +L+ Sbjct: 57 ADDGVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLA 116 Query: 72 IAESLGLFLLLVVMLLLFV 90 ESL ++ L++ ++LLF Sbjct: 117 FMESLTIYGLVIALVLLFA 135 >gi|310689665|pdb|2XQT|A Chain A, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689666|pdb|2XQT|B Chain B, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689667|pdb|2XQT|C Chain C, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689668|pdb|2XQT|D Chain D, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases gi|310689669|pdb|2XQT|E Chain E, Microscopic Rotary Mechanism Of Ion Translocation In The Fo Complex Of Atp Synthases Length = 82 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 24/59 (40%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G L + G R P A + +L+ +L ++ L+V ++LLF Sbjct: 20 IGSIGPGLGQGQAAGQAVEGIARQPEAEGKIRGTLLLSLAFMXALTIYGLVVALVLLFA 78 >gi|294828181|ref|NP_712963.2| ATP synthase C chain [Leptospira interrogans serovar Lai str. 56601] gi|293386030|gb|AAN49981.2| ATP synthase C chain [Leptospira interrogans serovar Lai str. 56601] Length = 99 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 24 YVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ VG+A + + AL + I + G R P A +T ++I A + E LF L+ Sbjct: 7 YIGVGIAAGVAILGAALGIGRIGGSATEGISRQPEAGGKIQTAMIIAAALIEGAALFALV 66 Query: 83 VVM 85 + Sbjct: 67 IAF 69 >gi|56751190|ref|YP_171891.1| F0F1 ATP synthase subunit C [Synechococcus elongatus PCC 6301] gi|81299143|ref|YP_399351.1| F0F1 ATP synthase subunit C [Synechococcus elongatus PCC 7942] gi|114676|sp|P08445|ATPL_SYNP6 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123769312|sp|Q31RF5|ATPL_SYNE7 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|48013|emb|CAA28924.1| unnamed protein product [Synechococcus elongatus PCC 6301] gi|56686149|dbj|BAD79371.1| H+-transporting two-sector ATPase [Synechococcus elongatus PCC 6301] gi|81168024|gb|ABB56364.1| ATP synthase F0, C subunit [Synechococcus elongatus PCC 7942] Length = 81 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGSAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|224179404|ref|YP_002600827.1| CF0 subunit III of ATP synthase [Pycnococcus provasolii] gi|217314447|gb|ACK36789.1| CF0 subunit III of ATP synthase [Pycnococcus provasolii] Length = 82 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L L N + + G R P A + +L+ ESL ++ L++ + +LF Sbjct: 19 LAAVGPGLGQGNAAGSAVDGIARQPEAEGKIRGTLLLSFAFMESLTIYGLVIALAVLFA 77 >gi|320355047|ref|YP_004196386.1| ATP synthase F0 subcomplex subunit C [Desulfobulbus propionicus DSM 2032] gi|320123549|gb|ADW19095.1| ATP synthase F0 subcomplex C subunit [Desulfobulbus propionicus DSM 2032] Length = 86 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Query: 19 SLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 SLA + ++ L + + N G RNP A A T +++ + ES+ Sbjct: 5 SLALICIGAALSIGLAGFGAGIGMGNGLRGACDGVARNPEAKGAITTTMILGMALCESIA 64 Query: 78 LFLLLVVMLLLFV 90 ++ L++ +LL+ Sbjct: 65 IYGLVIAFILLYA 77 >gi|118411108|ref|YP_874502.1| ATP synthase CF0 C chain subunit III [Thalassiosira pseudonana] gi|224015804|ref|XP_002297550.1| predicted protein [Thalassiosira pseudonana CCMP1335] gi|299830565|ref|YP_003735013.1| ATP synthase CF0 C chain subunit III [Durinskia baltica] gi|223634996|sp|A0T0P0|ATPH_THAPS RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|116739855|gb|ABK20725.1| ATP synthase CF0 C chain subunit III [Thalassiosira pseudonana] gi|220967814|gb|EED86190.1| predicted protein [Thalassiosira pseudonana CCMP1335] gi|297384929|gb|ADI40228.1| ATP synthase CF0 C chain subunit III [Durinskia baltica] Length = 82 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + + +L+ E+L ++ L+V + LLF Sbjct: 25 GIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLVVALALLFA 77 >gi|73670553|ref|YP_306568.1| F0F1 ATP synthase subunit C [Methanosarcina barkeri str. Fusaro] gi|72397715|gb|AAZ71988.1| ATP synthase F0 subcomplex C subunit [Methanosarcina barkeri str. Fusaro] Length = 91 Score = 36.0 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 A+ T LS + P A++ + + + ESL ++ +V M+L+F Sbjct: 30 AIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLAIYCFVVSMILIFA 82 >gi|11466684|ref|NP_039280.1| ATP synthase CF0 C subunit [Marchantia polymorpha] gi|13518334|ref|NP_084693.1| ATP synthase CF0 C subunit [Oenothera elata subsp. hookeri] gi|34501431|ref|NP_904218.1| ATP synthase CF0 C subunit [Physcomitrella patens subsp. patens] gi|68164790|ref|YP_247586.1| ATP synthase CF0 C subunit [Cucumis sativus] gi|108773117|ref|YP_635626.1| ATP synthase CF0 C subunit [Solanum tuberosum] gi|115531901|ref|YP_784057.1| ATP synthase CF0 subunit III [Pelargonium x hortorum] gi|115605009|ref|YP_784460.1| ATP synthase CF0 subunit III [Piper cenocladum] gi|169142714|ref|YP_001687141.1| ATP synthase subunit III [Oenothera argillicola] gi|169142864|ref|YP_001687287.1| ATP synthase subunit III [Oenothera glazioviana] gi|169142949|ref|YP_001687371.1| ATP synthase subunit III [Oenothera biennis] gi|169143035|ref|YP_001687455.1| ATP synthase subunit III [Oenothera parviflora] gi|170784729|ref|YP_001718645.1| ATP synthase CF0 subunit III [Trachelium caeruleum] gi|223931091|ref|YP_002586953.1| ATP synthase CF0 subunit III [Syntrichia ruralis] gi|323148817|ref|YP_004221910.1| ATP synthase CF0 subunit III [Erodium carvifolium] gi|330850615|ref|YP_004376496.1| ATP synthase CF0 subunit III [Ptilidium pulcherrimum] gi|60391815|sp|P62480|ATPH_OENEH RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|60391816|sp|P62481|ATPH_MARPO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75293255|sp|Q6WQW2|ATPH_CUCSA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75294048|sp|Q6YXK1|ATPH_PHYPA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122164293|sp|Q06FX4|ATPH_PELHO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122164375|sp|Q06GS3|ATPH_PIPCE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122248898|sp|Q2VEI9|ATPH_SOLTU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634985|sp|B0Z4N0|ATPH_OENAR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634986|sp|B0Z4W4|ATPH_OENBI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634987|sp|B0Z548|ATPH_OENGL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634988|sp|B0Z5D2|ATPH_OENPA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634997|sp|A9QC36|ATPH_TRACE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|11653|emb|CAA28066.1| atpH [Marchantia polymorpha] gi|6723749|emb|CAB67158.1| ATP synthase subunit III [Oenothera elata subsp. hookeri] gi|30844140|gb|AAP36991.1| ATPase subunit III [Cucumis sativus] gi|34494801|dbj|BAC85068.1| ATP synthase III subunit [Physcomitrella patens subsp. patens] gi|37725739|gb|AAO38178.1| ATPase subunit III [Cucumis sativus] gi|67511385|emb|CAJ00745.1| ATP synthase CF0 C chain [Cucumis sativus] gi|74027089|gb|AAZ94639.1| ATPase subunit III [Cucumis sativus] gi|82754616|gb|ABB90030.1| ATP synthase CF0 C chain [Solanum tuberosum] gi|88656791|gb|ABD47044.1| ATP synthase CF0 subunit III [Solanum tuberosum] gi|112253738|gb|ABI14459.1| ATP synthase CF0 subunit III [Piper cenocladum] gi|112382055|gb|ABI17248.1| ATP synthase CF0 subunit III [Pelargonium x hortorum] gi|115432791|gb|ABI97404.1| ATP synthase CF0 subunit III [Cucumis sativus] gi|115498290|gb|ABI98732.1| ATP synthase CF0 subunit III [Cucumis sativus] gi|156598451|gb|ABU85485.1| ATP synthase CF0 subunit III [Passiflora biflora] gi|156598749|gb|ABU85629.1| ATP synthase CF0 subunit III [Trachelium caeruleum] gi|157267477|gb|ABV26470.1| ATP synthase CF0 subunit III [Trachelium caeruleum] gi|159792952|gb|ABW98708.1| ATP synthase subunit III [Oenothera argillicola] gi|159793122|gb|ABW98876.1| ATP synthase subunit III [Oenothera biennis] gi|159895476|gb|ABX10041.1| ATP synthase subunit III [Oenothera glazioviana] gi|159895561|gb|ABX10125.1| ATP synthase subunit III [Oenothera parviflora] gi|197132336|gb|ACH47686.1| ATP synthase CF0 subunit III [Pelargonium cotyledonis] gi|219562305|gb|ACL27636.1| ATP synthase CF0 subunit III [Syntrichia ruralis] gi|290490336|gb|ADD31575.1| ATP synthase CF0 subunit III protein [Rhododendron simsii] gi|302024744|gb|ADK89590.1| ATP synthase CF0 subunit III [Ptilidium pulcherrimum] gi|316926281|gb|ADU58134.1| ATP synthase CF0 subunit III [Erodium carvifolium] Length = 81 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|157325517|ref|YP_001468295.1| ATP synthase CF0 C subunit [Ipomoea purpurea] gi|223634976|sp|A7Y3A9|ATPH_IPOPU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|157056745|gb|ABV02335.1| ATP synthase CF0 subunit III [Ipomoea purpurea] Length = 81 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|253729552|ref|YP_003029735.1| AtpH [Bambusa oldhamii] gi|246367062|gb|ACS94673.1| AtpH [Bambusa oldhamii] Length = 80 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 23/59 (38%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L + + G R P A + +L+ E+L ++ L+V + LLF Sbjct: 18 LASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFA 76 >gi|238927820|ref|ZP_04659580.1| H(+)-transporting two-sector ATPase [Selenomonas flueggei ATCC 43531] gi|304437796|ref|ZP_07397746.1| ATP synthase F0 sector subunit C [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|238884367|gb|EEQ48005.1| H(+)-transporting two-sector ATPase [Selenomonas flueggei ATCC 43531] gi|304369244|gb|EFM22919.1| ATP synthase F0 sector subunit C [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 83 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/72 (18%), Positives = 29/72 (40%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGMA-CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 +A + G+ L + + ++ G R P A T LI + E+L + Sbjct: 7 VAGALIGAGLCFGLAAIGAGIGDGLVTGRFIEGLARQPEAGGVLFTRTLISVGLIEALAI 66 Query: 79 FLLLVVMLLLFV 90 ++ +++L+ Sbjct: 67 IGVVFGIIMLYA 78 >gi|224477097|ref|YP_002634703.1| F0F1 ATP synthase subunit C [Staphylococcus carnosus subsp. carnosus TM300] gi|254810062|sp|B9DME9|ATPL_STACT RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|222421704|emb|CAL28518.1| putative ATP synthase C chain [Staphylococcus carnosus subsp. carnosus TM300] Length = 70 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A +A+G++ LG + I + + G R P A + + I + E+L + Sbjct: 3 LIAAAIAIGLSALG---AGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPIL 59 Query: 80 LLLVVMLLLF 89 L++ ++LF Sbjct: 60 GLVISFIVLF 69 >gi|172072930|ref|YP_001806691.1| ATP synthase CF0 C subunit [Cryptomeria japonica] gi|223634960|sp|B1VKH8|ATPH_CRYJA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|171854949|dbj|BAG16689.1| ATP synthase CF0 subunit III [Cryptomeria japonica] gi|239794317|dbj|BAH73314.1| ATP synthase CF0 subunit III [Cryptomeria japonica] gi|239794400|dbj|BAH73396.1| ATP synthase CF0 subunit III [Cryptomeria japonica] Length = 81 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G++ L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLSVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|240143390|ref|ZP_04741991.1| ATP synthase F0, C subunit [Roseburia intestinalis L1-82] gi|257204659|gb|EEV02944.1| ATP synthase F0, C subunit [Roseburia intestinalis L1-82] gi|291537134|emb|CBL10246.1| ATP synthase F0 subcomplex C subunit [Roseburia intestinalis M50/1] gi|291540373|emb|CBL13484.1| ATP synthase F0 subcomplex C subunit [Roseburia intestinalis XB6B4] Length = 84 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 33/71 (46%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +A + G+A + + + RNP A + +L+ +AE+ GL+ Sbjct: 10 MACSAIGAGLAVIAGIGPGIGQGIAAGHGAAAVGRNPGAKGDIMSTMLLGQAVAETTGLY 69 Query: 80 LLLVVMLLLFV 90 LL+ MLLLFV Sbjct: 70 GLLIAMLLLFV 80 >gi|7524608|ref|NP_042362.1| ATP synthase CF0 C subunit [Pinus thunbergii] gi|29565569|ref|NP_817149.1| ATP synthase CF0 C subunit [Pinus koraiensis] gi|222084082|ref|YP_002519535.1| ATP synthase CF0 C chain [Keteleeria davidiana] gi|237688451|ref|YP_002905070.1| ATP synthase CF0 C subunit [Picea sitchensis] gi|237688583|ref|YP_002905200.1| ATP synthase CF0 C subunit [Pinus gerardiana] gi|237688651|ref|YP_002905267.1| ATP synthase CF0 C subunit [Pinus krempfii] gi|309322332|ref|YP_003934183.1| ATP synthase CF0 C chain [Cedrus deodara] gi|309322409|ref|YP_003934489.1| ATP synthase CF0 C chain [Cathaya argyrophylla] gi|324986350|ref|YP_004276222.1| ATP synthase CF0 C subunit [Pinus lambertiana] gi|324986422|ref|YP_004276293.1| ATP synthase CF0 C subunit [Pinus monophylla] gi|324986493|ref|YP_004276363.1| ATP synthase CF0 C subunit [Pinus nelsonii] gi|1168599|sp|P41603|ATPH_PINTH RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75295664|sp|Q7GUD2|ATPH_PINKO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|1262602|dbj|BAA04320.1| H+-ATPase III subunit [Pinus thunbergii] gi|29469668|gb|AAO73996.1| H+-ATPase III subunit [Pinus koraiensis] gi|220983634|dbj|BAH11400.1| ATP synthase CF0 C chain [Keteleeria davidiana] gi|226875280|gb|ACO89019.1| ATP synthase CF0 C subunit [Picea sitchensis] gi|226876044|gb|ACO89300.1| ATP synthase CF0 C subunit [Pinus gerardiana] gi|226951109|gb|ACO94172.1| ATP synthase CF0 C subunit [Pinus krempfii] gi|228015916|gb|ACP50756.1| ATP synthase CF0 C subunit [Pinus taeda] gi|228015985|gb|ACP50824.1| ATP synthase CF0 C subunit [Pinus resinosa] gi|228016053|gb|ACP50891.1| ATP synthase CF0 C subunit [Pinus rzedowskii] gi|228016117|gb|ACP50954.1| ATP synthase CF0 C subunit [Pinus sibirica] gi|228016174|gb|ACP51010.1| ATP synthase CF0 C subunit [Pinus squamata] gi|228016239|gb|ACP51074.1| ATP synthase CF0 C subunit [Pinus strobus] gi|228016299|gb|ACP51133.1| ATP synthase CF0 C subunit [Pinus ponderosa] gi|228016369|gb|ACP51202.1| ATP synthase CF0 C subunit [Pinus thunbergii] gi|228016436|gb|ACP51268.1| ATP synthase CF0 C subunit [Pinus torreyana subsp. insularis] gi|228016500|gb|ACP51331.1| ATP synthase CF0 C subunit [Pinus torreyana subsp. torreyana] gi|228016559|gb|ACP51389.1| ATP synthase CF0 C subunit [Abies firma] gi|228016615|gb|ACP51444.1| ATP synthase CF0 C subunit [Pinus albicaulis] gi|228016682|gb|ACP51510.1| ATP synthase CF0 C subunit [Pinus aristata] gi|228016748|gb|ACP51575.1| ATP synthase CF0 C subunit [Pinus armandii] gi|228016812|gb|ACP51638.1| ATP synthase CF0 C subunit [Pinus attenuata] gi|228016871|gb|ACP51696.1| ATP synthase CF0 C subunit [Pinus ayacahuite] gi|228016935|gb|ACP51759.1| ATP synthase CF0 C subunit [Pinus banksiana] gi|228016999|gb|ACP51822.1| ATP synthase CF0 C subunit [Pinus canariensis] gi|228017064|gb|ACP51886.1| ATP synthase CF0 C subunit [Cedrus deodara] gi|228017118|gb|ACP51939.1| ATP synthase CF0 C subunit [Pinus cembra] gi|228017178|gb|ACP51998.1| ATP synthase CF0 C subunit [Pinus leiophylla var. chihuahuana] gi|228017239|gb|ACP52058.1| ATP synthase CF0 C subunit [Pinus flexilis] gi|228017305|gb|ACP52123.1| ATP synthase CF0 C subunit [Pinus lambertiana] gi|228017371|gb|ACP52188.1| ATP synthase CF0 C subunit [Larix occidentalis] gi|228017440|gb|ACP52256.1| ATP synthase CF0 C subunit [Pinus merkusii] gi|228017498|gb|ACP52313.1| ATP synthase CF0 C subunit [Pinus monticola] gi|228017561|gb|ACP52375.1| ATP synthase CF0 C subunit [Pinus parviflora var. pentaphylla] gi|228017625|gb|ACP52438.1| ATP synthase CF0 C subunit [Pinus peuce] gi|228017691|gb|ACP52503.1| ATP synthase CF0 C subunit [Pinus pinaster] gi|257042522|gb|ACV32796.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042551|gb|ACV32824.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042579|gb|ACV32851.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042609|gb|ACV32880.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042637|gb|ACV32907.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042665|gb|ACV32934.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042694|gb|ACV32962.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042722|gb|ACV32989.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042749|gb|ACV33015.1| ATP synthase CF0 C subunit [Pinus monticola] gi|257042777|gb|ACV33042.1| ATP synthase CF0 C subunit [Pinus monticola] gi|307683258|dbj|BAJ19566.1| ATP synthase CF0 C chain [Cedrus deodara] gi|307683335|dbj|BAJ19642.1| ATP synthase CF0 C chain [Cathaya argyrophylla] gi|307683413|dbj|BAJ19685.1| ATP synthase CF0 C chain [Pseudotsuga sinensis var. wilsoniana] gi|307683507|dbj|BAJ19732.1| ATP synthase CF0 C chain [Larix decidua] gi|307683601|dbj|BAJ19779.1| ATP synthase CF0 C chain [Picea morrisonicola] gi|323514199|gb|ADX89746.1| ATP synthase CF0 C subunit [Pinus lambertiana] gi|323522517|gb|ADX94859.1| ATP synthase CF0 C subunit [Pinus monophylla] gi|323522681|gb|ADX94929.1| ATP synthase CF0 C subunit [Pinus nelsonii] Length = 81 Score = 36.0 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G++ L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLSVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|167768297|ref|ZP_02440350.1| hypothetical protein CLOSS21_02853 [Clostridium sp. SS2/1] gi|317497772|ref|ZP_07956085.1| ATP synthase subunit C [Lachnospiraceae bacterium 5_1_63FAA] gi|167709821|gb|EDS20400.1| hypothetical protein CLOSS21_02853 [Clostridium sp. SS2/1] gi|291560274|emb|CBL39074.1| ATP synthase F0 subcomplex C subunit [butyrate-producing bacterium SSC/2] gi|316894961|gb|EFV17130.1| ATP synthase subunit C [Lachnospiraceae bacterium 5_1_63FAA] Length = 72 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 27/64 (42%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + L R P A +L+ +AE+ ++ L+V Sbjct: 6 IGAGIAVLTGLGAGIGIGVATNGALGAIARQPEEAGNINKTLLLGCALAEATSIYGLVVA 65 Query: 85 MLLL 88 +LL+ Sbjct: 66 ILLI 69 >gi|300870196|ref|YP_003785067.1| ATP synthase subunit C [Brachyspira pilosicoli 95/1000] gi|300687895|gb|ADK30566.1| ATP synthase, subunit C (H(+)-transporting two-sector ATPase) [Brachyspira pilosicoli 95/1000] Length = 73 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 +++ + G+A +G+G L + I + + G R P A+ +T +LI A + E +G Sbjct: 3 FAIIGATIGAGLAAIGVG---LGIGFIGSRAVEGIARQPEASGKIQTAMLISAALIEGVG 59 Query: 78 LFLLLVVMLLLFV 90 LF L++ +L LF Sbjct: 60 LFALVICILALFT 72 >gi|225572839|ref|ZP_03781594.1| hypothetical protein RUMHYD_01030 [Blautia hydrogenotrophica DSM 10507] gi|225039810|gb|EEG50056.1| hypothetical protein RUMHYD_01030 [Blautia hydrogenotrophica DSM 10507] Length = 71 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 11/67 (16%), Positives = 31/67 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +A L + +S T + R P A ++ +L+ +AE+ ++ ++ Sbjct: 5 IGAALAVLTGIGAGVGISKATATAVDAIARQPEAEGKIRSTLLLGCALAEATAIYGFVIA 64 Query: 85 MLLLFVI 91 +L++ ++ Sbjct: 65 LLIIIML 71 >gi|193891062|gb|ACF28684.1| chloroplast ATP synthase [Amphidinium carterae] Length = 143 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A V G A L + + G R P A + +L+ ESL ++ Sbjct: 68 ALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLAFMESLTIY 127 Query: 80 LLLVVMLLL 88 L++ ++LL Sbjct: 128 GLVIALVLL 136 >gi|87125413|ref|ZP_01081259.1| ATP synthase subunit C [Synechococcus sp. RS9917] gi|148240357|ref|YP_001225744.1| F0F1 ATP synthase subunit C [Synechococcus sp. WH 7803] gi|254432641|ref|ZP_05046344.1| ATP synthase C chain [Cyanobium sp. PCC 7001] gi|254810069|sp|A5GND2|ATPL_SYNPW RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|86167182|gb|EAQ68443.1| ATP synthase subunit C [Synechococcus sp. RS9917] gi|147848896|emb|CAK24447.1| ATP synthase C chain [Synechococcus sp. WH 7803] gi|197627094|gb|EDY39653.1| ATP synthase C chain [Cyanobium sp. PCC 7001] Length = 82 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 22 IGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALVLLFA 77 >gi|282600600|ref|ZP_05979177.2| ATP synthase F0, C subunit [Subdoligranulum variabile DSM 15176] gi|282571892|gb|EFB77427.1| ATP synthase F0, C subunit [Subdoligranulum variabile DSM 15176] Length = 86 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 28/66 (42%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 +A G+A L + + R P A+ + +L+ +AE +F + Sbjct: 20 IAAGLAVLTGFGAGIGIGIATGHASDAIARQPEASGKINSTLLLGCAMAEGTAIFGFITA 79 Query: 85 MLLLFV 90 ++++FV Sbjct: 80 LIIIFV 85 >gi|114669|sp|P26682|ATPL_ENTHR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|153568|gb|AAA26854.1| H+ ATPase [Enterococcus faecalis] gi|153576|gb|AAA26861.1| F1F0-ATPase gamma-subunit [Enterococcus faecalis] Length = 71 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 24/52 (46%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + + R P + +T + I + E++ + +++ ++L+F + Sbjct: 20 GNGQVISKTIESMARQPEMSGQLRTTMFIGVALVEAVPILGVVIALILVFAV 71 >gi|242281179|ref|YP_002993308.1| ATP synthase F0, C subunit [Desulfovibrio salexigens DSM 2638] gi|242124073|gb|ACS81769.1| ATP synthase F0, C subunit [Desulfovibrio salexigens DSM 2638] Length = 107 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 22/53 (41%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + G RNP A +++ ESL ++ L+V ++LLF Sbjct: 50 GIGQGLGLKAACEGTARNPEAGGKITVTLILGLAFVESLAIYALVVNLILLFA 102 >gi|119368486|ref|YP_913174.1| ATP synthase III subunit [Gossypium barbadense] gi|223634970|sp|A0ZZ22|ATPH_GOSBA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|119224848|dbj|BAF41234.1| ATP synthase III subunit [Gossypium barbadense] Length = 81 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALSIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|56791416|gb|AAW30247.1| ATP synthase F0 subunit 9 [Agave attenuata] Length = 59 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 8/46 (17%), Positives = 21/46 (45%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+ ++ + RNP A ++ + E++ LF ++ Sbjct: 14 VGIGNVLSSSIHSVARNPSLAKQLFGYAILGFALTEAIALFAPMMA 59 >gi|52841284|ref|YP_095083.1| ATP synthase C subunit (H+ transporting ATP synthase) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52628395|gb|AAU27136.1| ATP synthase C subunit (H+ transporting ATP synthase) [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] Length = 62 Score = 36.0 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 24/49 (48%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 + + L R P A + + I + ESL ++ L++V+++LF Sbjct: 1 MGRAISHALDALARQPEAEKSITRTLFIGLAMIESLAIYCLVIVLIILF 49 >gi|13518441|ref|NP_084801.1| ATP synthase CF0 C subunit [Lotus japonicus] gi|91214146|ref|YP_538768.1| ATP synthase CF0 C subunit [Glycine max] gi|139387457|ref|YP_001122811.1| ATP synthase CF0 subunit III [Phaseolus vulgaris] gi|289066831|ref|YP_003434349.1| ATP synthase CF0 subunit III [Vigna radiata] gi|59799157|sp|P69194|ATPH_LOTJA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|59799158|sp|P69195|ATPH_SOYBN RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634992|sp|A4GGB0|ATPH_PHAVU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|169935|gb|AAB01580.1| DCCD-binding protein [Glycine max] gi|13358982|dbj|BAB33199.1| ATPase III subunit [Lotus japonicus] gi|83595747|gb|ABC25128.1| ATP synthase CF0 subunit III [Glycine max] gi|112030979|gb|ABH88091.1| ATP synthase CF0 subunit III [Phaseolus vulgaris] gi|158187144|gb|ABW22777.1| ATP synthase CF0 subunit III [Phaseolus vulgaris] gi|259020018|gb|ACV90216.1| ATP synthase CF0 subunit III [Vigna radiata] Length = 81 Score = 36.0 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|256828750|ref|YP_003157478.1| alternate F1F0 ATPase, F0 subunit C [Desulfomicrobium baculatum DSM 4028] gi|256577926|gb|ACU89062.1| alternate F1F0 ATPase, F0 subunit C [Desulfomicrobium baculatum DSM 4028] Length = 93 Score = 36.0 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 26/59 (44%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G ALA T L+ + P A++ + + + ES ++ +V M+L+F Sbjct: 21 FGTMGPALAEGKAVATALTSLAQQPDASATITRTLFVGLAMIESTAIYCFVVSMILIFA 79 >gi|197132322|gb|ACH47679.1| ATP synthase CF0 subunit III [Erodium chrysanthum] Length = 81 Score = 36.0 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPDAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|7525020|ref|NP_051046.1| ATP synthase CF0 C subunit [Arabidopsis thaliana] gi|139387239|ref|YP_001123360.1| ATP synthase CF0 C subunit [Capsella bursa-pastoris] gi|139389405|ref|YP_001123102.1| ATP synthase CF0 C subunit [Olimarabidopsis pumila] gi|139389629|ref|YP_001123186.1| ATPase III subunit [Arabis hirsuta] gi|139389788|ref|YP_001123449.1| ATP synthase CF0 C subunit [Crucihimalaya wallichii] gi|139389937|ref|YP_001123537.1| ATPase III subunit [Draba nemorosa] gi|297837973|ref|XP_002886868.1| ATP synthase CF0 C subunit [Arabidopsis lyrata subsp. lyrata] gi|6685247|sp|P56760|ATPH_ARATH RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634959|sp|A4QKR8|ATPH_CRUWA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634967|sp|A4QL06|ATPH_DRANE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634989|sp|A4QJS0|ATPH_OLIPU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635047|sp|A4QK05|ATPH_ARAHI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635051|sp|A4QKH9|ATPH_CAPBU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|5881681|dbj|BAA84372.1| ATPase III subunit [Arabidopsis thaliana] gi|134286299|dbj|BAF49926.1| ATPase III subunit [Olimarabidopsis pumila] gi|134286384|dbj|BAF50010.1| ATPase III subunit [Arabis hirsuta] gi|134286560|dbj|BAF50184.1| ATPase III subunit [Capsella bursa-pastoris] gi|134286650|dbj|BAF50273.1| ATPase III subunit [Crucihimalaya wallichii] gi|134286739|dbj|BAF50361.1| ATPase III subunit [Draba nemorosa] gi|262400760|gb|ACY66249.1| ATP synthase CF0 C subunit [Brassica napus] gi|297332709|gb|EFH63127.1| ATP synthase CF0 C subunit [Arabidopsis lyrata subsp. lyrata] Length = 81 Score = 36.0 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|332671307|ref|YP_004454315.1| ATP synthase F0 subunit C [Cellulomonas fimi ATCC 484] gi|332340345|gb|AEE46928.1| ATP synthase F0, C subunit [Cellulomonas fimi ATCC 484] Length = 83 Score = 36.0 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Query: 5 MMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKT 64 + + +T AA S V G+A +G + + + + G R P A +T Sbjct: 3 LADTSTILAAADAVSGNIATVGYGLAVIG---PGIGLGILIGKTIEGIARQPEVAGQLRT 59 Query: 65 EVLIFAVIAESLGLFLLLVVML 86 + I E LGL L+ L Sbjct: 60 TMFIGIGFVEVLGLLGLITGFL 81 >gi|260654867|ref|ZP_05860355.1| ATP synthase F0, C subunit [Jonquetella anthropi E3_33 E1] gi|260630369|gb|EEX48563.1| ATP synthase F0, C subunit [Jonquetella anthropi E3_33 E1] Length = 72 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 25/64 (39%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + R P A + +L+ +AE+ ++ +V Sbjct: 6 LGAGIAVLTGVGAGIGIGLATGKACESIARQPEAKNDVMKTMLLGCGLAEATAIYGFVVA 65 Query: 85 MLLL 88 M ++ Sbjct: 66 MAVI 69 >gi|166367753|ref|YP_001660026.1| F0F1 ATP synthase subunit C [Microcystis aeruginosa NIES-843] gi|254810008|sp|B0JWU7|ATPL_MICAN RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|159027209|emb|CAO89303.1| atpE [Microcystis aeruginosa PCC 7806] gi|166090126|dbj|BAG04834.1| ATP synthase CF0 C chain [Microcystis aeruginosa NIES-843] Length = 81 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + +SG R P A + +L+ ESL ++ L++ ++LLF Sbjct: 22 IGPGVGQGTASGEAVSGIARQPEAEGRIRGTLLLSLAFMESLTIYGLVIALVLLFA 77 >gi|319954477|ref|YP_004165744.1| ATP synthase f0 subcomplex c subunit [Cellulophaga algicola DSM 14237] gi|319423137|gb|ADV50246.1| ATP synthase F0 subcomplex C subunit [Cellulophaga algicola DSM 14237] Length = 88 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 25/61 (40%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 +G + AL L+ + P A + + + ES+ ++ ++ M+L+F Sbjct: 19 MAIGGMIPALGQGKSIAAALNSLAQQPDANQTITRTLFVGLAMLESVAIYCFVIAMILIF 78 Query: 90 V 90 Sbjct: 79 A 79 >gi|210623308|ref|ZP_03293725.1| hypothetical protein CLOHIR_01675 [Clostridium hiranonis DSM 13275] gi|210153709|gb|EEA84715.1| hypothetical protein CLOHIR_01675 [Clostridium hiranonis DSM 13275] Length = 83 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 16/72 (22%), Positives = 30/72 (41%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 ++A + G+A L P A S + ++ A IAES + Sbjct: 8 AVAGSAIGAGIAVFTGIGAGLGQGYAAGKLAEAVGNQPEAKSEIMSSFIVGAAIAESTAI 67 Query: 79 FLLLVVMLLLFV 90 + L++ ++L+FV Sbjct: 68 YGLIIAIILIFV 79 >gi|58618220|gb|AAW80675.1| chloroplast ATPH isoform 5 [Heterocapsa triquetra] gi|157092945|gb|ABV22127.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] gi|157092947|gb|ABV22128.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] gi|157092949|gb|ABV22129.1| chloroplast ATP synthase subunit C [Heterocapsa triquetra] Length = 140 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Query: 13 AANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAV 71 A +G + A V G A L + + G R P A + +L+ Sbjct: 57 ADDGVWIPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLLLSLA 116 Query: 72 IAESLGLFLLLVVMLLLFV 90 ESL ++ L++ ++LLF Sbjct: 117 FMESLTIYGLVIALVLLFA 135 >gi|42518860|ref|NP_964790.1| F0F1 ATP synthase subunit C [Lactobacillus johnsonii NCC 533] gi|227889718|ref|ZP_04007523.1| H(+)-transporting two-sector ATPase [Lactobacillus johnsonii ATCC 33200] gi|268319744|ref|YP_003293400.1| ATP synthase C chain [Lactobacillus johnsonii FI9785] gi|81703852|sp|Q74K20|ATPL_LACJO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|41583146|gb|AAS08756.1| ATP synthase C chain [Lactobacillus johnsonii NCC 533] gi|227849582|gb|EEJ59668.1| H(+)-transporting two-sector ATPase [Lactobacillus johnsonii ATCC 33200] gi|262398119|emb|CAX67133.1| ATP synthase C chain [Lactobacillus johnsonii FI9785] gi|329667593|gb|AEB93541.1| ATP synthase C chain [Lactobacillus johnsonii DPC 6026] Length = 70 Score = 36.0 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 25/51 (49%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P +A+ + + I + E++ + +++ L+LF+ Sbjct: 20 GNGKVISKTIEGMARQPESANNLRATMFIGVGLIEAVPILAIVIGFLILFL 70 >gi|291520264|emb|CBK75485.1| ATP synthase F0 subcomplex C subunit [Butyrivibrio fibrisolvens 16/4] Length = 85 Score = 35.6 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 32/70 (45%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G+A + + + RNP A + +L+ +AE+ GL+ Sbjct: 11 ACSAIGAGLAVIAGIGPGIGQGIAAGHGAAAVGRNPGAQGQIMSTMLLGQAVAETTGLYG 70 Query: 81 LLVVMLLLFV 90 L++ +LLLFV Sbjct: 71 LVIALLLLFV 80 >gi|291460680|ref|ZP_06600070.1| ATP synthase F0, C subunit [Oribacterium sp. oral taxon 078 str. F0262] gi|291416639|gb|EFE90358.1| ATP synthase F0, C subunit [Oribacterium sp. oral taxon 078 str. F0262] Length = 93 Score = 35.6 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N L R P + +L+ IAE+ G++ + +LL+FV Sbjct: 28 IGPGIGEGNAVAKALEAIGRQPECKGDVTSTMLLGCAIAETTGIYGFVTGLLLIFV 83 >gi|330850942|ref|YP_004376692.1| ATP synthase CF0 C chain subunit III [Fistulifera sp. JPCC DA0580] gi|328835762|dbj|BAK19058.1| ATP synthase CF0 C chain subunit III [Fistulifera sp. JPCC DA0580] Length = 82 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P A + + +L+ E+L ++ L+V + LLF Sbjct: 25 GIGQGNAAGQAVEGIARQPEAENKIRGTLLLSLAFMEALTIYGLVVALALLFA 77 >gi|11465941|ref|NP_054483.1| ATP synthase CF0 C subunit [Nicotiana tabacum] gi|18860298|ref|NP_569616.1| ATP synthase CF0 C subunit [Psilotum nudum] gi|28202154|ref|NP_777395.1| ATP synthase CF0 C subunit [Anthoceros formosae] gi|32480830|ref|NP_862741.1| ATP synthase CF0 C subunit [Calycanthus floridus var. glaucus] gi|34500901|ref|NP_904086.1| ATP synthase CF0 C subunit [Amborella trichopoda] gi|49574590|ref|NP_848047.2| ATP synthase CF0 C subunit [Adiantum capillus-veneris] gi|50346769|ref|YP_053142.1| ATP synthase CF0 C subunit [Nymphaea alba] gi|52220797|ref|YP_086953.1| ATP synthase CF0 C subunit [Panax ginseng] gi|75755646|ref|YP_319752.1| ATP synthase CF0 C subunit [Acorus calamus] gi|78102518|ref|YP_358659.1| ATP synthase CF0 C subunit [Nicotiana sylvestris] gi|78103240|ref|YP_358563.1| ATP synthase CF0 C subunit [Phalaenopsis aphrodite subsp. formosana] gi|81176242|ref|YP_398321.1| ATP synthase CF0 C subunit [Lactuca sativa] gi|81301549|ref|YP_398846.1| ATP synthase CF0 C subunit [Nicotiana tomentosiformis] gi|89280622|ref|YP_514839.1| ATP synthase CF0 C subunit [Solanum lycopersicum] gi|91208889|ref|YP_538922.1| ATP synthase CF0 C subunit [Gossypium hirsutum] gi|91983979|ref|YP_567063.1| ATP synthase CF0 C subunit [Vitis vinifera] gi|94502483|ref|YP_588109.1| ATP synthase CF0 C subunit [Helianthus annuus] gi|108802630|ref|YP_636286.1| ATP synthase CF0 C subunit [Eucalyptus globulus subsp. globulus] gi|110227066|ref|YP_665545.1| ATP synthase CF0 C subunit [Populus alba] gi|114107033|ref|YP_740189.1| ATP synthase CF0 subunit III [Liriodendron tulipifera] gi|114107120|ref|YP_740104.1| ATP synthase CF0 subunit III [Daucus carota] gi|114329643|ref|YP_740462.1| ATP synthase CF0 subunit III [Citrus sinensis] gi|114329733|ref|YP_740552.1| ATP synthase CF0 subunit III [Platanus occidentalis] gi|114329955|ref|YP_740637.1| ATP synthase CF0 subunit III [Nandina domestica] gi|114804252|ref|YP_762248.1| ATP synthase CF0 subunit III [Morus indica] gi|115391889|ref|YP_778477.1| ATP synthase CF0 C subunit [Jasminum nudiflorum] gi|115604921|ref|YP_784373.1| ATP synthase CF0 subunit III [Drimys granadensis] gi|116617095|ref|YP_817469.1| ATP synthase CF0 subunit III [Coffea arabica] gi|121720600|ref|YP_001001521.1| ATP synthase CF0 subunit III [Nuphar advena] gi|122893977|ref|YP_001004173.1| ATP synthase CF0 subunit III [Ranunculus macranthus] gi|134093184|ref|YP_001109486.1| ATP synthase CF0 C subunit [Populus trichocarpa] gi|139388081|ref|YP_001123273.1| ATPase III subunit [Barbarea verna] gi|139388897|ref|YP_001123624.1| ATP synthase CF0 C subunit [Lepidium virginicum] gi|139389083|ref|YP_001123801.1| ATP synthase CF0 C subunit [Nasturtium officinale] gi|139389251|ref|YP_001123017.1| ATPase III subunit [Aethionema grandiflorum] gi|139390139|ref|YP_001123712.1| ATP synthase CF0 C subunit [Lobularia maritima] gi|139390335|ref|YP_001122933.1| ATPase III subunit [Aethionema cordifolium] gi|149390255|ref|YP_001294085.1| ATP synthase CF0 subunit III [Chloranthus spicatus] gi|149390341|ref|YP_001294339.1| ATP synthase CF0 C subunit [Dioscorea elephantipes] gi|149390429|ref|YP_001294257.1| ATP synthase CF0 subunit III [Illicium oligandrum] gi|149390527|ref|YP_001294171.1| ATP synthase CF0 subunit III [Buxus microphylla] gi|156618813|ref|YP_001430095.1| ATP synthase CF0 C subunit [Cuscuta reflexa] gi|159161240|ref|YP_001542518.1| ATP synthase CF0 subunit III [Cuscuta exaltata] gi|161622297|ref|YP_001586169.1| ATP synthase CF0 C subunit [Acorus americanus] gi|161784179|ref|YP_001595495.1| ATPase III subunit [Lemna minor] gi|167391792|ref|YP_001671670.1| ATP synthase CF0 C subunit [Carica papaya] gi|169794060|ref|YP_001718424.1| ATP synthase CF0 C subunit [Manihot esculenta] gi|183217733|ref|YP_001837352.1| ATP synthase CF0 C subunit [Guizotia abyssinica] gi|189162258|ref|YP_001936504.1| ATP synthase CF0 C subunit [Fagopyrum esculentum subsp. ancestrale] gi|225544111|ref|YP_002720099.1| atpH [Jatropha curcas] gi|229577741|ref|YP_002836077.1| ATP synthase CF0 subunit III [Megaleranthis saniculifolia] gi|281190718|ref|YP_003330955.1| ATP synthase CF0 C subunit [Parthenium argentatum] gi|289065076|ref|YP_003433962.1| ATP synthase CF0 subunit III [Typha latifolia] gi|292559497|ref|YP_003540918.1| ATP synthase CF0 C chain subunit III [Phoenix dactylifera] gi|295311719|ref|YP_003587455.1| ATP synthase CF0 subunit III [Oncidium Gower Ramsey] gi|309322438|ref|YP_003933951.1| ATP synthase CF0 subunit III [Eucalyptus grandis] gi|313183809|ref|YP_004021652.1| ATP synthase CF0 subunit III [Prunus persica] gi|313183980|ref|YP_004021137.1| ATP synthase CF0 subunit III [Castanea mollissima] gi|313199653|ref|YP_004021269.1| ATP synthase CF0 subunit III [Isoetes flaccida] gi|313199690|ref|YP_004021304.1| ATP synthase CF0 subunit III [Theobroma cacao] gi|317046160|ref|YP_004072449.1| ATPase subunit III [Corynocarpus laevigata] gi|323148893|ref|YP_004222448.1| ATP synthase CF0 subunit III [Smilax china] gi|323149069|ref|YP_004222633.1| ATP synthase CF0 subunit III [Anthriscus cerefolium] gi|325126852|ref|YP_004286089.1| ATP synthase CF0 subunit III [Fragaria vesca subsp. vesca] gi|325210917|ref|YP_004285991.1| ATP synthase CF0 subunit III [Gossypium thurberi] gi|326909385|ref|YP_004327654.1| ATP synthase CF0 C subunit [Hevea brasiliensis] gi|330850730|ref|YP_004376408.1| ATP synthase CF0 C subunit [Olea europaea subsp. europaea] gi|114654|sp|P06286|ATPH_TOBAC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|47115596|sp|P61172|ATPH_ANTFO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|68565054|sp|Q85FN2|ATPH_ADICA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75283445|sp|Q56P08|ATPH_LACSA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75289358|sp|Q68S19|ATPH_PANGI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75290273|sp|Q6EW61|ATPH_NYMAL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75294676|sp|Q70Y12|ATPH_AMBTC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75295775|sp|Q7HJJ2|ATPH_PSINU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75295807|sp|Q7HKY1|ATPH_CALFG RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122153608|sp|A0A322|ATPH_COFAR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122164454|sp|Q06H10|ATPH_DRIGR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122164986|sp|Q06RE4|ATPH_JASNU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122165974|sp|Q09FX4|ATPH_NANDO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122166048|sp|Q09G59|ATPH_PLAOC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122166196|sp|Q09MJ1|ATPH_CITSI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122166818|sp|Q09X30|ATPH_MORIN RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122225260|sp|Q1KXW7|ATPH_HELAN RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122227064|sp|Q3V547|ATPH_ACOCL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122227268|sp|Q4FGE9|ATPH_RANMC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122227269|sp|Q4FGF0|ATPH_NUPAD RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122233823|sp|Q0G9N2|ATPH_LIRTU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122233842|sp|Q0G9X5|ATPH_DAUCA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122238618|sp|Q2L8Z2|ATPH_GOSHI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122239253|sp|Q33C51|ATPH_NICTO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122239297|sp|Q3BAQ5|ATPH_PHAAO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122239304|sp|Q3C1H2|ATPH_NICSY RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122239625|sp|Q49L11|ATPH_EUCGG RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122242808|sp|Q0ZJ33|ATPH_VITVI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122243417|sp|Q14FH0|ATPH_POPAL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122246089|sp|Q4FGF2|ATPH_ACOAM RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122248451|sp|Q2MIB3|ATPH_SOLLC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634957|sp|A6MMA9|ATPH_CHLSC RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634961|sp|A8W3B1|ATPH_CUSEX RecName: Full=ATP synthase subunit C, plastid; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|223634964|sp|A7M953|ATPH_CUSRE RecName: Full=ATP synthase subunit C, plastid; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|223634966|sp|A6MMJ4|ATPH_DIOEL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634968|sp|B2XWN6|ATPH_FAGEA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634971|sp|B2LMI5|ATPH_GUIAB RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634975|sp|A6MMT1|ATPH_ILLOL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634977|sp|A9L983|ATPH_LEMMI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634979|sp|A4QL93|ATPH_LEPVR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634980|sp|A4QLI1|ATPH_LOBMA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634982|sp|B1NWD7|ATPH_MANES RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634983|sp|A4QLS0|ATPH_NASOF RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634993|sp|A4GYP5|ATPH_POPTR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635042|sp|A4QJA2|ATPH_AETCO RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635043|sp|A4QJI6|ATPH_AETGR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635048|sp|A4QK92|ATPH_BARVE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635050|sp|A6MM23|ATPH_BUXMI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635052|sp|B1A922|ATPH_CARPA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|11812|emb|CAA77343.1| ATPase III subunit [Nicotiana tabacum] gi|343484|gb|AAA84678.1| ATPase subunit III [Nicotiana tabacum] gi|18389451|dbj|BAB84203.1| ATP synthase subunit CF0 III [Psilotum nudum] gi|27807856|dbj|BAC55331.1| ATPase III subunit [Anthoceros formosae] gi|27807955|dbj|BAC55422.1| ATPase III subunit [Anthoceros formosae] gi|32399366|emb|CAD28708.1| ATPase III subunit [Calycanthus floridus var. glaucus] gi|34481616|emb|CAD45095.2| ATPase III subunit [Amborella trichopoda] gi|48475988|gb|AAP29379.2| ATP synthase CF0 C chain [Adiantum capillus-veneris] gi|50250314|emb|CAF28580.1| ATPase III subunit [Nymphaea alba] gi|51235300|gb|AAT98496.1| atpAse subunit III [Panax ginseng] gi|58802770|gb|AAW82490.1| ATP synthase CF0 C chain [Phalaenopsis aphrodite subsp. formosana] gi|60460796|gb|AAX21016.1| ATP synthase CF0 subunit III [Eucalyptus globulus subsp. globulus] gi|61992026|gb|AAX58147.1| ATPase subunit III [Lactuca sativa] gi|62149320|dbj|BAD93462.1| ATP synthase CF0 C chain [Silene latifolia] gi|69215264|gb|AAZ03823.1| ATP synthase CF0 C chain [Acorus americanus] gi|69215266|gb|AAZ03824.1| ATP synthase CF0 C chain [Ginkgo biloba] gi|69215268|gb|AAZ03825.1| ATP synthase CF0 C chain [Nuphar advena] gi|69215270|gb|AAZ03826.1| ATP synthase CF0 C chain [Ranunculus macranthus] gi|69215272|gb|AAZ03827.1| ATP synthase CF0 C chain [Typha latifolia] gi|69215274|gb|AAZ03828.1| ATP synthase CF0 C chain [Yucca schidigera] gi|74381696|emb|CAI53781.1| ATPase III subunit [Acorus calamus] gi|77799545|dbj|BAE46634.1| ATPase III subunit [Nicotiana sylvestris] gi|78100304|gb|ABB20945.1| ATP synthase CF0 subunit III [Morus indica] gi|78675160|dbj|BAE47586.1| ATP synthase CF0 C chain [Lactuca sativa] gi|80750908|dbj|BAE47984.1| ATPase III subunit [Nicotiana tomentosiformis] gi|84371970|gb|ABC56287.1| ATP synthase CF0 subunit III [Solanum lycopersicum] gi|84682191|gb|ABC60445.1| ATP synthase CF0 subunit III [Nuphar advena] gi|85540791|gb|ABC70743.1| ATP synthase CF0 subunit III [Ranunculus macranthus] gi|85687403|gb|ABC73615.1| ATP synthase CF0 subunit III [Gossypium hirsutum] gi|88656887|gb|ABD47138.1| ATP synthase CF0 subunit III [Helianthus annuus] gi|88656975|gb|ABD47225.1| ATP synthase CF0 subunit III [Lactuca sativa] gi|88696757|gb|ABD48482.1| ATPase III subunit [Lemna minor] gi|89241658|emb|CAJ32380.1| ATP synthase CF0 C chain [Solanum lycopersicum] gi|91701637|gb|ABE47521.1| ATP synthase CF0 subunit III [Vitis vinifera] gi|109945504|dbj|BAE97192.1| ATP synthase CF0 C chain [Populus alba] gi|110456210|gb|ABG74615.1| ATPase subunit III [Jasminum nudiflorum] gi|112032649|gb|ABH88284.1| ATP synthase CF0 subunit III [Drimys granadensis] gi|113200895|gb|ABI32411.1| ATP synthase CF0 subunit III [Daucus carota] gi|113200981|gb|ABI32496.1| ATP synthase CF0 subunit III [Liriodendron tulipifera] gi|113952609|gb|ABI49007.1| ATP synthase CF0 subunit III [Citrus sinensis] gi|114054371|gb|ABI49765.1| ATP synthase CF0 subunit III [Platanus occidentalis] gi|114054457|gb|ABI49850.1| ATP synthase CF0 subunit III [Nandina domestica] gi|116242151|gb|ABJ89666.1| ATP synthase CF0 subunit III [Coffea arabica] gi|133712046|gb|ABO36689.1| ATP synthase CF0 subunit III [Populus trichocarpa] gi|134286128|dbj|BAF49757.1| ATPase III subunit [Aethionema cordifolium] gi|134286213|dbj|BAF49841.1| ATPase III subunit [Aethionema grandiflorum] gi|134286472|dbj|BAF50097.1| ATPase III subunit [Barbarea verna] gi|134286827|dbj|BAF50448.1| ATPase III subunit [Lepidium virginicum] gi|134286916|dbj|BAF50536.1| ATPase III subunit [Lobularia maritima] gi|134287006|dbj|BAF50625.1| ATPase III subunit [Nasturtium officinale] gi|146744175|gb|ABQ43247.1| ATP synthase CF0 subunit III [Chloranthus spicatus] gi|146762272|gb|ABQ45236.1| ATP synthase CF0 subunit III [Buxus microphylla] gi|147917382|gb|ABQ52506.1| ATP synthase CF0 subunit III [Illicium oligandrum] gi|148668033|gb|ABR01417.1| ATP synthase CF0 subunit III [Dioscorea elephantipes] gi|156555998|emb|CAM98381.1| ATP synthase CF0 C chain [Cuscuta reflexa] gi|156573657|gb|ABU85162.1| ATP synthase CF0 subunit III [Anethum graveolens] gi|156598101|gb|ABU85316.1| ATP synthase CF0 subunit III [Elaeis oleifera] gi|156598293|gb|ABU85408.1| ATP synthase CF0 subunit III [Musa acuminata] gi|156598596|gb|ABU85555.1| ATP synthase CF0 subunit III [Scaevola aemula] gi|157695872|gb|ABV66141.1| ATP synthase CF0 subunit III [Manihot esculenta] gi|158938665|gb|ABW83682.1| ATP synthase CF0 subunit III [Cuscuta exaltata] gi|160369840|gb|ABX38731.1| ATP synthase CF0 subunit III [Acorus americanus] gi|166065344|gb|ABY79719.1| ATP synthase CF0 C subunit [Fagopyrum esculentum subsp. ancestrale] gi|166344119|gb|ABY86769.1| ATP synthase CF0 C chain [Carica papaya] gi|179366248|gb|ACB86519.1| ATP synthase CF0 subunit III [Guizotia abyssinica] gi|194132097|gb|ACF33351.1| ATP synthase CF0 subunit III [Gonystylus bancanus] gi|224979552|gb|ACN72679.1| atpH [Jatropha curcas] gi|226933869|gb|ACO92002.1| ATP synthase CF0 subunit III [Megaleranthis saniculifolia] gi|254833096|gb|ACT83099.1| ATP synthase CF0 subunit III [Oncidium Gower Ramsey] gi|269924831|gb|ACZ52704.1| ATP synthase CF0 C subunit [Parthenium argentatum] gi|281371759|gb|ADA63686.1| ATP synthase CF0 subunit III [Typha latifolia] gi|284444063|gb|ADB85770.1| ATP synthase CF0 C subunit-like protein [Wolffia arrhiza] gi|289645562|gb|ADD13625.1| ATP synthase CF0 subunit III [Anthriscus cerefolium] gi|290490316|gb|ADD31565.1| ATP synthase CF0 subunit III protein [Antirrhinum majus] gi|290490318|gb|ADD31566.1| ATP synthase CF0 subunit III protein [Aucuba japonica] gi|290490320|gb|ADD31567.1| ATP synthase CF0 subunit III protein [Dillenia indica] gi|290490322|gb|ADD31568.1| ATP synthase CF0 subunit III protein [Ehretia acuminata] gi|290490324|gb|ADD31569.1| ATP synthase CF0 subunit III protein [Ilex cornuta] gi|290490326|gb|ADD31570.1| ATP synthase CF0 subunit III protein [Lonicera japonica] gi|290490328|gb|ADD31571.1| ATP synthase CF0 subunit III protein [Meliosma aff. cuneifolia Moore 333] gi|290490330|gb|ADD31572.1| ATP synthase CF0 subunit III protein [Nelumbo nucifera] gi|290490332|gb|ADD31573.1| ATP synthase CF0 subunit III protein [Nerium oleander] gi|290490344|gb|ADD31579.1| ATP synthase CF0 subunit III protein [Cornus florida] gi|290490346|gb|ADD31580.1| ATP synthase CF0 subunit III protein [Euonymus americanus] gi|290490348|gb|ADD31581.1| ATP synthase CF0 subunit III protein [Ficus sp. Moore 315] gi|290490350|gb|ADD31582.1| ATP synthase CF0 subunit III protein [Gunnera manicata] gi|290490352|gb|ADD31583.1| ATP synthase CF0 subunit III protein [Heuchera sanguinea] gi|290490354|gb|ADD31584.1| ATP synthase CF0 subunit III protein [Liquidambar styraciflua] gi|290490356|gb|ADD31585.1| ATP synthase CF0 subunit III protein [Oxalis latifolia] gi|290490358|gb|ADD31586.1| ATP synthase CF0 subunit III protein [Plumbago auriculata] gi|290490360|gb|ADD31587.1| ATP synthase CF0 subunit III protein [Quercus nigra] gi|290490362|gb|ADD31588.1| ATP synthase CF0 subunit III protein [Staphylea colchica] gi|290490364|gb|ADD31589.1| ATP synthase CF0 subunit III protein [Trochodendron aralioides] gi|290775779|gb|ADD62275.1| ATP synthase CF0 subunit III [Gossypium thurberi] gi|290790905|gb|ADD63160.1| ATP synthase CF0 C chain subunit III [Phoenix dactylifera] gi|291059240|gb|ADD72076.1| ATP synthase CF0 subunit III [Olea europaea] gi|291575382|gb|ADE18095.1| ATP synthase CF0 subunit III [Isoetes flaccida] gi|294620564|gb|ADF28133.1| ATP synthase CF0 C chain subunit III [Phoenix dactylifera] gi|296936658|gb|ADH94330.1| ATP synthase CF0 subunit III [Syzygium cumini] gi|308223272|gb|ADO23580.1| ATP synthase CF0 subunit III [Eucalyptus grandis] gi|308523499|gb|ADO33549.1| ATP synthase CF0 C subunit [Hevea brasiliensis] gi|308742584|gb|ADO33435.1| ATP synthase CF0 subunit III [Smilax china] gi|309252877|gb|ADO60297.1| ATPase subunit III [Corynocarpus laevigata] gi|309321254|gb|ADO64797.1| ATP synthase CF0 subunit III [Theobroma cacao] gi|309321335|gb|ADO64877.1| ATP synthase CF0 subunit III [Theobroma cacao] gi|309321421|gb|ADO64962.1| ATP synthase CF0 subunit III [Prunus persica] gi|309321507|gb|ADO65047.1| ATP synthase CF0 subunit III [Castanea mollissima] gi|324022764|gb|ADY15338.1| ATP synthase CF0 subunit III [Fragaria vesca subsp. vesca] gi|326200268|gb|ADZ52307.1| ATP synthase CF0 C subunit [Asclepias syriaca] gi|328795420|emb|CBR30301.1| ATP synthase CF0 C subunit [Olea europaea subsp. europaea] gi|224347|prf||1102209A ATPase III,H translocating gi|225272|prf||1211235G ATPase III Length = 81 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|229542490|ref|ZP_04431550.1| ATP synthase F0, C subunit [Bacillus coagulans 36D1] gi|229326910|gb|EEN92585.1| ATP synthase F0, C subunit [Bacillus coagulans 36D1] Length = 72 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 21/53 (39%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + I + G R P A +T + I + E+L + +++ + L Sbjct: 18 GAGIGNGLIVGRTVEGIARQPEARGLLQTTMFIGIGLVEALPIIAVVIAFIAL 70 >gi|108796673|ref|YP_636517.1| ATP synthase CF0 C subunit [Zygnema circumcarinatum] gi|122233018|sp|Q32RK9|ATPH_ZYGCR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|61393657|gb|AAX45799.1| CF0 subunit III of ATP synthase [Zygnema circumcarinatum] Length = 81 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|68536425|ref|YP_251130.1| F0F1 ATP synthase subunit C [Corynebacterium jeikeium K411] gi|260577558|ref|ZP_05845497.1| ATP synthase C chain [Corynebacterium jeikeium ATCC 43734] gi|68264024|emb|CAI37512.1| ATP synthase C chain [Corynebacterium jeikeium K411] gi|258604282|gb|EEW17520.1| ATP synthase C chain [Corynebacterium jeikeium ATCC 43734] Length = 80 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G A+ V N+ R P A +T + + AE+L L + Sbjct: 21 IGYGLAAIG---SAIGVGNVAGKTAEAMARQPEMAGQLRTTMFLGIAFAEALALIGFVAG 77 Query: 85 ML 86 L Sbjct: 78 FL 79 >gi|78186930|ref|YP_374973.1| F0F1 ATP synthase subunit C [Chlorobium luteolum DSM 273] gi|78166832|gb|ABB23930.1| ATP synthase F0 subcomplex C subunit [Chlorobium luteolum DSM 273] Length = 93 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 26/60 (43%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL + L + P A+S+ + + + ES+ ++ + M+L+F Sbjct: 20 AVGSIGPALGEGRAVASALEALAQQPDASSSITRTLFVGLAMIESVAIYCFVTSMILIFA 79 >gi|213691221|ref|YP_002321807.1| ATP synthase F0, C subunit [Bifidobacterium longum subsp. infantis ATCC 15697] gi|254809771|sp|B7GTY8|ATPL_BIFLI RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|213522682|gb|ACJ51429.1| ATP synthase F0, C subunit [Bifidobacterium longum subsp. infantis ATCC 15697] gi|320457282|dbj|BAJ67903.1| ATP synthase subunit C [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 76 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 22/56 (39%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 +G + + +F + R P + +T + I + E L L + +++ Sbjct: 20 IGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLALVEVLALIGFVAALII 75 >gi|167747409|ref|ZP_02419536.1| hypothetical protein ANACAC_02129 [Anaerostipes caccae DSM 14662] gi|317471140|ref|ZP_07930511.1| ATP synthase subunit C protein [Anaerostipes sp. 3_2_56FAA] gi|167652771|gb|EDR96900.1| hypothetical protein ANACAC_02129 [Anaerostipes caccae DSM 14662] gi|316901355|gb|EFV23298.1| ATP synthase subunit C protein [Anaerostipes sp. 3_2_56FAA] Length = 87 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 15/73 (20%), Positives = 32/73 (43%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + L + G+A + + + RNP A + +L+ +AE+ G Sbjct: 8 FVLGCSAIGAGLALIAGIGPGVGQGYAAGQGAAAVGRNPGAKGDIMSTMLLGQAVAETTG 67 Query: 78 LFLLLVVMLLLFV 90 L+ L++ ++LL+ Sbjct: 68 LYGLVIGLILLYA 80 >gi|309322174|ref|YP_003934089.1| ATP synthase CF0 subunit III [Geranium palmatum] gi|197132326|gb|ACH47681.1| ATP synthase CF0 subunit III [Geranium carolinianum] gi|197132328|gb|ACH47682.1| ATP synthase CF0 subunit III [Geranium macrorrhizum] gi|197132330|gb|ACH47683.1| ATP synthase CF0 subunit III [Geranium palmatum] gi|300069267|gb|ADJ66388.1| ATP synthase CF0 subunit III [Geranium palmatum] Length = 81 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGRAVEGISRQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|169826595|ref|YP_001696753.1| F0F1 ATP synthase subunit C [Lysinibacillus sphaericus C3-41] gi|299537987|ref|ZP_07051273.1| F0F1 ATP synthase subunit C [Lysinibacillus fusiformis ZC1] gi|168991083|gb|ACA38623.1| ATP synthase F0, C subunit [Lysinibacillus sphaericus C3-41] gi|298726569|gb|EFI67158.1| F0F1 ATP synthase subunit C [Lysinibacillus fusiformis ZC1] Length = 74 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 22/47 (46%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 I + + G R P A +T + I + E+L + ++V +++ Sbjct: 26 GLIVSKTVEGIARQPEARGVLQTTMFIGVALVEALPIIAVVVAFIVM 72 >gi|60117149|ref|YP_209612.1| ATP synthase F0 subunit c [Polysphondylium pallidum] gi|51339713|gb|AAU00627.1| ATP synthase F0 subunit c [Polysphondylium pallidum] Length = 87 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 29/68 (42%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K V G+A +G+ V +F ++ NP ++ + E++ L L Sbjct: 19 GKKVGAGLASIGLAGAGAGVGLVFAAFVLSVSFNPNLRGELFKLTMLGFALTEAVALLAL 78 Query: 82 LVVMLLLF 89 ++ L+L+ Sbjct: 79 MMSFLILY 86 >gi|182679692|ref|YP_001833838.1| F0F1 ATP synthase subunit C [Beijerinckia indica subsp. indica ATCC 9039] gi|182635575|gb|ACB96349.1| ATP synthase F0, C subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 86 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G ALA + R P AA + + + E++ ++ L++ +L+LF Sbjct: 23 FGAIGPALAEGRAVAAAMDAIARQPEAAGTLSRTLFVGLAMIETMAIYCLVIALLVLFA 81 >gi|301500845|ref|YP_003795257.1| ATP synthase CF0 C subunit [Chromera velia] gi|301500920|ref|YP_003795332.1| ATP synthase CF0 C subunit [Chromera velia] gi|300069391|gb|ADJ66499.1| ATP synthase CF0 C subunit [Chromera velia] gi|300069466|gb|ADJ66574.1| ATP synthase CF0 C subunit [Chromera velia] Length = 169 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 27 VGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 G+A LG + + +S R +T +L + E++ ++ LL+ + Sbjct: 13 AGIAIGLGSIGPGIGQGILAGDAVSAISRQLEGEDKIRTTLLPSLAVLEAVTIYGLLIAL 72 Query: 86 LL 87 ++ Sbjct: 73 VI 74 >gi|255708778|gb|ACU30294.1| ATP synthase subunit 9 [Silene tunicoides] Length = 56 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 20/41 (48%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + N+F+ ++ RNP A ++ + E++ LF L Sbjct: 16 IGNVFSALINSVARNPSLAKQLFGYAILGFALTEAIALFAL 56 >gi|91202299|emb|CAJ75359.1| strongly similar to ATPE encoding subunit c of ATP synthase [Candidatus Kuenenia stuttgartiensis] Length = 93 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 25/60 (41%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL + LS + P A+ + + + ES ++ +V M+++F Sbjct: 20 AVGSIGPALGEARAAAQALSSIAQQPDEANTITRTLFVSMAMIESTAIYCFVVAMIVIFA 79 >gi|145596147|ref|YP_001160444.1| ATP synthase F0, C subunit [Salinispora tropica CNB-440] gi|145305484|gb|ABP56066.1| ATP synthase F0, C subunit [Salinispora tropica CNB-440] Length = 74 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 29/56 (51%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 L + V+ +F Y+ + R P +A ++T +++ + E+L LF L++ + Sbjct: 17 LAAIGPGIGVALVFAAYIQASARQPESAGFNRTWLVLGFALVEALALFGLVLAFAI 72 >gi|301062827|ref|ZP_07203425.1| alternate F1F0 ATPase, F0 subunit C [delta proteobacterium NaphS2] gi|300443089|gb|EFK07256.1| alternate F1F0 ATPase, F0 subunit C [delta proteobacterium NaphS2] Length = 92 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 15/77 (19%), Positives = 30/77 (38%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 A G+ ++A+ A +G AL L + P + + + + Sbjct: 3 ALGWIAVASILAAGIGMGIGAIGPALGEGRALAQALGSIAQQPDETNTITRTLFVGMAMV 62 Query: 74 ESLGLFLLLVVMLLLFV 90 ES ++ +V M+L+F Sbjct: 63 ESTAIYCFVVAMILIFA 79 >gi|159161147|ref|YP_001542434.1| ATP synthase CF0 subunit III [Ceratophyllum demersum] gi|223635053|sp|A8SE66|ATPH_CERDE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|148508430|gb|ABQ81437.1| ATP synthase CF0 subunit III [Ceratophyllum demersum] gi|227481106|emb|CAP62485.1| ATPase III subunit [Ceratophyllum demersum] Length = 81 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +A +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 SASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|291456002|ref|ZP_06595392.1| ATP synthase F0, C subunit [Bifidobacterium breve DSM 20213] gi|291382411|gb|EFE89929.1| ATP synthase F0, C subunit [Bifidobacterium breve DSM 20213] Length = 76 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 21/55 (38%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 +G + + +F + R P + +T + I + E L L + ++ Sbjct: 20 IGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLALVEVLALIGFVTALM 74 >gi|290490342|gb|ADD31578.1| ATP synthase CF0 subunit III protein [Bulnesia arborea] Length = 81 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPQAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|315038007|ref|YP_004031575.1| F0F1 ATP synthase subunit C [Lactobacillus amylovorus GRL 1112] gi|325956460|ref|YP_004291872.1| F0F1 ATP synthase subunit C [Lactobacillus acidophilus 30SC] gi|312276140|gb|ADQ58780.1| F0F1 ATP synthase subunit C [Lactobacillus amylovorus GRL 1112] gi|325333025|gb|ADZ06933.1| F0F1 ATP synthase subunit C [Lactobacillus acidophilus 30SC] gi|327183287|gb|AEA31734.1| F0F1 ATP synthase subunit C [Lactobacillus amylovorus GRL 1118] Length = 74 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 24/49 (48%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + L G R P +A + + I + E++ + ++V L+LF+ Sbjct: 26 GKVISKTLEGMARQPESAGNLRATMFIGVGLIEAVPILSIVVAFLILFL 74 >gi|329768927|ref|ZP_08260354.1| hypothetical protein HMPREF0433_00118 [Gemella sanguinis M325] gi|328836644|gb|EGF86302.1| hypothetical protein HMPREF0433_00118 [Gemella sanguinis M325] Length = 71 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 22/47 (46%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 +F ++ G R P S K+ + + E++ + +++ ++L Sbjct: 23 GFLFGKFIEGVSRQPELESRLKSNAFVLFALVEAVPILAIVISFIIL 69 >gi|326774100|ref|ZP_08233382.1| ATP synthase F0, C subunit [Actinomyces viscosus C505] gi|329945878|ref|ZP_08293565.1| ATP synthase F0, C subunit [Actinomyces sp. oral taxon 170 str. F0386] gi|326636239|gb|EGE37143.1| ATP synthase F0, C subunit [Actinomyces viscosus C505] gi|328528326|gb|EGF55304.1| ATP synthase F0, C subunit [Actinomyces sp. oral taxon 170 str. F0386] Length = 69 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 S A YV G+A LG + + + R P A T ++I A + E+L L Sbjct: 3 SAALAYVGYGLATLG---PGVGIGLLVGKTQEATARQPEVAGRLFTNMIIGAGMVEALAL 59 Query: 79 FLLLVVMLL 87 ++ +++ Sbjct: 60 IGFVMPLVV 68 >gi|259046354|ref|ZP_05736755.1| conserved domain protein [Granulicatella adiacens ATCC 49175] gi|259036991|gb|EEW38246.1| conserved domain protein [Granulicatella adiacens ATCC 49175] Length = 71 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 9/42 (21%), Positives = 24/42 (57%) Query: 49 LSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + R P ++ ++ + I + E++ +F +L+ ++L+FV Sbjct: 29 IESMTRQPELSNELRSTMFIGVALIEAMPIFAVLIALILVFV 70 >gi|239982322|ref|ZP_04704846.1| putative ATP synthase C chain [Streptomyces albus J1074] gi|291454167|ref|ZP_06593557.1| H(+)-transporting ATP synthase [Streptomyces albus J1074] gi|291357116|gb|EFE84018.1| H(+)-transporting ATP synthase [Streptomyces albus J1074] Length = 78 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V IF + R P AA + +L+ + E+L L +V Sbjct: 18 IGYGLAAIG---PGVGVGIIFGNGVQAMARQPEAAGLIRQNMLLGFAVVEALALIGFVVP 74 Query: 85 MLL 87 +L Sbjct: 75 FIL 77 >gi|28261704|ref|NP_783219.1| ATP synthase CF0 C subunit [Atropa belladonna] gi|75303121|sp|Q8RU61|ATPH_ATRBE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|20068318|emb|CAC88031.1| atpAse subunit III [Atropa belladonna] Length = 81 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|227877276|ref|ZP_03995349.1| F0F1 ATP synthase subunit C [Lactobacillus crispatus JV-V01] gi|256842839|ref|ZP_05548327.1| F0F1-type ATP synthase [Lactobacillus crispatus 125-2-CHN] gi|256848797|ref|ZP_05554231.1| F0F1-type ATP synthase [Lactobacillus crispatus MV-1A-US] gi|262045805|ref|ZP_06018769.1| F0F1-type ATP synthase [Lactobacillus crispatus MV-3A-US] gi|293381674|ref|ZP_06627655.1| ATP synthase F0, C subunit [Lactobacillus crispatus 214-1] gi|295692628|ref|YP_003601238.1| ATP synthase subunit c [Lactobacillus crispatus ST1] gi|312977641|ref|ZP_07789388.1| ATP synthase F0, C subunit [Lactobacillus crispatus CTV-05] gi|227863132|gb|EEJ70578.1| F0F1 ATP synthase subunit C [Lactobacillus crispatus JV-V01] gi|256614259|gb|EEU19460.1| F0F1-type ATP synthase [Lactobacillus crispatus 125-2-CHN] gi|256714336|gb|EEU29323.1| F0F1-type ATP synthase [Lactobacillus crispatus MV-1A-US] gi|260573764|gb|EEX30320.1| F0F1-type ATP synthase [Lactobacillus crispatus MV-3A-US] gi|290921721|gb|EFD98742.1| ATP synthase F0, C subunit [Lactobacillus crispatus 214-1] gi|295030734|emb|CBL50213.1| ATP synthase subunit C [Lactobacillus crispatus ST1] gi|310895380|gb|EFQ44447.1| ATP synthase F0, C subunit [Lactobacillus crispatus CTV-05] Length = 74 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 24/49 (48%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + L G R P +A + + I + E++ + ++V L+LF+ Sbjct: 26 GKVISKTLEGMARQPESAGNLRATMFIGVGLIEAVPILAIVVAFLILFL 74 >gi|9884626|dbj|BAB02632.1| H+-transporting ATP synthase like [Arabidopsis thaliana] Length = 81 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G+A L ++ + G R P A + +L+ V E+L ++ Sbjct: 7 AASVIVAGLAVGLASIEPGVSQGTTAGQAVEGIVRQPEAEGKIRGTLLLSLVFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 LLV + LLFV Sbjct: 67 GLLVALTLLFV 77 >gi|227548007|ref|ZP_03978056.1| H(+)-transporting two-sector ATPase [Corynebacterium lipophiloflavum DSM 44291] gi|227079913|gb|EEI17876.1| H(+)-transporting two-sector ATPase [Corynebacterium lipophiloflavum DSM 44291] Length = 73 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + + + + G R P A +T + + E+L L L+ Sbjct: 14 IGYGIATIG---PGIGIGMLVGKTVEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAG 70 Query: 85 ML 86 L Sbjct: 71 FL 72 >gi|157166513|gb|ABV25259.1| ATP synthase subunit 9 [Silene vulgaris] Length = 56 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 + + N+F++ + RNP A ++ + E++ LF L Sbjct: 14 IGIGNVFSSLIXSVARNPSLAKLLFGYAILGFALTEAIALFAL 56 >gi|172040391|ref|YP_001800105.1| F0F1 ATP synthase subunit C [Corynebacterium urealyticum DSM 7109] gi|171851695|emb|CAQ04671.1| ATP synthase C chain [Corynebacterium urealyticum DSM 7109] Length = 80 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G A+ V N+ R P A +T + + AE+L L + Sbjct: 21 IGYGLAAIG---SAIGVGNVAGKTAEAMARQPEMAGQLRTTMFLGIAFAEALALIGFVAG 77 Query: 85 ML 86 L Sbjct: 78 FL 79 >gi|156618897|ref|YP_001430033.1| ATP synthase CF0 C subunit [Cuscuta gronovii] gi|159106787|ref|YP_001531207.1| ATP synthase CF0 subunit III [Cuscuta obtusiflora] gi|223634962|sp|A7M8Z1|ATPH_CUSGR RecName: Full=ATP synthase subunit C, plastid; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|223634963|sp|A8W3H7|ATPH_CUSOB RecName: Full=ATP synthase subunit C, plastid; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|156555935|emb|CAM98319.1| ATP synthase CF0 C chain [Cuscuta gronovii] gi|158142511|gb|ABW20552.1| ATP synthase CF0 subunit III [Cuscuta obtusiflora] Length = 81 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|159039545|ref|YP_001538798.1| H+transporting two-sector ATPase C subunit [Salinispora arenicola CNS-205] gi|157918380|gb|ABV99807.1| H+transporting two-sector ATPase C subunit [Salinispora arenicola CNS-205] Length = 77 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V +F Y+ R P ++ V I + E+L L + Sbjct: 14 IGYGLAAIG---PGIGVGLVFAAYIQSTARQPESSRMTLPYVWIGFAVIEALALLGIAFG 70 Query: 85 ML 86 + Sbjct: 71 FI 72 >gi|298358756|ref|NP_001177258.1| ATP synthase lipid-binding protein, mitochondrial isoform B precursor [Homo sapiens] gi|119631513|gb|EAX11108.1| hCG16568, isoform CRA_b [Homo sapiens] Length = 105 Score = 35.2 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 17/34 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFR 54 AAK++ G A +G+ + +F + + G R Sbjct: 72 AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYAR 105 >gi|83816796|ref|YP_445046.1| ATP synthase F0, C subunit [Salinibacter ruber DSM 13855] gi|294506920|ref|YP_003570978.1| ATP synthase C subunit [Salinibacter ruber M8] gi|83758190|gb|ABC46303.1| ATP synthase F0, C subunit [Salinibacter ruber DSM 13855] gi|294343248|emb|CBH24026.1| ATP synthase C subunit [Salinibacter ruber M8] Length = 76 Score = 35.2 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 31/56 (55%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 A+ + + ++ + GA R P AA + +++ A + E + LF L++ +LL+ + Sbjct: 21 GAAIGIGRLASSSMDGAARQPEAAGDIRGLMIVSAGLIEGVALFALIICLLLVLFV 76 >gi|126661082|ref|ZP_01732164.1| H+-transporting two-sector ATPase, C subunit [Cyanothece sp. CCY0110] gi|172036422|ref|YP_001802923.1| putative ATP synthase F0, C subunit [Cyanothece sp. ATCC 51142] gi|126617626|gb|EAZ88413.1| H+-transporting two-sector ATPase, C subunit [Cyanothece sp. CCY0110] gi|171697876|gb|ACB50857.1| putative ATP synthase F0, C subunit [Cyanothece sp. ATCC 51142] Length = 92 Score = 35.2 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 26/67 (38%), Gaps = 1/67 (1%) Query: 25 VAVGMA-CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + G+ +G A+ L + P A+ + + + ES ++ +V Sbjct: 13 ITAGLTIAIGSVAPAIGEGLALANALRALAQQPDKANTITRTLFVGLALVESTAIYCFVV 72 Query: 84 VMLLLFV 90 M+L+F Sbjct: 73 SMILIFA 79 >gi|311033327|ref|ZP_07711417.1| hypothetical protein Bm3-1_22774 [Bacillus sp. m3-13] Length = 70 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 23/53 (43%) Query: 36 LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + I + + G R P S +T + I + E++ + +++ +++ Sbjct: 16 GAGIGNGLIVSRTVEGIARQPELKSTLQTTMFIGVALVEAIPIIAVVIAFMVI 68 >gi|238060781|ref|ZP_04605490.1| H+transporting two-sector ATPase C subunit [Micromonospora sp. ATCC 39149] gi|237882592|gb|EEP71420.1| H+transporting two-sector ATPase C subunit [Micromonospora sp. ATCC 39149] Length = 77 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V +F Y+ R P ++ V I + E+L L + Sbjct: 14 IGYGLAAIG---PGIGVGLVFAAYIQSTARQPESSRMTLPYVWIGFAVIEALALLGIAFG 70 Query: 85 ML 86 + Sbjct: 71 FI 72 >gi|58618218|gb|AAW80674.1| chloroplast ATPH isoform 4 [Heterocapsa triquetra] Length = 141 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 2/65 (3%) Query: 26 AVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVM 85 A+G+A +G V +++ + G R P A + +L+ ESL ++ L++ + Sbjct: 74 AIGLAAIGPSGVGQGIAS--GRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIAL 131 Query: 86 LLLFV 90 +LLF Sbjct: 132 VLLFA 136 >gi|81428740|ref|YP_395740.1| H(+)-transporting two-sector ATPase (ATP synthase), C subunit [Lactobacillus sakei subsp. sakei 23K] gi|123742225|sp|Q38WK0|ATPL_LACSS RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|78610382|emb|CAI55432.1| H(+)-transporting two-sector ATPase (ATP synthase), C subunit [Lactobacillus sakei subsp. sakei 23K] Length = 70 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 8/50 (16%), Positives = 23/50 (46%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 + + + R P ++ ++ + I + E++ + ++V L+LF Sbjct: 20 GNGKVISKTIESMARQPELSAQLRSTMFIGVGLIEAVPILSIVVSFLILF 69 >gi|259017972|gb|ACV89574.1| ATP synthetase subunit 9 [Cystophora retorta] Length = 44 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 8/44 (18%), Positives = 18/44 (40%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLI 68 + G+A +G+ + + +F + G RNP ++ Sbjct: 1 LGAGLATIGLAGAGVGIGTVFGALVLGTARNPSLKDELFRIAIL 44 >gi|301353398|ref|YP_003795567.1| ATP synthase CFO C subunit [Pteridium aquilinum subsp. aquilinum] gi|301016316|gb|ADK47603.1| ATP synthase CFO C subunit [Pteridium aquilinum subsp. aquilinum] Length = 90 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + L + E+L ++ Sbjct: 7 AAPVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTSLSSSAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V LF Sbjct: 67 GLVVAPAPLFA 77 >gi|237823447|pdb|2W5J|A Chain A, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823448|pdb|2W5J|B Chain B, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823449|pdb|2W5J|C Chain C, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823450|pdb|2W5J|D Chain D, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823451|pdb|2W5J|E Chain E, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823452|pdb|2W5J|F Chain F, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823453|pdb|2W5J|G Chain G, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823454|pdb|2W5J|H Chain H, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823455|pdb|2W5J|I Chain I, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823456|pdb|2W5J|J Chain J, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823457|pdb|2W5J|K Chain K, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823458|pdb|2W5J|L Chain L, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823459|pdb|2W5J|M Chain M, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase gi|237823460|pdb|2W5J|V Chain V, Structure Of The C14-Rotor Ring Of The Proton Translocating Chloroplast Atp Synthase Length = 78 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 6 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 65 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 66 GLVVALALLFA 76 >gi|242910138|ref|YP_002970631.1| ATP synthase CF0 subunit III [Alsophila spinulosa] gi|218454807|gb|ACK77144.1| ATP synthase CF0 subunit III [Alsophila spinulosa] Length = 81 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + L F Sbjct: 67 GLVVALALSFA 77 >gi|197132334|gb|ACH47685.1| ATP synthase CF0 subunit III [Sarcocaulon vanderietiae] Length = 81 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPQAEGQIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L++ + LLF Sbjct: 67 GLVIALALLFA 77 >gi|57234631|ref|YP_181302.1| ATP synthase F0, C subunit [Dehalococcoides ethenogenes 195] gi|73748398|ref|YP_307637.1| ATP synthase F0, C subunit [Dehalococcoides sp. CBDB1] gi|147669178|ref|YP_001213996.1| ATP synthase F0, C subunit [Dehalococcoides sp. BAV1] gi|270307922|ref|YP_003329980.1| ATP synthase F0, C subunit [Dehalococcoides sp. VS] gi|289432446|ref|YP_003462319.1| ATP synthase F0 C subunit [Dehalococcoides sp. GT] gi|123732469|sp|Q3Z8Z7|ATPL_DEHE1 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123732545|sp|Q3ZZU2|ATPL_DEHSC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487645|sp|A5FRR4|ATPL_DEHSB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|57225079|gb|AAW40136.1| ATP synthase F0, C subunit [Dehalococcoides ethenogenes 195] gi|73660114|emb|CAI82721.1| ATP synthase F0, C subunit [Dehalococcoides sp. CBDB1] gi|146270126|gb|ABQ17118.1| ATP synthase F0 subcomplex C subunit [Dehalococcoides sp. BAV1] gi|270153814|gb|ACZ61652.1| ATP synthase F0, C subunit [Dehalococcoides sp. VS] gi|288946166|gb|ADC73863.1| ATP synthase F0, C subunit [Dehalococcoides sp. GT] Length = 76 Score = 35.2 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Query: 23 KYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K +A G+A LG + V + L RNP A + T +++ AES+ +F L Sbjct: 7 KLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAESIAIFAL 66 Query: 82 LVVMLLLFV 90 ++ ++L+FV Sbjct: 67 VISIVLIFV 75 >gi|296128921|ref|YP_003636171.1| ATP synthase F0, C subunit [Cellulomonas flavigena DSM 20109] gi|296020736|gb|ADG73972.1| ATP synthase F0, C subunit [Cellulomonas flavigena DSM 20109] Length = 81 Score = 35.2 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 21/82 (25%), Positives = 31/82 (37%), Gaps = 3/82 (3%) Query: 5 MMEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKT 64 M + + AA S V G+A LG + + + + G R P A +T Sbjct: 1 MADTSMILAAADAVSGNIATVGYGLAVLG---PGIGLGILIGKTVEGIARQPEVAGQLRT 57 Query: 65 EVLIFAVIAESLGLFLLLVVML 86 + I E LGL L+ L Sbjct: 58 TMFIGIGFVEVLGLLGLITGFL 79 >gi|86606757|ref|YP_475520.1| F0F1 ATP synthase subunit C [Synechococcus sp. JA-3-3Ab] gi|86610104|ref|YP_478866.1| F0F1 ATP synthase subunit C [Synechococcus sp. JA-2-3B'a(2-13)] gi|123751649|sp|Q2JIF6|ATPL_SYNJB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123751773|sp|Q2JSV7|ATPL_SYNJA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|86555299|gb|ABD00257.1| ATP synthase F0, C subunit [Synechococcus sp. JA-3-3Ab] gi|86558646|gb|ABD03603.1| ATP synthase F0, C subunit [Synechococcus sp. JA-2-3B'a(2-13)] Length = 81 Score = 35.2 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 23/48 (47%) Query: 43 NIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 N + G R P A + +L+ E+L ++ L+V ++LLF Sbjct: 30 NAAAAAMEGLARQPEAEDKIRGNLLVSLAFMEALTIYGLVVALVLLFA 77 >gi|262197648|ref|YP_003268857.1| H+transporting two-sector ATPase C subunit [Haliangium ochraceum DSM 14365] gi|262080995|gb|ACY16964.1| H+transporting two-sector ATPase C subunit [Haliangium ochraceum DSM 14365] Length = 114 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 T L G RNP AA T +++ + ESL ++ L++ +LLL Sbjct: 65 GRAAATALDGIARNPGAADKLFTPMILGLALIESLVIYALIISILLL 111 >gi|238855952|ref|ZP_04646238.1| ATP synthase F0, C subunit [Lactobacillus jensenii 269-3] gi|256850896|ref|ZP_05556285.1| ATP synthase F0, C subunit [Lactobacillus jensenii 27-2-CHN] gi|260661110|ref|ZP_05862024.1| ATP synthase F0, C subunit [Lactobacillus jensenii 115-3-CHN] gi|260664669|ref|ZP_05865521.1| ATP synthase F0, C subunit [Lactobacillus jensenii SJ-7A-US] gi|282934192|ref|ZP_06339470.1| ATP synthase F0, C subunit [Lactobacillus jensenii 208-1] gi|282934359|ref|ZP_06339626.1| ATP synthase F0, C subunit [Lactobacillus jensenii 208-1] gi|297205773|ref|ZP_06923168.1| ATP synthase F0 sector subunit C [Lactobacillus jensenii JV-V16] gi|313471880|ref|ZP_07812372.1| ATP synthase F0, C subunit [Lactobacillus jensenii 1153] gi|238831425|gb|EEQ23776.1| ATP synthase F0, C subunit [Lactobacillus jensenii 269-3] gi|239529204|gb|EEQ68205.1| ATP synthase F0, C subunit [Lactobacillus jensenii 1153] gi|256615958|gb|EEU21146.1| ATP synthase F0, C subunit [Lactobacillus jensenii 27-2-CHN] gi|260548047|gb|EEX24023.1| ATP synthase F0, C subunit [Lactobacillus jensenii 115-3-CHN] gi|260561734|gb|EEX27706.1| ATP synthase F0, C subunit [Lactobacillus jensenii SJ-7A-US] gi|281301569|gb|EFA93846.1| ATP synthase F0, C subunit [Lactobacillus jensenii 208-1] gi|281301806|gb|EFA94072.1| ATP synthase F0, C subunit [Lactobacillus jensenii 208-1] gi|297148899|gb|EFH29197.1| ATP synthase F0 sector subunit C [Lactobacillus jensenii JV-V16] Length = 71 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 26/51 (50%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + +T + G R P +AS ++ + I + E++ + +++ L+ F+ Sbjct: 20 GNGKVISTTIQGMARQPESASELRSTMFIGVGLIEAVPILAVVIAFLIFFL 70 >gi|317484415|ref|ZP_07943330.1| ATP synthase subunit C [Bilophila wadsworthia 3_1_6] gi|316924334|gb|EFV45505.1| ATP synthase subunit C [Bilophila wadsworthia 3_1_6] Length = 111 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 8/94 (8%) Query: 5 MMEAATFAAANGYYSLAAKYVAVGMACLGMG--------LVALAVSNIFTTYLSGAFRNP 56 MM A+ A A + ++G+A G + + G RNP Sbjct: 14 MMGIASLAFAADGAPVKLDSASLGLAIFGCAIGMAVAAAGCGIGQGLGLKSACEGIARNP 73 Query: 57 CAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 AA + +++ ESL ++ L+V +++LF Sbjct: 74 DAAGKIQVSLILGLAFVESLAIYSLVVNLIILFA 107 >gi|94987500|ref|YP_595433.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis PHE/MN1-00] gi|94731749|emb|CAJ55112.1| F0F1-type ATP synthase, subunit c [Lawsonia intracellularis PHE/MN1-00] Length = 115 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 25/61 (40%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 L + G RNP A+ + +++ ESL ++ L++ +++LF Sbjct: 51 MALAALGCGIGQGLGLKGACEGIARNPEASGKIQVALILGLAFIESLAIYALVINLIILF 110 Query: 90 V 90 Sbjct: 111 A 111 >gi|309322263|ref|YP_003934341.1| ATP synthase CF0 subunit III [Monsonia speciosa] gi|197132332|gb|ACH47684.1| ATP synthase CF0 subunit III [Monsonia speciosa] gi|300069356|gb|ADJ66476.1| ATP synthase CF0 subunit III [Monsonia speciosa] Length = 81 Score = 35.2 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPQAEGQIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + +LF Sbjct: 67 GLVVALAILFA 77 >gi|290490334|gb|ADD31574.1| ATP synthase CF0 subunit III protein [Phoradendron serotinum] Length = 83 Score = 35.2 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVLAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|118360896|ref|XP_001013679.1| hypothetical protein TTHERM_00833720 [Tetrahymena thermophila] gi|89295446|gb|EAR93434.1| hypothetical protein TTHERM_00833720 [Tetrahymena thermophila SB210] Length = 782 Score = 35.2 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 16/83 (19%), Positives = 30/83 (36%), Gaps = 6/83 (7%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 M+ F + ++ KY+ +GM +G A+ VS +F + N + Sbjct: 410 MKPIEFNFQDRSDKISGKYIGLGMYAIG--GSAV-VSGMFGALI---AENSTFVVGTRGV 463 Query: 66 VLIFAVIAESLGLFLLLVVMLLL 88 L G+ +L + L Sbjct: 464 ALFGIAGFVVSGILSMLAGIWLF 486 >gi|83643799|ref|YP_432234.1| F0 ATP synthase subunit C [Hahella chejuensis KCTC 2396] gi|83631842|gb|ABC27809.1| ATP synthase F0, C subunit [Hahella chejuensis KCTC 2396] Length = 90 Score = 35.2 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG L ALA+ ++ L R P A + + I + ESL +++L++V+++LF Sbjct: 20 ALGAMLPALAMGKAISSALDALARQPEAEKSITRTLFIGLAMIESLAIYVLVIVLIVLF 78 >gi|60117212|ref|YP_209546.1| ATP synthase CF0 C subunit [Huperzia lucidula] gi|75286697|sp|Q5SCX4|ATPH_HUPLU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|50660020|gb|AAT80742.1| ATP synthase CF0 subunit III [Huperzia lucidula] Length = 81 Score = 35.2 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + L F Sbjct: 67 GLVVALALPFA 77 >gi|327441433|dbj|BAK17798.1| F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Solibacillus silvestris StLB046] Length = 74 Score = 35.2 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 23/47 (48%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 I + + G R P A A +T + I + E+L + +++ +++ Sbjct: 26 GLIVSKTVEGIARQPEARGALQTTMFIGVALVEALPIIAVVIAFIVM 72 >gi|241888572|ref|ZP_04775879.1| ATP synthase F0, C subunit [Gemella haemolysans ATCC 10379] gi|241864595|gb|EER68970.1| ATP synthase F0, C subunit [Gemella haemolysans ATCC 10379] Length = 71 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 8/47 (17%), Positives = 22/47 (46%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 +F ++ G R P S K+ + + E++ + +++ ++L Sbjct: 23 GFLFGKFIEGVSRQPELESRLKSNAFVLFALVEAVPILAIVISFVIL 69 >gi|157092937|gb|ABV22123.1| chloroplast ATP synthase subunit C [Alexandrium affine] Length = 145 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Query: 9 ATFAAANGYYSLAAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVL 67 A +A + A V G A L + + G R P A + +L Sbjct: 58 AAYADGGAVWVPALSAVGAGFAIGLAAIGSGVGQGIASGRCIDGISRQPEVADDLRGVLL 117 Query: 68 IFAVIAESLGLFLLLVVMLLLFV 90 + ESL ++ L++ ++LLF Sbjct: 118 LSLAFMESLTIYGLVIALVLLFA 140 >gi|300781413|ref|ZP_07091267.1| ATP synthase F0 sector subunit C [Corynebacterium genitalium ATCC 33030] gi|300533120|gb|EFK54181.1| ATP synthase F0 sector subunit C [Corynebacterium genitalium ATCC 33030] Length = 79 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 17/76 (22%), Positives = 28/76 (36%), Gaps = 3/76 (3%) Query: 11 FAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFA 70 A AN + G+A +G L + + + G R P A +T + + Sbjct: 6 LAQANEQTVTGLGTIGYGIATIG---PGLGIGILVGKTVEGMARQPEMAGQLRTTMFLGI 62 Query: 71 VIAESLGLFLLLVVML 86 E+L L L+ L Sbjct: 63 AFVEALALIGLVAGFL 78 >gi|58337085|ref|YP_193670.1| F0F1 ATP synthase subunit C [Lactobacillus acidophilus NCFM] gi|227903653|ref|ZP_04021458.1| F0F1 ATP synthase subunit C [Lactobacillus acidophilus ATCC 4796] gi|6652828|gb|AAF22493.1|AF098522_3 F1F0-ATPase subunit c [Lactobacillus acidophilus] gi|58254402|gb|AAV42639.1| H+-transporting ATP synthase chain c [Lactobacillus acidophilus NCFM] gi|227868540|gb|EEJ75961.1| F0F1 ATP synthase subunit C [Lactobacillus acidophilus ATCC 4796] Length = 77 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 24/51 (47%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P +A + + I + E++ + ++V L+LF+ Sbjct: 27 GNGKVISKTIEGMARQPESAGNLRATMFIGVGLIEAVPILAIVVAFLILFL 77 >gi|11466782|ref|NP_039378.1| ATP synthase CF0 C subunit [Oryza sativa Japonica Group] gi|11467187|ref|NP_043020.1| ATP synthase CF0 C subunit [Zea mays] gi|11497511|ref|NP_054919.1| ATP synthase CF0 C subunit [Spinacia oleracea] gi|14017567|ref|NP_114254.1| ATP synthase CF0 C subunit [Triticum aestivum] gi|48478768|ref|YP_024376.1| ATP synthase CF0 C subunit [Saccharum hybrid cultivar SP-80-3280] gi|50233966|ref|YP_052744.1| ATP synthase CF0 C subunit [Oryza nivara] gi|50812523|ref|YP_054626.1| ATP synthase CF0 C subunit [Saccharum officinarum] gi|91208975|ref|YP_538835.1| ATP synthase CF0 C subunit [Solanum bulbocastanum] gi|109156592|ref|YP_654211.1| ATP synthase CF0 C subunit [Oryza sativa Indica Group] gi|118430297|ref|YP_874731.1| ATP synthase CF0 subunit III [Agrostis stolonifera] gi|118430383|ref|YP_874648.1| ATP synthase CF0 subunit III [Hordeum vulgare subsp. vulgare] gi|118614487|ref|YP_899402.1| ATP synthase CF0 subunit III [Sorghum bicolor] gi|159106859|ref|YP_001531278.1| ATP synthase CF0 III [Lolium perenne] gi|194033144|ref|YP_002000482.1| ATP synthase CF0 C subunit [Brachypodium distachyon] gi|218176240|ref|YP_002364497.1| ATP synthase CF0 subunit III [Festuca arundinacea] gi|255961378|ref|YP_003097571.1| ATP synthase CF0 subunit III [Dendrocalamus latiflorus] gi|260677415|ref|YP_003208183.1| ATP synthase CF0 subunit III [Coix lacryma-jobi] gi|295065723|ref|YP_003587663.1| ATP synthase CF0 C subunit [Anomochloa marantoidea] gi|60391825|sp|P69447|ATPH_SPIOL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|60391826|sp|P69448|ATPH_WHEAT RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|60391827|sp|P69449|ATPH_MAIZE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|68565036|sp|Q6ENH9|ATPH_ORYNI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75290177|sp|Q6ENW8|ATPH_SACOF RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75291226|sp|Q6L3A2|ATPH_SACHY RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122226195|sp|Q2MIK0|ATPH_SOLBU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|148840823|sp|P0C2Z9|ATPH_ORYSA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|148840824|sp|P0C300|ATPH_ORYSI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|148840825|sp|P0C301|ATPH_ORYSJ RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634974|sp|A1E9I6|ATPH_HORVU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634981|sp|A8Y9G5|ATPH_LOLPR RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223634995|sp|A1E9R9|ATPH_SORBI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635044|sp|A1EA03|ATPH_AGRST RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|223635049|sp|B3TN46|ATPH_BRADI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|19920163|gb|AAM08595.1|AC092750_29 Putative ATPase III subunit from chromosome 10 chloroplast insertion [Oryza sativa Japonica Group] gi|20143585|gb|AAM12342.1|AC091680_43 ATPase III subunit [Oryza sativa Japonica Group] gi|20146748|gb|AAM12484.1|AC074232_11 ATPase III subunit [Oryza sativa Japonica Group] gi|21327355|gb|AAM48260.1|AC122148_13 Putative ATPase III subunit from chromosome 10 chloroplast insertion [Oryza sativa Japonica Group] gi|11976|emb|CAA33991.1| ATPase III subunit [Oryza sativa Japonica Group] gi|12251|emb|CAA27402.1| unnamed protein product [Spinacia oleracea] gi|12407|emb|CAA28875.1| unnamed protein product [Zea mays] gi|342580|gb|AAA84473.1| phosphorylation coupling factor alpha subunit (atpA) [Zea mays] gi|343673|gb|AAA84724.1| ATP synthase proton-translocating subunit [Triticum aestivum] gi|902217|emb|CAA60281.1| ATPase subunit III [Zea mays] gi|7636092|emb|CAB88712.1| ATPase subunit III [Spinacia oleracea] gi|13928200|dbj|BAB47029.1| ATPase III subunit [Triticum aestivum] gi|42795484|gb|AAS46051.1| ATP synthase CF0 C chain [Oryza sativa Indica Group] gi|42795550|gb|AAS46116.1| ATP synthase CF0 C chain [Oryza sativa Japonica Group] gi|42795614|gb|AAS46179.1| ATP synthase CF0 C chain [Oryza sativa Japonica Group] gi|48478670|gb|AAT44690.1| ATP synthase CF0 C chain [Saccharum hybrid cultivar SP80-3280] gi|49614990|dbj|BAD26773.1| ATPase III subunit [Oryza nivara] gi|49659507|dbj|BAD27288.1| ATP synthase III subunit [Saccharum hybrid cultivar NCo 310] gi|58613935|gb|AAW79569.1| ATP synthase CF0 subunit III [Lophopyrum elongatum] gi|84371882|gb|ABC56200.1| ATP synthase CF0 subunit III [Solanum bulbocastanum] gi|118201037|gb|ABK79408.1| ATP synthase CF0 subunit III [Hordeum vulgare subsp. vulgare] gi|118201121|gb|ABK79491.1| ATP synthase CF0 subunit III [Sorghum bicolor] gi|118201206|gb|ABK79575.1| ATP synthase CF0 subunit III [Agrostis stolonifera] gi|158934393|emb|CAO85971.1| ATP synthase CF0 III [Lolium perenne] gi|193075552|gb|ACF08635.1| ATPase III subunit [Brachypodium distachyon] gi|195609660|gb|ACG26660.1| ATP synthase C chain [Zea mays] gi|209361353|gb|ACI43268.1| ATP synthase CF0 subunit III [Coix lacryma-jobi] gi|215882324|gb|ACJ70754.1| ATP synthase CF0 subunit III [Festuca arundinacea] gi|251765247|gb|ACT15401.1| ATP synthase CF0 C subunit [Anomochloa marantoidea] gi|254553619|gb|ACT67268.1| ATP synthase CF0 subunit III [Joinvillea plicata] gi|255040255|gb|ACT99915.1| ATP synthase CF0 subunit III [Dendrocalamus latiflorus] gi|290490340|gb|ADD31577.1| ATP synthase CF0 subunit III protein [Berberidopsis corallina] gi|290790569|gb|ADD62829.1| ATP synthase CF0 subunit III [Oryza sativa Japonica Group] gi|290790638|gb|ADD62897.1| ATP synthase CF0 subunit III [Oryza meridionalis] gi|290790707|gb|ADD62965.1| ATP synthase CF0 subunit III [Oryza australiensis] gi|290790776|gb|ADD63033.1| ATP synthase CF0 subunit III [Potamophila parviflora] gi|290790844|gb|ADD63100.1| ATP synthase CF0 subunit III [Microlaena stipoides] gi|308196283|gb|ADO17490.1| ATP synthase CF0 C subunit [Arundinaria gigantea] gi|223270|prf||0702201A synthase proteolipid subunit,ATP gi|226694|prf||1603356V ATPase III Length = 81 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|23336543|ref|ZP_00121755.1| COG0636: F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K [Bifidobacterium longum DJO10A] gi|23464961|ref|NP_695564.1| ATP synthase C chain [Bifidobacterium longum NCC2705] gi|189439991|ref|YP_001955072.1| F0F1-type ATP synthase subunit C [Bifidobacterium longum DJO10A] gi|227545743|ref|ZP_03975792.1| ATP synthase C subunit [Bifidobacterium longum subsp. infantis ATCC 55813] gi|239622554|ref|ZP_04665585.1| ATP synthase C subunit [Bifidobacterium longum subsp. infantis CCUG 52486] gi|296453444|ref|YP_003660587.1| ATP synthase F0 subunit C [Bifidobacterium longum subsp. longum JDM301] gi|312133386|ref|YP_004000725.1| atpe [Bifidobacterium longum subsp. longum BBMN68] gi|317481930|ref|ZP_07940955.1| ATP synthase F0 [Bifidobacterium sp. 12_1_47BFAA] gi|322688424|ref|YP_004208158.1| ATP synthase subunit C [Bifidobacterium longum subsp. infantis 157F] gi|322690443|ref|YP_004220013.1| ATP synthase subunit C [Bifidobacterium longum subsp. longum JCM 1217] gi|81754472|sp|Q8G7A8|ATPL_BIFLO RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254809770|sp|B3DTV5|ATPL_BIFLD RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|23325558|gb|AAN24200.1| ATP synthase C chain [Bifidobacterium longum NCC2705] gi|45593075|gb|AAS68120.1| ATP synthase C subunit [Bifidobacterium breve UCC2003] gi|189428426|gb|ACD98574.1| F0F1-type ATP synthase subunit c [Bifidobacterium longum DJO10A] gi|227213859|gb|EEI81698.1| ATP synthase C subunit [Bifidobacterium longum subsp. infantis ATCC 55813] gi|239514551|gb|EEQ54418.1| ATP synthase C subunit [Bifidobacterium longum subsp. infantis CCUG 52486] gi|291517463|emb|CBK71079.1| ATP synthase F0 subcomplex C subunit [Bifidobacterium longum subsp. longum F8] gi|296182875|gb|ADG99756.1| ATP synthase F0, C subunit [Bifidobacterium longum subsp. longum JDM301] gi|311772612|gb|ADQ02100.1| AtpE [Bifidobacterium longum subsp. longum BBMN68] gi|316916497|gb|EFV37894.1| ATP synthase F0 [Bifidobacterium sp. 12_1_47BFAA] gi|320455299|dbj|BAJ65921.1| ATP synthase subunit C [Bifidobacterium longum subsp. longum JCM 1217] gi|320459760|dbj|BAJ70380.1| ATP synthase subunit C [Bifidobacterium longum subsp. infantis 157F] Length = 75 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 9/56 (16%), Positives = 22/56 (39%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 +G + + +F + R P + +T + I + E L L + +++ Sbjct: 20 IGTLGPGIGLGILFGKAMESTARQPEMSGKIQTIMFIGLALVEVLALIGFVAALII 75 >gi|326332914|ref|ZP_08199171.1| ATP synthase C chain (Lipid-binding protein) [Nocardioidaceae bacterium Broad-1] gi|325949272|gb|EGD41355.1| ATP synthase C chain (Lipid-binding protein) [Nocardioidaceae bacterium Broad-1] Length = 67 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +A + +G++ +G + V IF Y++G R P A S + ++ + E + Sbjct: 4 SADMIGLGLSAIG---PGVGVGLIFAAYVAGVARQPEAQSRLQAIAILGFALCEQFFIIS 60 Query: 81 LLVVMLL 87 L + +L Sbjct: 61 LALAFVL 67 >gi|307822042|ref|ZP_07652274.1| H+transporting two-sector ATPase C subunit [Methylobacter tundripaludum SV96] gi|307736608|gb|EFO07453.1| H+transporting two-sector ATPase C subunit [Methylobacter tundripaludum SV96] Length = 88 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 LG+ L ALA+ + L R P + + + I + ESL ++ L++++++LF Sbjct: 20 ALGVMLPALAMGKAIGSALEALSRQPESEQSIMRTLFIGLAMIESLAIYCLVIILIVLF 78 >gi|296119527|ref|ZP_06838085.1| ATP synthase C chain [Corynebacterium ammoniagenes DSM 20306] gi|295967410|gb|EFG80677.1| ATP synthase C chain [Corynebacterium ammoniagenes DSM 20306] Length = 79 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G L + + + G R P A +T + + E+L L L+ Sbjct: 20 IGYGIATIG---PGLGIGILVGKTVEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAG 76 Query: 85 ML 86 L Sbjct: 77 FL 78 >gi|116749039|ref|YP_845726.1| ATP synthase F0 subunit C [Syntrophobacter fumaroxidans MPOB] gi|224487667|sp|A0LIN9|ATPL_SYNFM RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|116698103|gb|ABK17291.1| ATP synthase F0, C subunit [Syntrophobacter fumaroxidans MPOB] Length = 90 Score = 34.8 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G RNP A+ +LI + ESL ++ L+V ++L++ Sbjct: 23 GIGQGMAVRGAVEGIARNPEASGKVTVTMLIGLAMIESLSIYALVVSLILIYA 75 >gi|294501865|ref|YP_003565565.1| ATP synthase F0 subunit C [Bacillus megaterium QM B1551] gi|295707213|ref|YP_003600288.1| ATP synthase F0 subunit C [Bacillus megaterium DSM 319] gi|114666|sp|P20603|ATPL_BACMQ RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|142556|gb|AAA82521.1| ATP synthase c subunit [Bacillus megaterium] gi|294351802|gb|ADE72131.1| ATP synthase F0, C subunit [Bacillus megaterium QM B1551] gi|294804872|gb|ADF41938.1| ATP synthase F0, C subunit [Bacillus megaterium DSM 319] Length = 70 Score = 34.8 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A +A+G+A LG + I + + G R P A + + + + E+L + Sbjct: 3 LIASAIAIGLAALG---AGIGNGLIVSKTIEGTARQPEARGTLTSMMFVGVALVEALPII 59 Query: 80 LLLVVMLL 87 +++ ++ Sbjct: 60 AVVIAFMV 67 >gi|54023027|ref|YP_117269.1| F0F1 ATP synthase subunit C [Nocardia farcinica IFM 10152] gi|54014535|dbj|BAD55905.1| putative ATP synthase C subunit [Nocardia farcinica IFM 10152] Length = 81 Score = 34.8 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 12/77 (15%), Positives = 24/77 (31%) Query: 10 TFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIF 69 ++ A K + L + V + + G R P +T + + Sbjct: 4 SYLAQEAANESTLKGLGAVGYGLAAIGPGIGVGIVVGKAIEGIARQPELQGTIRTNMFLG 63 Query: 70 AVIAESLGLFLLLVVML 86 E+L L L+ + Sbjct: 64 IAFTEALALIGLVAGFI 80 >gi|323339967|ref|ZP_08080234.1| ATP synthase F0 sector subunit C [Lactobacillus ruminis ATCC 25644] gi|323092609|gb|EFZ35214.1| ATP synthase F0 sector subunit C [Lactobacillus ruminis ATCC 25644] Length = 74 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 22/54 (40%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + + + L R P + +T + I + E++ + +++ +LL Sbjct: 19 IGTGIGNGLVISKTLESMARQPELSGQLRTTMFIGVGLIEAVPIIAVVISFMLL 72 >gi|313183944|ref|YP_004021798.1| ATP synthase CF0 subunit III [Equisetum arvense] gi|281371664|gb|ADA63597.1| ATP synthase CF0 subunit III [Equisetum arvense] Length = 81 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVLAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|306485992|gb|ADM92644.1| AtpH [Davidia involucrata] Length = 80 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 30/70 (42%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AA +A G+A + + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYG 66 Query: 81 LLVVMLLLFV 90 L+V + LLF Sbjct: 67 LVVALALLFA 76 >gi|118110602|ref|XP_426577.2| PREDICTED: similar to ATP synthase lipid-binding protein, mitochondrial precursor (ATP synthase proteolipid P3) (ATPase protein 9) (ATPase subunit C), partial [Gallus gallus] Length = 91 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 9/34 (26%), Positives = 17/34 (50%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFR 54 AAK++ G A +G+ + +F + + G R Sbjct: 58 AAKFIGAGAATVGVAGYGAGIGTLFGSLIIGYAR 91 >gi|296446123|ref|ZP_06888071.1| ATP synthase F0, C subunit [Methylosinus trichosporium OB3b] gi|296256317|gb|EFH03396.1| ATP synthase F0, C subunit [Methylosinus trichosporium OB3b] Length = 81 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G ALA + R P AA + + + E++ ++ L++ +LLLF Sbjct: 18 FGAIGPALAEGKAVAAAMEAIARQPEAAGVLSRTLFVGLAMIETMAIYCLVIALLLLFA 76 >gi|311898384|dbj|BAJ30792.1| putative ATP synthase subunit C [Kitasatospora setae KM-6054] Length = 75 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V IF + R P AA ++ + I + E+L L +++ Sbjct: 14 IGYGLAAIG---PGIGVGLIFGNGVQAMARQPEAAGLIRSNMFIGFALTEALALIGIVMP 70 Query: 85 ML 86 + Sbjct: 71 FV 72 >gi|227552050|ref|ZP_03982099.1| H(+)-transporting two-sector ATPase [Enterococcus faecium TX1330] gi|257882702|ref|ZP_05662355.1| predicted protein [Enterococcus faecium 1,231,502] gi|257886788|ref|ZP_05666441.1| predicted protein [Enterococcus faecium 1,141,733] gi|257895356|ref|ZP_05675009.1| predicted protein [Enterococcus faecium Com12] gi|257897968|ref|ZP_05677621.1| predicted protein [Enterococcus faecium Com15] gi|261208697|ref|ZP_05923134.1| predicted protein [Enterococcus faecium TC 6] gi|289566046|ref|ZP_06446483.1| ATP synthase F0, C subunit [Enterococcus faecium D344SRF] gi|293378227|ref|ZP_06624396.1| ATP synthase F0, C subunit [Enterococcus faecium PC4.1] gi|293556421|ref|ZP_06675002.1| ATP synthase F0, C subunit [Enterococcus faecium E1039] gi|293572430|ref|ZP_06683410.1| ATP synthase F0, C subunit [Enterococcus faecium E980] gi|294617576|ref|ZP_06697206.1| ATP synthase F0, C subunit [Enterococcus faecium E1679] gi|294623199|ref|ZP_06702077.1| ATP synthase F0, C subunit [Enterococcus faecium U0317] gi|227178803|gb|EEI59775.1| H(+)-transporting two-sector ATPase [Enterococcus faecium TX1330] gi|257818360|gb|EEV45688.1| predicted protein [Enterococcus faecium 1,231,502] gi|257822842|gb|EEV49774.1| predicted protein [Enterococcus faecium 1,141,733] gi|257831921|gb|EEV58342.1| predicted protein [Enterococcus faecium Com12] gi|257835880|gb|EEV60954.1| predicted protein [Enterococcus faecium Com15] gi|260077199|gb|EEW64919.1| predicted protein [Enterococcus faecium TC 6] gi|289162153|gb|EFD10016.1| ATP synthase F0, C subunit [Enterococcus faecium D344SRF] gi|291596182|gb|EFF27445.1| ATP synthase F0, C subunit [Enterococcus faecium E1679] gi|291597394|gb|EFF28567.1| ATP synthase F0, C subunit [Enterococcus faecium U0317] gi|291601488|gb|EFF31759.1| ATP synthase F0, C subunit [Enterococcus faecium E1039] gi|291607492|gb|EFF36834.1| ATP synthase F0, C subunit [Enterococcus faecium E980] gi|292643091|gb|EFF61232.1| ATP synthase F0, C subunit [Enterococcus faecium PC4.1] Length = 71 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 7/52 (13%), Positives = 24/52 (46%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + + R P + +T + I + E++ + +++ ++L+F + Sbjct: 20 GNGQVISKTIESMARQPEMSGQFRTTMFIGVALVEAVPILGVVIALILVFAV 71 >gi|124112041|ref|YP_001019099.1| CF0 subunit III of ATP synthase [Chlorokybus atmophyticus] gi|223635054|sp|Q19VA3|ATPH_CHLAT RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|124012157|gb|ABD62173.2| CF0 subunit III of ATP synthase [Chlorokybus atmophyticus] Length = 82 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVLAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|110802254|ref|YP_699467.1| F0F1 ATP synthase subunit C [Clostridium perfringens SM101] gi|122956533|sp|Q0SQZ0|ATPL_CLOPS RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|110682755|gb|ABG86125.1| ATP synthase F0, C subunit [Clostridium perfringens SM101] Length = 72 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 15/69 (21%), Positives = 35/69 (50%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K +A G+A L + + + R P A+ ++ ++ A ++E+ ++ L+ Sbjct: 4 KLLAAGIAVLAGIGAGIGIGIATAGAIEATARQPEASDKIQSLFIMGAGLSEATAIYGLV 63 Query: 83 VVMLLLFVI 91 + ++LLFV+ Sbjct: 64 ISIILLFVV 72 >gi|319893059|ref|YP_004149934.1| ATP synthase C chain [Staphylococcus pseudintermedius HKU10-03] gi|317162755|gb|ADV06298.1| ATP synthase C chain [Staphylococcus pseudintermedius HKU10-03] gi|323463886|gb|ADX76039.1| ATP synthase F0, C subunit [Staphylococcus pseudintermedius ED99] Length = 70 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A +A+G++ LG + I + + G R P A + + + I + E+L + Sbjct: 3 LIAAAIAIGLSALG---AGIGNGLIVSRTVEGVARQPEARTQLMSIMFIGIGLVEALPII 59 Query: 80 LLLVVMLLLFV 90 +++ ++LF+ Sbjct: 60 GVVITFIVLFI 70 >gi|282861125|ref|ZP_06270190.1| ATP synthase F0, C subunit [Streptomyces sp. ACTE] gi|282563783|gb|EFB69320.1| ATP synthase F0, C subunit [Streptomyces sp. ACTE] gi|320008541|gb|ADW03391.1| ATP synthase F0, C subunit [Streptomyces flavogriseus ATCC 33331] Length = 81 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V IF R P AA ++ ++ V+ E+L L L++ Sbjct: 19 IGYGLAAIG---PGVGVGIIFGNGTQALARQPEAAGLIRSNQILGFVLCEALALIGLVMP 75 Query: 85 ML 86 + Sbjct: 76 FV 77 >gi|8928610|ref|NP_059415.1| ATP synthase F0 subunit 9 [Paramecium aurelia] gi|299830282|ref|YP_003734446.1| ATP synthase F0 subunit 9 [Paramecium caudatum] gi|114502|sp|P16001|ATP9_PARTE RecName: Full=ATP synthase subunit 9, mitochondrial; AltName: Full=Lipid-binding protein gi|13262|emb|CAA34039.1| unnamed protein product [Paramecium aurelia] gi|299507841|emb|CAZ66825.1| ATP synthase F0 subunit 9 [Paramecium caudatum] Length = 75 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 29/71 (40%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 LA K + +G+ L + AL V +F Y RNP A L+ + E+ Sbjct: 5 LAIKTLVLGLCMLPISAAALGVGILFAGYNIAVSRNPDEAETIFNGTLMGFALVETFVFM 64 Query: 80 LLLVVMLLLFV 90 +++ F+ Sbjct: 65 SFFFGVIVYFI 75 >gi|11465571|ref|NP_045037.1| ATP synthase CF0 C subunit [Cyanidium caldarium] gi|14547922|sp|Q9TM30|ATPH_CYACA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|6466427|gb|AAF13009.1|AF022186_181 unknown [Cyanidium caldarium] Length = 82 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P A + +L+ ESL ++ L+V + LLF Sbjct: 22 IGPGIGQGSAAANAVEGLARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALSLLFA 77 >gi|237688514|ref|YP_002905132.1| ATP synthase CF0 C subunit [Pinus contorta] gi|226875343|gb|ACO89081.1| ATP synthase CF0 C subunit [Pinus contorta] Length = 81 Score = 34.8 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G++ L + + G R P A + +L+ E+L + Sbjct: 7 AASVIAAGLSVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTXY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|91201493|emb|CAJ74553.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] Length = 108 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 30/64 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + + + ALA + + ++ + R P A+ + ++I ESL ++ L++ Sbjct: 9 IGIPVVAVAAFGCALAQAKVVSSAVESMARQPSVAAKVQLAMIIGIAFIESLAIYSLMIS 68 Query: 85 MLLL 88 +L Sbjct: 69 FMLF 72 >gi|283794877|ref|YP_003359230.1| ATP synthase CF0 C subunit [Cryptomonas paramecium] gi|253981849|gb|ACT46766.1| ATP synthase CF0 C subunit [Cryptomonas paramecium] Length = 82 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + L R P A + +L+ ESL ++ Sbjct: 7 AASVIASGLAIGLAAIGPGIGQGSASAQALESIARQPEAEGKIRGTLLLSLAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L++ + LLF Sbjct: 67 GLVIALSLLFA 77 >gi|242624344|ref|YP_003002262.1| ATP synthase CF0 C chain subunit III [Aureoumbra lagunensis] gi|239997452|gb|ACS36974.1| ATP synthase CF0 C chain subunit III [Aureoumbra lagunensis] Length = 82 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G++ L + + G R P + + +L+ E+L ++ Sbjct: 7 AASVIGAGLSVGLAAIGPGIGQGTAAGQAVEGIARQPEVENKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|56791403|gb|AAW30241.1| ATP synthase F0 subunit 9 [Amborella trichopoda] gi|56791407|gb|AAW30243.1| ATP synthase F0 subunit 9 [Laurus nobilis] gi|56791409|gb|AAW30244.1| ATP synthase F0 subunit 9 [Platanus occidentalis] gi|56791422|gb|AAW30250.1| ATP synthase F0 subunit 9 [Liriodendron tulipifera] Length = 60 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 7/46 (15%), Positives = 20/46 (43%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+ ++ + RNP A ++ + E++ F ++ Sbjct: 14 VGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMA 59 >gi|257461433|ref|ZP_05626529.1| ATP synthase C chain [Campylobacter gracilis RM3268] gi|257441156|gb|EEV16303.1| ATP synthase C chain [Campylobacter gracilis RM3268] Length = 112 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + L+G RNP AS T + I + E+ ++ L++ +LLF Sbjct: 50 MGNAASATLNGIARNPSVASKLSTTMYISLAMIEAQVIYALVIAFILLFA 99 >gi|115443538|ref|YP_778557.1| ATP synthase CF0 C chain [Bigelowiella natans] gi|122233798|sp|Q06J70|ATPH_BIGNA RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|110810183|gb|ABG91389.1| ATP synthase CF0 C chain [Bigelowiella natans] Length = 81 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ ESL ++ L+V ++LLF Sbjct: 25 GIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALVLLFA 77 >gi|317050941|ref|YP_004112057.1| ATP synthase F0 subunit C [Desulfurispirillum indicum S5] gi|316946025|gb|ADU65501.1| ATP synthase F0, C subunit [Desulfurispirillum indicum S5] Length = 112 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 L A + G+ LG + + N G RNP A+ T ++I + ESL + Sbjct: 32 LTAIMIGAGIGMGLGALGTGIGMGNAIQGATEGIARNPNASGKIMTAMIIGLAMIESLAI 91 Query: 79 FLLLVVMLLLFV 90 + L++ ++LLF Sbjct: 92 YTLVIALILLFA 103 >gi|261838536|gb|ACX98302.1| ATP synthase F0 C chain [Helicobacter pylori 51] Length = 105 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 14/72 (19%), Positives = 34/72 (47%), Gaps = 3/72 (4%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 YS+ + +G+A G A+ + N+ ++G RNP T + + + E+ Sbjct: 31 YSILGAMIGLGIAAFG---GAIGMGNVAAATITGTARNPGVGGKLLTTMFVAMAMIEAQV 87 Query: 78 LFLLLVVMLLLF 89 ++ L+ ++ ++ Sbjct: 88 IYTLVFAIIAIY 99 >gi|116494657|ref|YP_806391.1| F0F1-type ATP synthase, subunit c [Lactobacillus casei ATCC 334] gi|191638156|ref|YP_001987322.1| ATP synthase C chain [Lactobacillus casei BL23] gi|227535359|ref|ZP_03965408.1| H(+)-transporting two-sector ATPase [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|239631742|ref|ZP_04674773.1| F0F1-type ATP synthase [Lactobacillus paracasei subsp. paracasei 8700:2] gi|301066216|ref|YP_003788239.1| F0F1-type ATP synthase subunit c [Lactobacillus casei str. Zhang] gi|122263922|sp|Q03A23|ATPL_LACC3 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|254810003|sp|B3WDL3|ATPL_LACCB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|116104807|gb|ABJ69949.1| ATP synthase F0 subcomplex C subunit [Lactobacillus casei ATCC 334] gi|190712458|emb|CAQ66464.1| ATP synthase C chain [Lactobacillus casei BL23] gi|227186955|gb|EEI67022.1| H(+)-transporting two-sector ATPase [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|239526207|gb|EEQ65208.1| F0F1-type ATP synthase [Lactobacillus paracasei subsp. paracasei 8700:2] gi|300438623|gb|ADK18389.1| F0F1-type ATP synthase, subunit c [Lactobacillus casei str. Zhang] gi|327382187|gb|AEA53663.1| ATP synthase subunit c [Lactobacillus casei LC2W] gi|327385384|gb|AEA56858.1| ATP synthase subunit c [Lactobacillus casei BD-II] Length = 70 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 23/51 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 ++ + + L G R P A + + I + E++ + ++V +L+ Sbjct: 18 SIGNGMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPILSVVVAFMLM 68 >gi|11467512|ref|NP_043658.1| ATP synthase CF0 C subunit [Odontella sinensis] gi|231612|sp|Q00824|ATPH_ODOSI RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|11947|emb|CAA43153.1| adenosinetriphosphatase [Odontella sinensis] gi|1185207|emb|CAA91690.1| ATP synthase CFO subunit III [Odontella sinensis] Length = 82 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 23/53 (43%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + N + G R P + + +L+ E+L ++ L+V + LLF Sbjct: 25 GIGQGNAAGQAVEGIARQPEGENKIRGTLLLSLAFMEALTIYGLVVALALLFA 77 >gi|297157191|gb|ADI06903.1| F-type proton-transporting ATPase c chain [Streptomyces bingchenggensis BCW-1] Length = 82 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V IF R P AA + ++ V+ E+L L L++ Sbjct: 20 IGYGLAAIG---PGVGVGIIFGNGTQALARQPEAAGLIRANQILGFVLCEALALIGLVMP 76 Query: 85 ML 86 + Sbjct: 77 FV 78 >gi|295425481|ref|ZP_06818174.1| ATP synthase F0 sector subunit C [Lactobacillus amylolyticus DSM 11664] gi|295064820|gb|EFG55735.1| ATP synthase F0 sector subunit C [Lactobacillus amylolyticus DSM 11664] Length = 74 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 23/51 (45%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + R P +A + + I + E++ + ++V L+LF+ Sbjct: 24 GNGKVISKTIECMARQPESADNLRATMFIGVGLIEAVPIIAIVVAFLILFL 74 >gi|461583|sp|P35013|ATPH_GALSU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|629433|pir||S39516 H+-transporting two-sector ATPase (EC 3.6.3.14) lipid-binding protein - red alga (Cyanidium caldarium) chloroplast gi|429174|emb|CAA48021.1| H(+)-transporting ATP synthase [Galdieria sulphuraria] Length = 83 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 22/56 (39%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ E+L ++ L+V + LLF Sbjct: 22 IGPGIGQGTASAQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALSLLFA 77 >gi|323138834|ref|ZP_08073897.1| ATP synthase F0, C subunit [Methylocystis sp. ATCC 49242] gi|322395876|gb|EFX98414.1| ATP synthase F0, C subunit [Methylocystis sp. ATCC 49242] Length = 80 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 26/59 (44%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G ALA + R P AA + + + E++ ++ L++ +LLLF Sbjct: 17 MGAVGPALAEGRAVAAAMEAIARQPEAAGVISRTLFVGLAMIETMAIYCLVIALLLLFA 75 >gi|124302892|ref|YP_001023687.1| ATP synthase CF0 C subunit [Angiopteris evecta] gi|223635046|sp|A2T319|ATPH_ANGEV RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|110628290|gb|ABG79586.1| ATP synthase CF0 subunit III [Angiopteris evecta] Length = 81 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + L F Sbjct: 67 GLVVALALSFA 77 >gi|284032935|ref|YP_003382866.1| ATP synthase F0 subunit C [Kribbella flavida DSM 17836] gi|283812228|gb|ADB34067.1| ATP synthase F0, C subunit [Kribbella flavida DSM 17836] Length = 75 Score = 34.4 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 22/55 (40%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 L + V IF ++G R P A S ++ I + E L + + + + Sbjct: 17 LAAIGPGVGVGLIFAAVINGTARQPEAQSRLQSIAWIGFGVTEVLAIIGIALAFV 71 >gi|78184061|ref|YP_376496.1| F0F1 ATP synthase subunit C [Synechococcus sp. CC9902] gi|116071308|ref|ZP_01468577.1| ATP synthase subunit C [Synechococcus sp. BL107] gi|123757127|sp|Q3AZM5|ATPL_SYNS9 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|78168355|gb|ABB25452.1| ATP synthase F0, C subunit [Synechococcus sp. CC9902] gi|116066713|gb|EAU72470.1| ATP synthase subunit C [Synechococcus sp. BL107] Length = 81 Score = 34.4 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ ESL ++ L+V ++LLF Sbjct: 22 IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLFA 77 >gi|170076619|ref|YP_001733258.1| ATP synthase c subunit [Synechococcus sp. PCC 7002] gi|169887481|gb|ACB01189.1| ATP synthase c subunit [Synechococcus sp. PCC 7002] Length = 91 Score = 34.4 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL L + P A+ + + + ES ++ L+V M+LLFV Sbjct: 20 AIGSIGPALGEGMAVARALGAIAQQPDKANMITRTLFVGLAMVESTAIYCLVVSMILLFV 79 >gi|114672|sp|P21905|ATPL_PROMO RecName: Full=ATP synthase subunit c, sodium ion specific; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|45602|emb|CAA46895.1| ATPase c subunit [Propionigenium modestum] gi|45612|emb|CAA37840.1| ATPase subunit c [Propionigenium modestum] gi|45645|emb|CAA37912.1| unnamed protein product [Propionigenium modestum] gi|45650|emb|CAA41369.1| F0 subunit [Propionigenium modestum] gi|249183|gb|AAB22156.1| sodium dependent ATPase F1 subunit c [Propionigenium modestum, Peptide, 89 aa] Length = 89 Score = 34.4 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + R P A + +++ IAES G++ L++ ++LL+ Sbjct: 26 IGPGVGQGYAAGKAVESVARQPEAKGDIISTMVLGQAIAESTGIYSLVIALILLYA 81 >gi|283954495|ref|ZP_06372015.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. jejuni 414] gi|283794112|gb|EFC32861.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. jejuni 414] Length = 112 Score = 34.4 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 18/85 (21%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 +E +S+ A + +G+A LG A+ + N ++G RNP T Sbjct: 24 VEQEAINVWIKAFSVLAAGLGLGVAALG---GAIGMGNTAAATIAGTARNPGLGPKLMTT 80 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFV 90 + I + E+ ++ L++ ++ L+ Sbjct: 81 MFIALAMIEAQVIYALVIALIALYA 105 >gi|226307397|ref|YP_002767357.1| ATP synthase subunit c [Rhodococcus erythropolis PR4] gi|229489983|ref|ZP_04383836.1| F0F1 ATP synthase subunit C [Rhodococcus erythropolis SK121] gi|226186514|dbj|BAH34618.1| ATP synthase subunit c [Rhodococcus erythropolis PR4] gi|229323084|gb|EEN88852.1| F0F1 ATP synthase subunit C [Rhodococcus erythropolis SK121] Length = 80 Score = 34.4 bits (78), Expect = 4.7, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A +G + V + + G R P A +T + + E+L L L+ Sbjct: 21 IGYGLAAIG---PGIGVGIVVGKAIEGMVRQPEMAGQVRTTMFLGIAFTEALALIGLVAG 77 Query: 85 ML 86 + Sbjct: 78 FI 79 >gi|325105223|ref|YP_004274877.1| ATP synthase F0 subcomplex C subunit [Pedobacter saltans DSM 12145] gi|324974071|gb|ADY53055.1| ATP synthase F0 subcomplex C subunit [Pedobacter saltans DSM 12145] Length = 71 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 33/62 (53%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 +A A L + + + N+ + + G R P AAS +T ++I A + E + LF ++V Sbjct: 5 IAAIGAGLAVIGAGIGIGNVGSKAMEGIARQPEAASKIQTAMIIAAALIEGVALFGVVVA 64 Query: 85 ML 86 +L Sbjct: 65 LL 66 >gi|91780115|ref|YP_555322.1| F0F1 ATP synthase subunit C [Burkholderia xenovorans LB400] gi|91692775|gb|ABE35972.1| ATP synthase F0 subcomplex C subunit [Burkholderia xenovorans LB400] Length = 82 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 24/59 (40%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G AL + R P +A + + + E++ ++ L++ +L+LF Sbjct: 19 FGAIGPALGEGRAVAAAMDALARQPESAGTISRTLFVGLAMIETMAIYCLVIALLVLFA 77 >gi|306485994|gb|ADM92645.1| AtpH [Franklinia alatamaha] Length = 76 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 2/72 (2%) Query: 21 AAKYVAVGMACLGMG--LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 AA +A G+A G+ + + G R P A + +L+ E+L + Sbjct: 1 AASVIAAGLAVGGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTI 60 Query: 79 FLLLVVMLLLFV 90 + L+V + LLF Sbjct: 61 YGLVVALALLFA 72 >gi|296268880|ref|YP_003651512.1| H+transporting two-sector ATPase C subunit [Thermobispora bispora DSM 43833] gi|296091667|gb|ADG87619.1| H+transporting two-sector ATPase C subunit [Thermobispora bispora DSM 43833] Length = 74 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 24/63 (38%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++ L + V IF + R P A + +L+ V+ E+L L L+ Sbjct: 10 HIGAIGYGLATLGPGIGVGLIFGQGVQAIARQPEAYGLIRQNMLLGFVLTEALALIGLVA 69 Query: 84 VML 86 + Sbjct: 70 PFI 72 >gi|269794326|ref|YP_003313781.1| ATP synthase F0 subcomplex subunit C [Sanguibacter keddieii DSM 10542] gi|269096511|gb|ACZ20947.1| ATP synthase F0 subcomplex C subunit [Sanguibacter keddieii DSM 10542] Length = 78 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 20/55 (36%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVML 86 LG + + + + G R P A +T + I E L L ++ L Sbjct: 21 LGTLGPGIGLGILIGKTVEGMARQPEVAGQLRTTMFIGVAFVELLALLGIVAGFL 75 >gi|242620030|ref|YP_003002034.1| ATP synthase CF0 C chain subunit III [Aureococcus anophagefferens] gi|239997275|gb|ACS36798.1| ATP synthase CF0 C chain subunit III [Aureococcus anophagefferens] Length = 82 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA + G++ L + + G R P + + +L+ E+L ++ Sbjct: 7 AASVIGAGLSVGLAAIGPGIGQGTAAGQAVEGIARQPEVENQIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|153951147|ref|YP_001397995.1| F0F1 ATP synthase subunit C [Campylobacter jejuni subsp. doylei 269.97] gi|224487634|sp|A7H3B5|ATPL_CAMJD RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|152938593|gb|ABS43334.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. doylei 269.97] Length = 112 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 18/85 (21%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 +E +S+ A + +G+A LG A+ + N ++G RNP T Sbjct: 24 VEQEAINVWIKAFSVLAAGLGLGVAALG---GAIGMGNTAAATIAGTARNPGLGPKLMTT 80 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFV 90 + I + E+ ++ L++ ++ L+ Sbjct: 81 MFIALAMIEAQVIYALVIALIALYA 105 >gi|86150852|ref|ZP_01069068.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. jejuni 260.94] gi|86152877|ref|ZP_01071082.1| ATP synthase C chain [Campylobacter jejuni subsp. jejuni HB93-13] gi|121613349|ref|YP_001000610.1| F0F1 ATP synthase subunit C [Campylobacter jejuni subsp. jejuni 81-176] gi|157415193|ref|YP_001482449.1| F0F1 ATP synthase subunit C [Campylobacter jejuni subsp. jejuni 81116] gi|167005541|ref|ZP_02271299.1| F0F1 ATP synthase subunit C [Campylobacter jejuni subsp. jejuni 81-176] gi|315124429|ref|YP_004066433.1| hypothetical protein ICDCCJ07001_888 [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|122953392|sp|Q0Q7H1|ATPL_CAMJJ RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487633|sp|A8FLY5|ATPL_CAMJ8 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|85842022|gb|EAQ59268.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. jejuni 260.94] gi|85843762|gb|EAQ60972.1| ATP synthase C chain [Campylobacter jejuni subsp. jejuni HB93-13] gi|87248921|gb|EAQ71884.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. jejuni 81-176] gi|107770415|gb|ABF83745.1| ATP synthase F0 C subunit [Campylobacter jejuni subsp. jejuni 81-176] gi|157386157|gb|ABV52472.1| ATP synthase F0 sector C subunit [Campylobacter jejuni subsp. jejuni 81116] gi|307747834|gb|ADN91104.1| ATP synthase subunit c [Campylobacter jejuni subsp. jejuni M1] gi|315018151|gb|ADT66244.1| hypothetical protein ICDCCJ07001_888 [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|315932491|gb|EFV11430.1| ATP synthase F0, C subunit [Campylobacter jejuni subsp. jejuni 327] Length = 112 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 18/85 (21%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 +E +S+ A + +G+A LG A+ + N ++G RNP T Sbjct: 24 VEQEAINVWIKAFSVLAAGLGLGVAALG---GAIGMGNTAAATIAGTARNPGLGPKLMTT 80 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFV 90 + I + E+ ++ L++ ++ L+ Sbjct: 81 MFIALAMIEAQVIYALVIALIALYA 105 >gi|221633216|ref|YP_002522441.1| ATP synthase F0 subunit C [Thermomicrobium roseum DSM 5159] gi|221155864|gb|ACM04991.1| ATP synthase F0, C subunit [Thermomicrobium roseum DSM 5159] Length = 81 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 28/54 (51%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + + RNP A A + ++I A +AE++ ++ +V +++ FV+ Sbjct: 28 GIGIGLAVKGAMEAIGRNPEAEGAVRLTMIIGAALAEAVAIYAFVVAVIIAFVL 81 >gi|114765107|ref|ZP_01444252.1| ATP synthase F0, C subunit [Pelagibaca bermudensis HTCC2601] gi|114542511|gb|EAU45537.1| ATP synthase F0, C subunit [Roseovarius sp. HTCC2601] Length = 82 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 24/59 (40%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G AL + R P AA + + + E++ ++ L++ +L+LF Sbjct: 20 FGAIGPALGEGRAVAAAMDAIARQPEAAGTLSRTLFVGLAMIETMAIYTLVIALLVLFA 78 >gi|205375340|ref|ZP_03228130.1| ATP synthase F0, C subunit [Bacillus coahuilensis m4-4] Length = 71 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 24/51 (47%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 ++ I + + G R P A +T + I + E+L + +++ L++ Sbjct: 18 SIGNGMIVSKTVEGMARQPEARGILQTTMFIGVALVEALPIIAIVIAFLVM 68 >gi|56791395|gb|AAW30237.1| ATP synthase F0 subunit 9 [Eichhornia crassipes] gi|56791412|gb|AAW30245.1| ATP synthase F0 subunit 9 [Asarum sp. Qiu 96018] gi|56791420|gb|AAW30249.1| ATP synthase F0 subunit 9 [Eschscholzia californica] Length = 59 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 7/46 (15%), Positives = 20/46 (43%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+ ++ + RNP A ++ + E++ F ++ Sbjct: 14 VGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMA 59 >gi|56791397|gb|AAW30238.1| ATP synthase F0 subunit 9 [Philodendron hederaceum var. oxycardium] Length = 59 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 7/46 (15%), Positives = 20/46 (43%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + N+ ++ + RNP A ++ + E++ F ++ Sbjct: 14 VGIGNVLSSSIHSVARNPSLAKQSFGYAILGFALTEAIASFAPMMA 59 >gi|58618222|gb|AAW80676.1| chloroplast ATPH isoform 6 [Heterocapsa triquetra] Length = 52 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 22/45 (48%) Query: 46 TTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + G R P A + +L+ ESL ++ L++ ++LLF Sbjct: 3 GRCIDGISRQPEVADDLRGVLLLSLAFMESLTIYGLVIALVLLFA 47 >gi|15896124|ref|NP_349473.1| F0F1 ATP synthase subunit C [Clostridium acetobutylicum ATCC 824] gi|5915735|sp|O08310|ATPL_CLOAB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|15025916|gb|AAK80813.1|AE007784_10 FoF1-type ATP synthase C subunit [Clostridium acetobutylicum ATCC 824] gi|1905950|gb|AAB50192.1| F-type ATP synthase subunit c [Clostridium acetobutylicum ATCC 824] gi|4323563|gb|AAD16421.1| ATP synthase subunit c [Clostridium acetobutylicum ATCC 824] gi|325510278|gb|ADZ21914.1| FoF1-type ATP synthase C subunit [Clostridium acetobutylicum EA 2018] Length = 81 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 18/73 (24%), Positives = 34/73 (46%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 + L +Y+ G+A +G + + + + R P +AS +++ AE Sbjct: 8 FLLGMQYLGAGLAAIGCIGGGVGIGTVTGKAVEAIGRQPESASKVMPTMIMGLAFAEVTS 67 Query: 78 LFLLLVVMLLLFV 90 L+ L V ++LLFV Sbjct: 68 LYALFVAIMLLFV 80 >gi|270284704|ref|ZP_05966525.2| ATP synthase C chain [Bifidobacterium gallicum DSM 20093] gi|270276360|gb|EFA22214.1| ATP synthase C chain [Bifidobacterium gallicum DSM 20093] Length = 83 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G + + + + G R P +T + + E L L + Sbjct: 23 VGYGLAAIG---PGIGLGILIGKTIEGTARQPELGGRLQTLMFLGLAFVEVLALLGFVAA 79 Query: 85 ML 86 + Sbjct: 80 FI 81 >gi|224487718|sp|Q1MPG5|ATPL_LAWIP RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein Length = 84 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 25/61 (40%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 L + G RNP A+ + +++ ESL ++ L++ +++LF Sbjct: 20 MALAALGCGIGQGLGLKGACEGIARNPEASGKIQVALILGLAFIESLAIYALVINLIILF 79 Query: 90 V 90 Sbjct: 80 A 80 >gi|297585424|ref|YP_003701204.1| ATP synthase F0 subunit C [Bacillus selenitireducens MLS10] gi|297143881|gb|ADI00639.1| ATP synthase F0, C subunit [Bacillus selenitireducens MLS10] Length = 73 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 27/59 (45%) Query: 30 ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 A L A V+ + + L G R P +T + I + E+L +F +++ LLL Sbjct: 12 ASLAAIAGAFGVAIVVRSTLQGITRQPEIRGPLQTVMFIGVPLVEALPIFAIVIAFLLL 70 >gi|154503957|ref|ZP_02041017.1| hypothetical protein RUMGNA_01783 [Ruminococcus gnavus ATCC 29149] gi|153795384|gb|EDN77804.1| hypothetical protein RUMGNA_01783 [Ruminococcus gnavus ATCC 29149] Length = 74 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 28/65 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + + R P A S +++ +AE+ ++ ++ Sbjct: 7 IGAGIAVLTGIGAGVGIGIATGKAVDAIARQPEAESKISKNLILGCALAEATAIYGFIIG 66 Query: 85 MLLLF 89 +L++F Sbjct: 67 ILIVF 71 >gi|119715993|ref|YP_922958.1| H+-transporting two-sector ATPase, C subunit [Nocardioides sp. JS614] gi|254810018|sp|A1SHI6|ATPL_NOCSJ RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|119536654|gb|ABL81271.1| ATP synthase F0 subcomplex C subunit [Nocardioides sp. JS614] Length = 69 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 +A + G+A +G + + IF Y+SG R P A S + ++ +AE+L + Sbjct: 6 SANMIGYGLAAIG---PGVGIGLIFAAYISGVARQPEAQSRLQAIAILGFALAEALAIIG 62 Query: 81 LLVVMLL 87 + + +L Sbjct: 63 IALAFVL 69 >gi|170694203|ref|ZP_02885358.1| ATP synthase F0, C subunit [Burkholderia graminis C4D1M] gi|170140943|gb|EDT09116.1| ATP synthase F0, C subunit [Burkholderia graminis C4D1M] Length = 82 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 25 VAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 VA +A G A+A + R P +A + + + E++ ++ L++ Sbjct: 11 VAAALAVSFGAIGPAIAEGRAVAAAMDAIARQPDSAGTVSRTLFVGLAMIETMAIYCLVI 70 Query: 84 VMLLLFV 90 +LLLF Sbjct: 71 ALLLLFA 77 >gi|119026450|ref|YP_910295.1| ATP synthase C chain [Bifidobacterium adolescentis ATCC 15703] gi|154488037|ref|ZP_02029154.1| hypothetical protein BIFADO_01606 [Bifidobacterium adolescentis L2-32] gi|171742078|ref|ZP_02917885.1| hypothetical protein BIFDEN_01183 [Bifidobacterium dentium ATCC 27678] gi|212715316|ref|ZP_03323444.1| hypothetical protein BIFCAT_00209 [Bifidobacterium catenulatum DSM 16992] gi|225352596|ref|ZP_03743619.1| hypothetical protein BIFPSEUDO_04221 [Bifidobacterium pseudocatenulatum DSM 20438] gi|283456796|ref|YP_003361360.1| ATP synthase subunit C [Bifidobacterium dentium Bd1] gi|306822061|ref|ZP_07455445.1| ATP synthase F0 sector subunit C [Bifidobacterium dentium ATCC 27679] gi|309802663|ref|ZP_07696767.1| ATP synthase F0, C subunit [Bifidobacterium dentium JCVIHMP022] gi|224487626|sp|A1A3D0|ATPL_BIFAA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|118766034|dbj|BAF40213.1| ATP synthase C chain [Bifidobacterium adolescentis ATCC 15703] gi|154083510|gb|EDN82555.1| hypothetical protein BIFADO_01606 [Bifidobacterium adolescentis L2-32] gi|171277692|gb|EDT45353.1| hypothetical protein BIFDEN_01183 [Bifidobacterium dentium ATCC 27678] gi|212661773|gb|EEB22348.1| hypothetical protein BIFCAT_00209 [Bifidobacterium catenulatum DSM 16992] gi|225156790|gb|EEG70184.1| hypothetical protein BIFPSEUDO_04221 [Bifidobacterium pseudocatenulatum DSM 20438] gi|283103430|gb|ADB10536.1| ATP synthase C chain [Bifidobacterium dentium Bd1] gi|304554661|gb|EFM42564.1| ATP synthase F0 sector subunit C [Bifidobacterium dentium ATCC 27679] gi|308220727|gb|EFO77035.1| ATP synthase F0, C subunit [Bifidobacterium dentium JCVIHMP022] Length = 75 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G + + + + G R P S +T + + E L L ++ Sbjct: 16 VGYGLAAIG---PGIGLGILIGKTIEGTARQPELGSRLQTLMFLGLAFVEVLALLGFVLA 72 Query: 85 ML 86 + Sbjct: 73 FI 74 >gi|269957237|ref|YP_003327026.1| ATP synthase F0 subunit C [Xylanimonas cellulosilytica DSM 15894] gi|269305918|gb|ACZ31468.1| ATP synthase F0, C subunit [Xylanimonas cellulosilytica DSM 15894] Length = 76 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A LG + + + + G R P A + + + E L L L+ Sbjct: 16 IGYGLATLG---PGIGLGILIGKTVEGMARQPEVAGQLRATMFLGLAFVEVLALLGLVAG 72 Query: 85 ML 86 L Sbjct: 73 FL 74 >gi|33865026|ref|NP_896585.1| F0F1 ATP synthase subunit C [Synechococcus sp. WH 8102] gi|78213707|ref|YP_382486.1| F0F1 ATP synthase subunit C [Synechococcus sp. CC9605] gi|148242981|ref|YP_001228138.1| F0F1 ATP synthase subunit C [Synechococcus sp. RCC307] gi|260436152|ref|ZP_05790122.1| ATP synthase C chain [Synechococcus sp. WH 8109] gi|81575118|sp|Q7U8W9|ATPL_SYNPX RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|123756852|sp|Q3AHK1|ATPL_SYNSC RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|224487669|sp|A5GV76|ATPL_SYNR3 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|33638710|emb|CAE07005.1| ATP synthase subunit c [Synechococcus sp. WH 8102] gi|78198166|gb|ABB35931.1| ATP synthase F0, C subunit [Synechococcus sp. CC9605] gi|147851291|emb|CAK28785.1| ATP synthase C chain [Synechococcus sp. RCC307] gi|260414026|gb|EEX07322.1| ATP synthase C chain [Synechococcus sp. WH 8109] Length = 82 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 23/56 (41%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ ESL ++ L+V ++LLF Sbjct: 22 IGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLFA 77 >gi|116490718|ref|YP_810262.1| F0F1-type ATP synthase, subunit c [Oenococcus oeni PSU-1] gi|118586241|ref|ZP_01543701.1| ATP synthase, c subunit [Oenococcus oeni ATCC BAA-1163] gi|290890137|ref|ZP_06553219.1| hypothetical protein AWRIB429_0609 [Oenococcus oeni AWRIB429] gi|122277098|sp|Q04G25|ATPL_OENOB RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|116091443|gb|ABJ56597.1| ATP synthase F0 subcomplex C subunit [Oenococcus oeni PSU-1] gi|118433325|gb|EAV40031.1| ATP synthase, c subunit [Oenococcus oeni ATCC BAA-1163] gi|290480181|gb|EFD88823.1| hypothetical protein AWRIB429_0609 [Oenococcus oeni AWRIB429] Length = 70 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Query: 24 YVAVGMACLGMG-LVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+A G+A G + + + R P +T + I + E++ + ++ Sbjct: 3 YIAAGIALCGSAIGAGIGNGMLMAKLIESIARQPELEGNLRTNMFISMALVEAMPIIVIA 62 Query: 83 VVMLLL 88 + +L+ Sbjct: 63 MSFVLI 68 >gi|116333893|ref|YP_795420.1| F0F1 ATP synthase subunit C [Lactobacillus brevis ATCC 367] gi|122269420|sp|Q03QY3|ATPL_LACBA RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|116099240|gb|ABJ64389.1| F0F1-type ATP synthase, subunit c [Lactobacillus brevis ATCC 367] Length = 70 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 21/43 (48%) Query: 46 TTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + L G R P + +T + I + E++ + +V ++++ Sbjct: 26 SKMLEGMARQPELSGQLRTNMFIGVGLVEAMPIIAFVVALMVM 68 >gi|90961571|ref|YP_535487.1| ATP synthase C chain [Lactobacillus salivarius UCC118] gi|227890657|ref|ZP_04008462.1| H(+)-transporting two-sector ATPase [Lactobacillus salivarius ATCC 11741] gi|301299963|ref|ZP_07206190.1| ATP synthase F0, C subunit [Lactobacillus salivarius ACS-116-V-Col5a] gi|90820765|gb|ABD99404.1| ATP synthase C chain [Lactobacillus salivarius UCC118] gi|227867595|gb|EEJ75016.1| H(+)-transporting two-sector ATPase [Lactobacillus salivarius ATCC 11741] gi|300852445|gb|EFK80102.1| ATP synthase F0, C subunit [Lactobacillus salivarius ACS-116-V-Col5a] Length = 74 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 23/47 (48%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 S + + L G R P ++ ++ + I + E+ + ++V LL+ Sbjct: 25 SLVISKMLEGMARQPELSNQLRSNMFIGVGLVEATPILAIVVSFLLV 71 >gi|308746049|ref|YP_003934545.1| ATP synthase CFO C subunit [Cheilanthes lindheimeri] gi|302375482|gb|ADL29856.1| ATP synthase CFO C subunit [Cheilanthes lindheimeri] Length = 81 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVV 84 L+V Sbjct: 67 GLVVA 71 >gi|257790794|ref|YP_003181400.1| H+transporting two-sector ATPase C subunit [Eggerthella lenta DSM 2243] gi|317488494|ref|ZP_07947045.1| ATP synthase subunit C [Eggerthella sp. 1_3_56FAA] gi|325831939|ref|ZP_08165036.1| putative ATP synthase F0, C subunit [Eggerthella sp. HGA1] gi|257474691|gb|ACV55011.1| H+transporting two-sector ATPase C subunit [Eggerthella lenta DSM 2243] gi|316912426|gb|EFV33984.1| ATP synthase subunit C [Eggerthella sp. 1_3_56FAA] gi|325486260|gb|EGC88712.1| putative ATP synthase F0, C subunit [Eggerthella sp. HGA1] Length = 72 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 27/67 (40%), Gaps = 3/67 (4%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A K V G++ +G L + R P T +I A +AE+LGL Sbjct: 9 ALKLVGYGLSTIG---PGLGIGIACYGCCVATARQPELQGRLFTNFIIGAALAEALGLIG 65 Query: 81 LLVVMLL 87 ++ ++ Sbjct: 66 FVLTFIV 72 >gi|119511016|ref|ZP_01630137.1| ATP synthase c subunit [Nodularia spumigena CCY9414] gi|119464361|gb|EAW45277.1| ATP synthase c subunit [Nodularia spumigena CCY9414] Length = 91 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 24/60 (40%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G A+A L + P A+ + + I ES ++ +V M+L+F Sbjct: 22 AIGSIGPAIAEGWAVARALGAMAQQPDQANTITRTLFVGLAIIESTAIYCFVVSMILIFA 81 >gi|57237764|ref|YP_179012.1| F0F1 ATP synthase subunit C [Campylobacter jejuni RM1221] gi|205356418|ref|ZP_03223183.1| ATP synthase F0 sector C subunit [Campylobacter jejuni subsp. jejuni CG8421] gi|81353672|sp|Q5HUM3|ATPL_CAMJR RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|57166568|gb|AAW35347.1| ATP synthase F0, C subunit [Campylobacter jejuni RM1221] gi|205345803|gb|EDZ32441.1| ATP synthase F0 sector C subunit [Campylobacter jejuni subsp. jejuni CG8421] gi|315058375|gb|ADT72704.1| ATP synthase C chain [Campylobacter jejuni subsp. jejuni S3] Length = 112 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 18/85 (21%), Positives = 38/85 (44%), Gaps = 3/85 (3%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 +E +S+ A + +G+A LG A+ + N ++G RNP T Sbjct: 24 VEQEAINVWIKAFSVLAAGLGLGVAALG---GAIGMGNTAAATIAGTARNPGLGPKLMTT 80 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFV 90 + I + E+ ++ L++ ++ L+ Sbjct: 81 MFIALAMIEAQVIYALVIALIALYA 105 >gi|159042995|ref|YP_001531789.1| F0F1 ATP synthase subunit C [Dinoroseobacter shibae DFL 12] gi|157910755|gb|ABV92188.1| ATP synthase F0, C subunit [Dinoroseobacter shibae DFL 12] Length = 96 Score = 34.1 bits (77), Expect = 6.0, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 27/60 (45%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G AL +T LS + P AAS + + + ES ++ +V M+L+F Sbjct: 20 AIGAIGPALGEGRAASTALSAIAQQPDAASTLSRTLFVSLAMIESTAIYCFVVAMILIFA 79 >gi|18311174|ref|NP_563108.1| F0F1 ATP synthase subunit C [Clostridium perfringens str. 13] gi|110800530|ref|YP_696871.1| F0F1 ATP synthase subunit C [Clostridium perfringens ATCC 13124] gi|168205571|ref|ZP_02631576.1| ATP synthase F0, C subunit [Clostridium perfringens E str. JGS1987] gi|168210122|ref|ZP_02635747.1| ATP synthase F0, C subunit [Clostridium perfringens B str. ATCC 3626] gi|168213704|ref|ZP_02639329.1| ATP synthase F0, C subunit [Clostridium perfringens CPE str. F4969] gi|168215821|ref|ZP_02641446.1| ATP synthase F0, C subunit [Clostridium perfringens NCTC 8239] gi|169344217|ref|ZP_02865199.1| ATP synthase F0, C subunit [Clostridium perfringens C str. JGS1495] gi|182623908|ref|ZP_02951696.1| ATP synthase F0, C subunit [Clostridium perfringens D str. JGS1721] gi|81766636|sp|Q8XIC9|ATPL_CLOPE RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122958719|sp|Q0TNB9|ATPL_CLOP1 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|18145857|dbj|BAB81898.1| ATP synthase C chain [Clostridium perfringens str. 13] gi|110675177|gb|ABG84164.1| ATP synthase F0, C subunit [Clostridium perfringens ATCC 13124] gi|169297676|gb|EDS79776.1| ATP synthase F0, C subunit [Clostridium perfringens C str. JGS1495] gi|170662873|gb|EDT15556.1| ATP synthase F0, C subunit [Clostridium perfringens E str. JGS1987] gi|170711797|gb|EDT23979.1| ATP synthase F0, C subunit [Clostridium perfringens B str. ATCC 3626] gi|170714805|gb|EDT26987.1| ATP synthase F0, C subunit [Clostridium perfringens CPE str. F4969] gi|177910801|gb|EDT73155.1| ATP synthase F0, C subunit [Clostridium perfringens D str. JGS1721] gi|182382003|gb|EDT79482.1| ATP synthase F0, C subunit [Clostridium perfringens NCTC 8239] Length = 72 Score = 34.1 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 34/68 (50%) Query: 23 KYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 K +A G+A L + + L R P A+ ++ ++ A ++E+ ++ L+ Sbjct: 4 KLLAAGIAVLAGIGAGIGIGIATAGALEATARQPEASDKIQSLFIMGAGLSEATAIYGLV 63 Query: 83 VVMLLLFV 90 V ++LLFV Sbjct: 64 VSIILLFV 71 >gi|19717798|gb|AAL96319.1| ATPase subunit 9 [Candida glabrata] gi|19717800|gb|AAL96320.1| ATPase subunit 9 [Candida glabrata] gi|19717802|gb|AAL96321.1| ATPase subunit 9 [Candida glabrata] gi|19717804|gb|AAL96322.1| ATPase subunit 9 [Candida glabrata] gi|19717806|gb|AAL96323.1| ATPase subunit 9 [Candida glabrata] gi|19717808|gb|AAL96324.1| ATPase subunit 9 [Candida glabrata] gi|19717810|gb|AAL96325.1| ATPase subunit 9 [Candida glabrata] gi|19717812|gb|AAL96326.1| ATPase subunit 9 [Candida glabrata] gi|19717814|gb|AAL96327.1| ATPase subunit 9 [Candida glabrata] gi|19717816|gb|AAL96328.1| ATPase subunit 9 [Candida glabrata] gi|19717818|gb|AAL96329.1| ATPase subunit 9 [Candida glabrata] gi|19717820|gb|AAL96330.1| ATPase subunit 9 [Candida glabrata] gi|19717822|gb|AAL96331.1| ATPase subunit 9 [Candida glabrata] gi|19717824|gb|AAL96332.1| ATPase subunit 9 [Candida glabrata] gi|19717826|gb|AAL96333.1| ATPase subunit 9 [Candida glabrata] gi|19717828|gb|AAL96334.1| ATPase subunit 9 [Candida glabrata] gi|19717830|gb|AAL96335.1| ATPase subunit 9 [Candida glabrata] gi|19717832|gb|AAL96336.1| ATPase subunit 9 [Candida glabrata] gi|19717834|gb|AAL96337.1| ATPase subunit 9 [Candida glabrata] gi|19717836|gb|AAL96338.1| ATPase subunit 9 [Candida glabrata] gi|19717838|gb|AAL96339.1| ATPase subunit 9 [Candida glabrata] gi|19717840|gb|AAL96340.1| ATPase subunit 9 [Candida glabrata] gi|19717842|gb|AAL96341.1| ATPase subunit 9 [Candida glabrata] gi|19717844|gb|AAL96342.1| ATPase subunit 9 [Candida glabrata] gi|19717846|gb|AAL96343.1| ATPase subunit 9 [Candida glabrata] gi|19717848|gb|AAL96344.1| ATPase subunit 9 [Candida glabrata] gi|19717850|gb|AAL96345.1| ATPase subunit 9 [Candida glabrata] gi|19717852|gb|AAL96346.1| ATPase subunit 9 [Candida glabrata] gi|19717854|gb|AAL96347.1| ATPase subunit 9 [Candida glabrata] gi|19717856|gb|AAL96348.1| ATPase subunit 9 [Candida glabrata] gi|19717858|gb|AAL96349.1| ATPase subunit 9 [Candida glabrata] gi|19717860|gb|AAL96350.1| ATPase subunit 9 [Candida glabrata] gi|19717862|gb|AAL96351.1| ATPase subunit 9 [Candida glabrata] gi|19717864|gb|AAL96352.1| ATPase subunit 9 [Candida glabrata] gi|19717866|gb|AAL96353.1| ATPase subunit 9 [Candida glabrata] gi|19717868|gb|AAL96354.1| ATPase subunit 9 [Candida glabrata] gi|19717870|gb|AAL96355.1| ATPase subunit 9 [Candida glabrata] gi|19717872|gb|AAL96356.1| ATPase subunit 9 [Candida glabrata] gi|19717874|gb|AAL96357.1| ATPase subunit 9 [Candida glabrata] gi|19717876|gb|AAL96358.1| ATPase subunit 9 [Candida glabrata] gi|19717878|gb|AAL96359.1| ATPase subunit 9 [Candida glabrata] gi|19717880|gb|AAL96360.1| ATPase subunit 9 [Candida glabrata] gi|19717882|gb|AAL96361.1| ATPase subunit 9 [Candida glabrata] gi|19717884|gb|AAL96362.1| ATPase subunit 9 [Candida glabrata] Length = 50 Score = 34.1 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 12/47 (25%), Positives = 24/47 (51%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 +LAAKY+ G++ +G+ + + +F ++G RNP + Sbjct: 4 ALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKDTLFSY 50 >gi|51209984|ref|YP_063648.1| ATP synthase CF0 C subunit [Gracilaria tenuistipitata var. liui] gi|399085|sp|Q02851|ATPH_ANTSP RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|75289855|sp|Q6B8R2|ATPH_GRATL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|14173|emb|CAA44980.1| atpH [Antithamnion sp.] gi|50657738|gb|AAT79723.1| ATP synthase CF0 C chain subunit III [Gracilaria tenuistipitata var. liui] Length = 82 Score = 34.1 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 22/56 (39%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P + +L+ ESL ++ L+V + LLF Sbjct: 22 IGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFMESLTIYGLVVALSLLFA 77 >gi|169142784|ref|YP_001687209.1| ATP synthase CF0 C subunit [Aneura mirabilis] gi|223635045|sp|B0YPM3|ATPH_ANEMR RecName: Full=ATP synthase subunit C, plastid; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|153973810|gb|ABS54470.1| ATP synthase CF0 subunit III [Aneura mirabilis] Length = 81 Score = 34.1 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L E+L ++ Sbjct: 7 AASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLSSPASMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + L F Sbjct: 67 GLVVALALSFA 77 >gi|300858262|ref|YP_003783245.1| ATP synthase subunit C [Corynebacterium pseudotuberculosis FRC41] gi|300685716|gb|ADK28638.1| ATP synthase C chain [Corynebacterium pseudotuberculosis FRC41] gi|302205983|gb|ADL10325.1| F0F1 ATP synthase subunit C [Corynebacterium pseudotuberculosis C231] gi|302330536|gb|ADL20730.1| F0F1 ATP synthase subunit C [Corynebacterium pseudotuberculosis 1002] gi|308276218|gb|ADO26117.1| F0F1 ATP synthase subunit C [Corynebacterium pseudotuberculosis I19] Length = 79 Score = 34.1 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 3/82 (3%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 M A AA++ S + V G+A +G L + + L G R P A +T Sbjct: 1 MNEAILAASDTAVSGSIATVGYGLATIG---PGLGIGILVGKALEGMARQPEMAGQLRTT 57 Query: 66 VLIFAVIAESLGLFLLLVVMLL 87 + + E+L L L+ +L Sbjct: 58 MFLGIAFVEALALIGLVAGFIL 79 >gi|184154912|ref|YP_001843252.1| F1F0-ATPase C subunit [Lactobacillus fermentum IFO 3956] gi|227514476|ref|ZP_03944525.1| H(+)-transporting two-sector ATPase [Lactobacillus fermentum ATCC 14931] gi|260663291|ref|ZP_05864182.1| ATP synthase F0, C subunit [Lactobacillus fermentum 28-3-CHN] gi|254810004|sp|B2GAU0|ATPL_LACF3 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|183226256|dbj|BAG26772.1| F1F0-ATPase C subunit [Lactobacillus fermentum IFO 3956] gi|227087162|gb|EEI22474.1| H(+)-transporting two-sector ATPase [Lactobacillus fermentum ATCC 14931] gi|260552143|gb|EEX25195.1| ATP synthase F0, C subunit [Lactobacillus fermentum 28-3-CHN] Length = 70 Score = 34.1 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 7/47 (14%), Positives = 20/47 (42%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + L G R P + + + + + E+L + +++ L++ Sbjct: 22 GLVIGHTLDGMARQPEMSGQLRGTMFLGVGLIEALPILSIVIAFLVM 68 >gi|22711899|ref|NP_683779.1| ATP synthase CF0 C subunit [Chaetosphaeridium globosum] gi|75302102|sp|Q8MA07|ATPH_CHAGL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|22416903|gb|AAM96503.1| CF0 subunit III of ATP synthase [Chaetosphaeridium globosum] Length = 81 Score = 34.1 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 +A +A G+A L + + G R P + +L+ E+L ++ Sbjct: 7 SASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|293375568|ref|ZP_06621842.1| ATP synthase F0, C subunit [Turicibacter sanguinis PC909] gi|325836774|ref|ZP_08166241.1| ATP synthase F0, C subunit [Turicibacter sp. HGF1] gi|292645785|gb|EFF63821.1| ATP synthase F0, C subunit [Turicibacter sanguinis PC909] gi|325491152|gb|EGC93441.1| ATP synthase F0, C subunit [Turicibacter sp. HGF1] Length = 94 Score = 34.1 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 16/85 (18%), Positives = 33/85 (38%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 ++ +N + L V G+A + N + R P A Sbjct: 3 LQTVASTISNEAFVLGMSAVGAGIAVCSGIGTGIGQGNAAGQAAAAVGRQPEAKGDVMQM 62 Query: 66 VLIFAVIAESLGLFLLLVVMLLLFV 90 +++ IAE+ ++ +V ++LLF+ Sbjct: 63 MILGQAIAETSAIYGFVVAIILLFI 87 >gi|229823978|ref|ZP_04450047.1| hypothetical protein GCWU000282_01282 [Catonella morbi ATCC 51271] gi|229786332|gb|EEP22446.1| hypothetical protein GCWU000282_01282 [Catonella morbi ATCC 51271] Length = 71 Score = 34.1 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 5/55 (9%), Positives = 21/55 (38%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 ++ + + + R P + + + + E++ + +++ +L F Sbjct: 16 LGASIGNGMVISKTIESIARQPELEGKLRMTMFLGVGLIEAVPIIAVVIALLFAF 70 >gi|78187939|ref|YP_375982.1| ATP synthase F0, C subunit [Chlorobium luteolum DSM 273] gi|145220543|ref|YP_001131252.1| ATP synthase F0, C subunit [Prosthecochloris vibrioformis DSM 265] gi|78167841|gb|ABB24939.1| ATP synthase F0 subcomplex C subunit [Chlorobium luteolum DSM 273] gi|145206707|gb|ABP37750.1| ATP synthase F0 subcomplex C subunit [Chlorobium phaeovibrioides DSM 265] Length = 75 Score = 34.1 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 27/54 (50%) Query: 34 MGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLL 87 + L + NI + G R P A S +T ++I A + E + LF ++ +LL Sbjct: 19 VIGAGLGIGNIAASAAEGTARQPEATSDIRTTMIIAAALIEGVALFGEVICVLL 72 >gi|312142780|ref|YP_003994226.1| ATP synthase F0, C subunit [Halanaerobium sp. 'sapolanicus'] gi|311903431|gb|ADQ13872.1| ATP synthase F0, C subunit [Halanaerobium sp. 'sapolanicus'] Length = 85 Score = 34.1 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 33/68 (48%) Query: 24 YVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 ++A G+A + + + + R P A A T +L+ V++ S G++ L++ Sbjct: 18 FLASGLALIAGVGPGIGMGYAAGKATTAVRRQPEARGAIITTMLLGQVVSGSTGIYSLII 77 Query: 84 VMLLLFVI 91 + L+F I Sbjct: 78 AIFLIFGI 85 >gi|218290066|ref|ZP_03494233.1| ATP synthase F0, C subunit [Alicyclobacillus acidocaldarius LAA1] gi|258512721|ref|YP_003186155.1| ATP synthase F0, C subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|218239900|gb|EED07088.1| ATP synthase F0, C subunit [Alicyclobacillus acidocaldarius LAA1] gi|257479447|gb|ACV59766.1| ATP synthase F0, C subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 82 Score = 34.1 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + Y+ G R P A + L+ + E+ + L +++LF Sbjct: 25 SGVGDGMVMSKYVEGVARQPEARGSIFGSALLGVALVEAFPVIALAFGIIILFT 78 >gi|167628987|ref|YP_001679486.1| ATP synthase f0, c subunit [Heliobacterium modesticaldum Ice1] gi|167591727|gb|ABZ83475.1| ATP synthase f0, c subunit [Heliobacterium modesticaldum Ice1] Length = 78 Score = 34.1 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A + G+A L ++ + + + G R P A A +T + I + E+L + Sbjct: 5 AFALLGAGLAVGLAAFGASIGNGMVTSKTVEGIARQPQARGALQTTMFISVGLIEALPII 64 Query: 80 LLLVVMLL 87 +++ LL Sbjct: 65 TVVIAFLL 72 >gi|119944244|ref|YP_941924.1| F0F1 ATP synthase subunit C [Psychromonas ingrahamii 37] gi|119862848|gb|ABM02325.1| ATP synthase F0, H+-transporting two-sector ATPase C subunit [Psychromonas ingrahamii 37] Length = 93 Score = 34.1 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 25 VAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + G+ G ALA ++ + P A+S + + + ES ++ +V Sbjct: 13 IIAGLTTGFGTMGPALAEGRAVAAAMASLAQQPDASSTITRTLFVGLAMIESTAIYCFVV 72 Query: 84 VMLLLFV 90 M++LF Sbjct: 73 SMIILFA 79 >gi|11465712|ref|NP_053856.1| ATP synthase CF0 C subunit [Porphyra purpurea] gi|90994437|ref|YP_536927.1| ATP synthase CF0 C subunit [Porphyra yezoensis] gi|1703750|sp|P51246|ATPH_PORPU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|122225825|sp|Q1XDP1|ATPH_PORYE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|1276712|gb|AAC08132.1| ATP synthase CF0 C chain (lipid-binding) (subunit III) [Porphyra purpurea] gi|90819001|dbj|BAE92370.1| ATP synthase CFO C chain lipid-binding subunit III [Porphyra yezoensis] Length = 82 Score = 34.1 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 22/56 (39%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P + +L+ ESL ++ L+V + LLF Sbjct: 22 IGPGIGQGSAAANAVEGIARQPEVEGKIRGTLLLSLAFMESLTIYGLVVALSLLFA 77 >gi|295836491|ref|ZP_06823424.1| ATP synthase subunit C [Streptomyces sp. SPB74] gi|197699016|gb|EDY45949.1| ATP synthase subunit C [Streptomyces sp. SPB74] Length = 80 Score = 34.1 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 4/71 (5%) Query: 20 LAAKYVAVGMACLGMGLVALA----VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAES 75 LAA +V+ + LG GL A+ V IF R P AA + ++ E+ Sbjct: 7 LAADHVSGSLGSLGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRANQILGFAFCEA 66 Query: 76 LGLFLLLVVML 86 L L L++ + Sbjct: 67 LALIGLVMPFV 77 >gi|269118885|ref|YP_003307062.1| ATP synthase F0 C subunit [Sebaldella termitidis ATCC 33386] gi|268612763|gb|ACZ07131.1| ATP synthase F0, C subunit [Sebaldella termitidis ATCC 33386] Length = 78 Score = 34.1 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 17/69 (24%), Positives = 27/69 (39%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 A + G A +G + + R P A + I IAES G++ Sbjct: 7 AGALLGAGTAMIGGIGSGIGQGFATGKAVEAVSRQPEAKQDILQVLFIGCAIAESTGIYS 66 Query: 81 LLVVMLLLF 89 L++ LL+F Sbjct: 67 LVIAFLLIF 75 >gi|160881859|ref|YP_001560827.1| F0F1 ATP synthase subunit C [Clostridium phytofermentans ISDg] gi|224487644|sp|A9KK97|ATPL_CLOPH RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|160430525|gb|ABX44088.1| ATP synthase F0, C subunit [Clostridium phytofermentans ISDg] Length = 86 Score = 34.1 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 17/77 (22%), Positives = 32/77 (41%) Query: 14 ANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIA 73 +N + L + G+A + + + RNP A + +L+ +A Sbjct: 3 SNEAFVLGCSAIGAGLAMIAGIGPGIGQGIAAGHGAAAVGRNPGARGNIMSTMLLGQAVA 62 Query: 74 ESLGLFLLLVVMLLLFV 90 E+ GL+ V ++LLF Sbjct: 63 ETTGLYGFAVAIILLFA 79 >gi|153805567|ref|YP_001382143.1| ATP synthase CF0 C subunit [Leptosira terrestris] gi|223634978|sp|A6YG66|ATPH_LEPTE RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|134270098|gb|ABO69287.1| CF0 subunit III of ATP synthase [Leptosira terrestris] Length = 82 Score = 34.1 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 22/56 (39%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P A + +L+ ESL ++ L+V + LLF Sbjct: 22 IGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIYGLVVALALLFA 77 >gi|69247780|ref|ZP_00604485.1| ATP synthase F0, C subunit [Enterococcus faecium DO] gi|257879709|ref|ZP_05659362.1| ATP synthase F0 [Enterococcus faecium 1,230,933] gi|257884016|ref|ZP_05663669.1| ATP synthase F0 [Enterococcus faecium 1,231,501] gi|257890373|ref|ZP_05670026.1| ATP synthase F0 [Enterococcus faecium 1,231,410] gi|257892981|ref|ZP_05672634.1| ATP synthase F0 [Enterococcus faecium 1,231,408] gi|258616681|ref|ZP_05714451.1| H(+)-transporting two-sector ATPase (ATP synthase), C subunit [Enterococcus faecium DO] gi|260559632|ref|ZP_05831812.1| ATP synthase F0 [Enterococcus faecium C68] gi|293560033|ref|ZP_06676537.1| ATP synthase F0, C subunit [Enterococcus faecium E1162] gi|293568729|ref|ZP_06680044.1| ATP synthase F0, C subunit [Enterococcus faecium E1071] gi|294616244|ref|ZP_06696037.1| ATP synthase F0, C subunit [Enterococcus faecium E1636] gi|314939617|ref|ZP_07846844.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133a04] gi|314941243|ref|ZP_07848139.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133C] gi|314949824|ref|ZP_07853134.1| ATP synthase F0, C subunit [Enterococcus faecium TX0082] gi|314953384|ref|ZP_07856309.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133A] gi|314993461|ref|ZP_07858826.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133B] gi|314997316|ref|ZP_07862281.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133a01] gi|68194709|gb|EAN09191.1| ATP synthase F0, C subunit [Enterococcus faecium DO] gi|257813937|gb|EEV42695.1| ATP synthase F0 [Enterococcus faecium 1,230,933] gi|257819854|gb|EEV47002.1| ATP synthase F0 [Enterococcus faecium 1,231,501] gi|257826733|gb|EEV53359.1| ATP synthase F0 [Enterococcus faecium 1,231,410] gi|257829360|gb|EEV55967.1| ATP synthase F0 [Enterococcus faecium 1,231,408] gi|260074300|gb|EEW62622.1| ATP synthase F0 [Enterococcus faecium C68] gi|291588689|gb|EFF20522.1| ATP synthase F0, C subunit [Enterococcus faecium E1071] gi|291590758|gb|EFF22474.1| ATP synthase F0, C subunit [Enterococcus faecium E1636] gi|291605900|gb|EFF35330.1| ATP synthase F0, C subunit [Enterococcus faecium E1162] gi|313588607|gb|EFR67452.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133a01] gi|313592126|gb|EFR70971.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133B] gi|313594577|gb|EFR73422.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133A] gi|313599967|gb|EFR78810.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133C] gi|313641157|gb|EFS05737.1| ATP synthase F0, C subunit [Enterococcus faecium TX0133a04] gi|313643897|gb|EFS08477.1| ATP synthase F0, C subunit [Enterococcus faecium TX0082] Length = 71 Score = 34.1 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 8/52 (15%), Positives = 24/52 (46%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 + + + R P + +T + I + E++ + ++V ++L+F + Sbjct: 20 GNGQVISKTIESMARQPEMSGQFRTTMFIGVALVEAVPILGVVVALILVFGV 71 >gi|4469301|emb|CAB38451.1| ATP synthase CF0 C chain [Prototheca wickerhamii] Length = 81 Score = 34.1 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA +A G+A L + + G R P A + +L+ ESL ++ Sbjct: 7 AASVIAAGLAIGLATIGPGIGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|301500886|ref|YP_003795298.1| ATP synthase CF0 C subunit [Chromera velia] gi|300069432|gb|ADJ66540.1| ATP synthase CF0 C subunit [Chromera velia] Length = 80 Score = 34.1 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 24/59 (40%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 LG + + +S R P + +L+ E+L ++ L++ + LLF Sbjct: 19 LGSIGPGIGQGILAGDAVSAISRQPEVEDKIRNTLLLSLAFLEALTIYGLIIALALLFA 77 >gi|223041166|ref|ZP_03611419.1| ATP synthase C chain (Lipid-binding protein) [Campylobacter rectus RM3267] gi|255322466|ref|ZP_05363611.1| ATP synthase C chain [Campylobacter showae RM3277] gi|222877563|gb|EEF12691.1| ATP synthase C chain (Lipid-binding protein) [Campylobacter rectus RM3267] gi|255300374|gb|EET79646.1| ATP synthase C chain [Campylobacter showae RM3277] Length = 99 Score = 34.1 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 27/52 (51%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + N + +SG RNP S T + + + E+ ++ L++ +++L+ Sbjct: 44 IGMGNTASATISGTARNPGVGSKLTTTMFVALAMIEAQVIYALVIALIVLYA 95 >gi|160688735|gb|ABX45151.1| ATPase subunit 9 [Polysphondylium pallidum] Length = 87 Score = 34.1 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 29/68 (42%) Query: 22 AKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLL 81 K V G+A +G+ V +F ++ NP ++ + E++ L L Sbjct: 19 GKKVGAGLASIGLAGAGAGVGIVFAAFVLSVSFNPNLRGELFKLTMLGFALTEAVALLAL 78 Query: 82 LVVMLLLF 89 ++ L+L+ Sbjct: 79 MMSFLILY 86 >gi|258406206|ref|YP_003198948.1| ATP synthase F0, C subunit [Desulfohalobium retbaense DSM 5692] gi|257798433|gb|ACV69370.1| ATP synthase F0, C subunit [Desulfohalobium retbaense DSM 5692] Length = 106 Score = 34.1 bits (77), Expect = 7.6, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 23/41 (56%) Query: 50 SGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G RNP A+ +L+ + ESL ++ L+V ++LLF Sbjct: 62 EGTARNPEASGKITVTMLVGLAMIESLAIYALVVNLILLFA 102 >gi|257867450|ref|ZP_05647103.1| H+ ATPase [Enterococcus casseliflavus EC30] gi|257873780|ref|ZP_05653433.1| H+ ATPase [Enterococcus casseliflavus EC10] gi|257877530|ref|ZP_05657183.1| H+ ATPase [Enterococcus casseliflavus EC20] gi|257801506|gb|EEV30436.1| H+ ATPase [Enterococcus casseliflavus EC30] gi|257807944|gb|EEV36766.1| H+ ATPase [Enterococcus casseliflavus EC10] gi|257811696|gb|EEV40516.1| H+ ATPase [Enterococcus casseliflavus EC20] Length = 70 Score = 34.1 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 7/50 (14%), Positives = 22/50 (44%) Query: 40 AVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 + + R P + ++ + I + E++ + +++ +LL+F Sbjct: 20 GNGQVIAKTIESMARQPEMSGQLRSTMFIGVALVEAVPILGVVIALLLVF 69 >gi|328463640|gb|EGF35240.1| ATP synthase subunit C [Lactobacillus rhamnosus MTCC 5462] Length = 70 Score = 33.7 bits (76), Expect = 7.7, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 23/51 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 ++ + + L G R P A + + I + E++ + ++V +L+ Sbjct: 18 SIGNGMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPIISVVVAFMLM 68 >gi|255961298|ref|YP_003097480.1| ATP synthase CF0 C chain [Selaginella moellendorffii] gi|302824467|ref|XP_002993876.1| hypothetical protein SELMODRAFT_137813 [Selaginella moellendorffii] gi|254941470|gb|ACT88985.1| ATP synthase CF0 C chain [Selaginella moellendorffii] gi|296399251|gb|ADH10426.1| ATP synthase CF0 subunit III [Selaginella moellendorffii] gi|300138243|gb|EFJ05017.1| hypothetical protein SELMODRAFT_137813 [Selaginella moellendorffii] Length = 81 Score = 33.7 bits (76), Expect = 7.7, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A L + + G R P A + L+ E+L ++ Sbjct: 7 AASVVAAGLAVGLASTGPGVGQGTAAGQAVEGIARQPEAEGKTRGTSLLSPAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LF Sbjct: 67 GLVVALAPLFA 77 >gi|255505423|ref|ZP_05346002.3| ATP synthase F0, C subunit [Bryantella formatexigens DSM 14469] gi|255267935|gb|EET61140.1| ATP synthase F0, C subunit [Bryantella formatexigens DSM 14469] Length = 128 Score = 33.7 bits (76), Expect = 7.7, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 24/42 (57%) Query: 50 SGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 G R P A +T +++ V E+ ++ L+V +L++FV+ Sbjct: 87 EGIARQPEAEGKIRTNLMLGLVFIETAIIYALIVAILIIFVL 128 >gi|299830362|ref|YP_003734577.1| ATP synthase CF0 C chain subunit III [Kryptoperidinium foliaceum] gi|297385064|gb|ADI40362.1| ATP synthase CF0 C chain subunit III [Kryptoperidinium foliaceum] Length = 82 Score = 33.7 bits (76), Expect = 7.8, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 22/53 (41%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P + + +L+ E+L ++ L+V + LLF Sbjct: 25 GIGQGTAAGQAVEGIARQPEVENKIRGTLLLSLAFMEALTIYGLVVALALLFA 77 >gi|226360601|ref|YP_002778379.1| F0F1 ATP synthase subunit C [Rhodococcus opacus B4] gi|226239086|dbj|BAH49434.1| ATP synthase subunit c [Rhodococcus opacus B4] Length = 82 Score = 33.7 bits (76), Expect = 7.8, Method: Composition-based stats. Identities = 16/81 (19%), Positives = 26/81 (32%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 M A A + AK L + V + + G R P A +T Sbjct: 1 MSLAYLAQEAVETTTTAKGFGAIGYGLAAIGPGIGVGIVVGKAIEGMVRQPEMAGQVRTT 60 Query: 66 VLIFAVIAESLGLFLLLVVML 86 + + E+L L L+ + Sbjct: 61 MFLGIAFTEALALIGLVAGFI 81 >gi|193213685|ref|YP_001999638.1| ATP synthase F0 subunit C [Chlorobaculum parvum NCIB 8327] gi|193087162|gb|ACF12438.1| ATP synthase F0, C subunit [Chlorobaculum parvum NCIB 8327] Length = 75 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 24 YVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLL 82 Y+ G+ A L + L + NI + G R P A S +T ++I A + E + LF + Sbjct: 8 YLGAGVGAGLAVIGAGLGIGNIAASAAEGTARQPEATSDIRTTMIIAAALIEGVALFGEV 67 Query: 83 VVMLL 87 + +LL Sbjct: 68 ICVLL 72 >gi|336868|gb|AAA84220.1| ATP synthase proton-translocating subunit [Euglena gracilis] Length = 77 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 21/45 (46%) Query: 46 TTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + G R P A + +L+ E+L ++ L+V + ++F Sbjct: 29 GKAIEGLARQPEAEDKIRGTLLLSLAFMEALTIYGLVVALAIIFA 73 >gi|326382089|ref|ZP_08203782.1| F0F1 ATP synthase subunit C [Gordonia neofelifaecis NRRL B-59395] gi|326199515|gb|EGD56696.1| F0F1 ATP synthase subunit C [Gordonia neofelifaecis NRRL B-59395] Length = 80 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 11/68 (16%), Positives = 25/68 (36%) Query: 19 SLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGL 78 ++ K L + V + + G R P A +T + + ++E+L L Sbjct: 12 TITGKGFGAIGYGLAAIGPGIGVGIVAGKAIEGIARQPELAGQIRTTMFLGIALSEALAL 71 Query: 79 FLLLVVML 86 ++ + Sbjct: 72 IGIVAGFI 79 >gi|210617054|ref|ZP_03291389.1| hypothetical protein CLONEX_03611 [Clostridium nexile DSM 1787] gi|210149577|gb|EEA80586.1| hypothetical protein CLONEX_03611 [Clostridium nexile DSM 1787] Length = 75 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 28/64 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + + + R P A S +L+ +AE+ ++ ++ Sbjct: 8 IGAGIAVLTGIGAGIGIGIATSKAVDAIARQPEAESKISKSLLLGCALAEATAIYGFVIA 67 Query: 85 MLLL 88 +L++ Sbjct: 68 LLII 71 >gi|71842278|ref|YP_277366.1| ATP synthase CF0 C subunit [Emiliania huxleyi] gi|122249154|sp|Q4G3A1|ATPH_EMIHU RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|52547760|gb|AAU81915.1| ATP synthase CF0 C chain [Emiliania huxleyi] gi|60101521|gb|AAX13865.1| ATP synthase CF0 C chain [Emiliania huxleyi] Length = 82 Score = 33.7 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 A +A G+A L + + G R P A + +L+ ESL ++ Sbjct: 7 GASVIAAGLAIGLASIGPGIGQGTAAAQAVEGLARQPEAEGKIRGTLLLSLAFMESLTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALCLLFA 77 >gi|32266092|ref|NP_860124.1| F0F1 ATP synthase subunit C [Helicobacter hepaticus ATCC 51449] gi|81666187|sp|Q7VIL1|ATPL_HELHP RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|32262141|gb|AAP77190.1| ATP synthase F0 [Helicobacter hepaticus ATCC 51449] Length = 103 Score = 33.7 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 17/73 (23%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Query: 18 YSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLG 77 YS+A + +G+A LG A+ + + +SG RNP + + I + E+ Sbjct: 29 YSIAGAVIGLGIAALG---GAIGMGHAAAATISGTARNPGISGKLLGTMFIALALIEAQV 85 Query: 78 LFLLLVVMLLLFV 90 ++ L++ ++ L+ Sbjct: 86 IYTLVLALIALYA 98 >gi|269837455|ref|YP_003319683.1| ATP synthase F0, C subunit [Sphaerobacter thermophilus DSM 20745] gi|269786718|gb|ACZ38861.1| ATP synthase F0, C subunit [Sphaerobacter thermophilus DSM 20745] Length = 81 Score = 33.7 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 31/60 (51%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 LG AL + + RNP A A + ++I A +AE++ ++ +V +++ FV+ Sbjct: 22 LGSLGPALGIGMAVRAAMEALGRNPEAEGAIRITMIIGAALAEAVAIYAFVVAIVIAFVL 81 >gi|168333938|ref|ZP_02692170.1| ATP synthase F0, C subunit [Epulopiscium sp. 'N.t. morphotype B'] Length = 178 Score = 33.7 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 18/72 (25%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEV-LIFAVIAESLGL 78 L A + G+A + + +NP T V L+ A +AE+ G+ Sbjct: 21 LGASAIGAGLAMIAGXGPGIGQGFAAGKAAEAMGKNPEHGGKPATLVMLLGAAVAETSGI 80 Query: 79 FLLLVVMLLLFV 90 F L+V +++LF Sbjct: 81 FSLVVAIIMLFA 92 >gi|308274422|emb|CBX31021.1| ATP synthase subunit c 2 [uncultured Desulfobacterium sp.] Length = 65 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 22/42 (52%) Query: 49 LSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L + P AA+ + I + ESL ++ L++ ++L+F Sbjct: 11 LEAIAQQPDAANTITRNLFIGIAMIESLAIYCLVIAVILIFT 52 >gi|228474868|ref|ZP_04059597.1| ATP synthase F0, C subunit [Staphylococcus hominis SK119] gi|314935943|ref|ZP_07843293.1| ATP synthase F0, C subunit [Staphylococcus hominis subsp. hominis C80] gi|228271100|gb|EEK12480.1| ATP synthase F0, C subunit [Staphylococcus hominis SK119] gi|313655949|gb|EFS19691.1| ATP synthase F0, C subunit [Staphylococcus hominis subsp. hominis C80] Length = 70 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A +A+G++ LG + I + + G R P A + + I + E+L + Sbjct: 3 LIAAAIAIGLSALG---AGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPII 59 Query: 80 LLLVVMLLLF 89 +++ + LF Sbjct: 60 GVVISFMTLF 69 >gi|227497326|ref|ZP_03927558.1| F0F1 ATP synthase subunit C [Actinomyces urogenitalis DSM 15434] gi|226833197|gb|EEH65580.1| F0F1 ATP synthase subunit C [Actinomyces urogenitalis DSM 15434] Length = 67 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A LG + + + G R P A A +T + I A + E+LGL Sbjct: 8 IGYGLATLG---PGIGIGLLVAKTQEGTARQPEVAGALRTNMFIGAALIEALGLLGFAAG 64 Query: 85 ML 86 + Sbjct: 65 FV 66 >gi|121282040|gb|ABM53594.1| putative ATP synthase C chain [uncultured bacterium CBNPD1 BAC clone 2089] Length = 94 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 23/59 (38%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L + + + + R P AA +T + + E+L L +V +LL F Sbjct: 36 LAAIGPGIGIGYLVGKAVEAMARQPEAAGMVRTTMFLGIAFTEALALIGFVVFILLKFA 94 >gi|56965614|ref|YP_177348.1| F0F1 ATP synthase subunit C [Bacillus clausii KSM-K16] gi|81364971|sp|Q5WB73|ATPL_BACSK RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|56911860|dbj|BAD66387.1| F0F1-type ATP synthase C chain [Bacillus clausii KSM-K16] Length = 71 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 24/49 (48%) Query: 41 VSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 V+ I + G R P +T + I A +AE++ + +++ LL F Sbjct: 21 VAIIVKAVIEGTARQPEQRGTLQTLMFIGAPLAEAVPIIAIVIAFLLFF 69 >gi|15616321|ref|NP_244626.1| F0F1 ATP synthase subunit C [Bacillus halodurans C-125] gi|81785506|sp|Q9K6H0|ATPL_BACHD RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|10176383|dbj|BAB07478.1| ATP synthase subunit c [Bacillus halodurans C-125] Length = 70 Score = 33.7 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 22/42 (52%) Query: 49 LSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 L G R P + +T + I +AE++ + ++V +LLF Sbjct: 29 LEGVTRQPELRGSLQTLMFIGVPLAEAVPIIAIVVSFILLFT 70 >gi|7520936|pir||C71379 probable ATPase, chain K - syphilis spirochete Length = 154 Score = 33.7 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 5/69 (7%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 KY+A G+A L LAV I + +P + + L F +AE + L+ Sbjct: 88 GLKYIAAGLAVGLACVGGGLAVGKIGAAAMGAMSEDPEIS----GKALPFIGLAEGICLW 143 Query: 80 LLLVVMLLL 88 LV +L++ Sbjct: 144 GFLVALLII 152 >gi|326693454|ref|ZP_08230459.1| ATP synthase F0 subunit C [Leuconostoc argentinum KCTC 3773] Length = 75 Score = 33.7 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 7/47 (14%), Positives = 21/47 (44%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 + + +L+G R P S + + + + E + + ++ +L+ Sbjct: 27 GVLISQFLAGMSRQPELESRLLSRMFLGVALVEVMPILSIVFAFMLM 73 >gi|114330299|ref|YP_746521.1| F0F1 ATP synthase subunit C [Nitrosomonas eutropha C91] gi|114307313|gb|ABI58556.1| ATP synthase F0, C subunit [Nitrosomonas eutropha C91] Length = 90 Score = 33.7 bits (76), Expect = 8.3, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Query: 25 VAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLV 83 + +G+ LG + V + +L GA R P + +V + + ++ + + + Sbjct: 16 IGIGLMIGLGAAGACIGVGVMCGRFLEGAARQPEMIPTLQGKVFLLLGLTDASFIIAVGL 75 Query: 84 VMLLLF 89 ML F Sbjct: 76 AMLFAF 81 >gi|11467369|ref|NP_043226.1| ATP synthase CF0 C subunit [Cyanophora paradoxa] gi|1352045|sp|P48086|ATPH_CYAPA RecName: Full=ATP synthase subunit C, cyanelle; AltName: Full=ATP synthase F0 sector subunit C; AltName: Full=ATPase subunit III; AltName: Full=Lipid-binding protein gi|1016170|gb|AAA81257.1| c subunit of the F0 portion of ATP synthase [Cyanophora paradoxa] Length = 81 Score = 33.7 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 21/56 (37%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + G R P + +L+ E+L ++ L+V + LLF Sbjct: 22 IGPGIGQGTAAGQAVEGIARQPEVDGKIRGTLLLSLAFMEALTIYGLVVALALLFA 77 >gi|199597581|ref|ZP_03211010.1| F0F1-type ATP synthase, subunit c [Lactobacillus rhamnosus HN001] gi|229551974|ref|ZP_04440699.1| H(+)-transporting two-sector ATPase [Lactobacillus rhamnosus LMS2-1] gi|258508173|ref|YP_003170924.1| ATP synthase subunit C [Lactobacillus rhamnosus GG] gi|258539388|ref|YP_003173887.1| ATP synthase subunit C [Lactobacillus rhamnosus Lc 705] gi|199591604|gb|EDY99681.1| F0F1-type ATP synthase, subunit c [Lactobacillus rhamnosus HN001] gi|229314709|gb|EEN80682.1| H(+)-transporting two-sector ATPase [Lactobacillus rhamnosus LMS2-1] gi|257148100|emb|CAR87073.1| ATP synthase C chain [Lactobacillus rhamnosus GG] gi|257151064|emb|CAR90036.1| ATP synthase C chain [Lactobacillus rhamnosus Lc 705] gi|259649491|dbj|BAI41653.1| F0F1-type ATP synthase subunit C [Lactobacillus rhamnosus GG] Length = 70 Score = 33.7 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 8/51 (15%), Positives = 23/51 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 ++ + + L G R P A + + I + E++ + +++ +L+ Sbjct: 18 SIGNGMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPIISVVIAFMLM 68 >gi|113955150|ref|YP_731514.1| F0F1 ATP synthase subunit C [Synechococcus sp. CC9311] gi|123327633|sp|Q0I7Q8|ATPL_SYNS3 RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|113882501|gb|ABI47459.1| ATP synthase F0, C subunit [Synechococcus sp. CC9311] Length = 81 Score = 33.7 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P A + +L+ ESL ++ L+V ++LLF Sbjct: 22 IGPGIGQGSASQGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLFA 77 >gi|38233641|ref|NP_939408.1| F0F1 ATP synthase subunit C [Corynebacterium diphtheriae NCTC 13129] gi|38199901|emb|CAE49567.1| ATP synthase C chain [Corynebacterium diphtheriae] Length = 79 Score = 33.7 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 20/82 (24%), Positives = 33/82 (40%), Gaps = 3/82 (3%) Query: 6 MEAATFAAANGYYSLAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTE 65 M AA++ S + V G+A +G L + + L G R P A +T Sbjct: 1 MNEVILAASDTAVSGSIATVGYGIATIG---PGLGIGILVGKALEGMARQPEMAGQLRTT 57 Query: 66 VLIFAVIAESLGLFLLLVVMLL 87 + + E+L L L+ +L Sbjct: 58 MFLGIAFVEALALIGLVAGFIL 79 >gi|229829784|ref|ZP_04455853.1| hypothetical protein GCWU000342_01881 [Shuttleworthia satelles DSM 14600] gi|229791773|gb|EEP27887.1| hypothetical protein GCWU000342_01881 [Shuttleworthia satelles DSM 14600] Length = 73 Score = 33.7 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 26/53 (49%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFVI 91 L + R P A ++ +++ A ++E+ ++ ++ +L++F++ Sbjct: 20 LGIGIATGHAADAIARQPEADKKIQSNLILGAALSEATAIYGFVLGILIIFML 72 >gi|302536951|ref|ZP_07289293.1| ATP synthase F0, C subunit [Streptomyces sp. C] gi|302445846|gb|EFL17662.1| ATP synthase F0, C subunit [Streptomyces sp. C] Length = 77 Score = 33.7 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G + V IF R P AA + ++ E+L L L++ Sbjct: 15 VGYGLAAIG---PGVGVGIIFGNGTQALARQPEAAGLIRANQILGFAFCEALALIGLVMP 71 Query: 85 ML 86 + Sbjct: 72 FV 73 >gi|254425700|ref|ZP_05039417.1| ATP synthase F0, C subunit, putative [Synechococcus sp. PCC 7335] gi|196188123|gb|EDX83088.1| ATP synthase F0, C subunit, putative [Synechococcus sp. PCC 7335] Length = 92 Score = 33.7 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 15/73 (20%), Positives = 32/73 (43%), Gaps = 9/73 (12%) Query: 27 VGMACLGMGLVALAVSNIFTTYLSG---------AFRNPCAASAHKTEVLIFAVIAESLG 77 +G+A + MG + +AV +I G + P A+ + + + ES Sbjct: 7 IGIASIVMGGLTIAVGSIAPALGEGRALAQALTALAQQPDEANTITRTLFVGMALVESTA 66 Query: 78 LFLLLVVMLLLFV 90 ++ ++ ++LLF Sbjct: 67 IYCFVITLILLFA 79 >gi|313885511|ref|ZP_07819261.1| ATP synthase F0, C subunit [Eremococcus coleocola ACS-139-V-Col8] gi|312619241|gb|EFR30680.1| ATP synthase F0, C subunit [Eremococcus coleocola ACS-139-V-Col8] Length = 80 Score = 33.7 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 28/54 (51%) Query: 37 VALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +L + +NP AA+ ++ +++ +AE+ ++ LL+ +LLFV Sbjct: 24 SSLGQGIAAGKAVEAVGKNPEAANEIRSMLILGCGVAETCAIYGLLISFILLFV 77 >gi|328957989|ref|YP_004375375.1| F0F1 ATP synthase subunit C [Carnobacterium sp. 17-4] gi|328674313|gb|AEB30359.1| F0F1 ATP synthase subunit C [Carnobacterium sp. 17-4] Length = 70 Score = 33.7 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 23/51 (45%) Query: 39 LAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLF 89 L S + + + R P +T + I + E++ + +++ +L+F Sbjct: 19 LGSSRVVSKTIESIARQPEMKGQLQTLMYIGIGLVEAIPIMAVVIAFILVF 69 >gi|126665451|ref|ZP_01736433.1| ATP synthase F0, C subunit [Marinobacter sp. ELB17] gi|126630079|gb|EBA00695.1| ATP synthase F0, C subunit [Marinobacter sp. ELB17] Length = 95 Score = 33.7 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 25/60 (41%) Query: 31 CLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 +G +LA ++ + P AA + + + ES ++ +V M+L+F Sbjct: 20 AIGCIGPSLAEGRAAAAAIAAIAQQPDAAPTLSRTLFVSLAMIESTAIYCFVVAMILIFA 79 >gi|158520648|ref|YP_001528518.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] gi|224487660|sp|A8ZUM8|ATPL_DESOH RecName: Full=ATP synthase subunit c; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|158509474|gb|ABW66441.1| ATP synthase F0, C subunit [Desulfococcus oleovorans Hxd3] Length = 96 Score = 33.7 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%) Query: 38 ALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + G RNP A+ +LI + ESL ++ L+V ++L+F Sbjct: 28 GIGQGLGLKAAAEGVARNPEASGKITVTMLIGLAMIESLCIYALVVALILIFA 80 >gi|258646353|ref|ZP_05733822.1| conserved domain protein [Dialister invisus DSM 15470] gi|260403751|gb|EEW97298.1| conserved domain protein [Dialister invisus DSM 15470] Length = 117 Score = 33.7 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 9/49 (18%), Positives = 24/49 (48%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + + G R P T +L+ + ES+ + +++ ++L+F Sbjct: 64 AKVASHAIDGMTRQPEMQGQLFTSMLVGIGLVESIPIIAIVISLVLVFA 112 >gi|157363028|ref|YP_001469795.1| F0F1 ATP synthase subunit C [Thermotoga lettingae TMO] gi|157313632|gb|ABV32731.1| ATP synthase F0, C subunit [Thermotoga lettingae TMO] Length = 86 Score = 33.7 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Query: 22 AKYVAVGMACLGMGLVALAV-SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 K++ G+ + ++ + R P T +L+ + E+ GL+ Sbjct: 16 GKFIGAGICMGAGAIGPGIGEGHVGDGAMQAMARQPELIGVLTTRMLLSQAVCETTGLYS 75 Query: 81 LLVVMLLLFVI 91 LL+ +L+LFV+ Sbjct: 76 LLISILILFVL 86 >gi|260906202|ref|ZP_05914524.1| ATP synthase F0, C subunit [Brevibacterium linens BL2] Length = 74 Score = 33.7 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 3/63 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 V G+A +G + V + + G R P A A + + + + E+L L + Sbjct: 14 VGYGLAAIG---PGVGVGIVIGKTIEGTARQPEMAGALRGNMFLGIALIEALALIGIATP 70 Query: 85 MLL 87 L Sbjct: 71 FFL 73 >gi|125975086|ref|YP_001038996.1| ATP synthase F0, C subunit [Clostridium thermocellum ATCC 27405] gi|256003260|ref|ZP_05428252.1| ATP synthase F0, C subunit [Clostridium thermocellum DSM 2360] gi|281418496|ref|ZP_06249515.1| ATP synthase F0, C subunit [Clostridium thermocellum JW20] gi|125715311|gb|ABN53803.1| ATP synthase F0 subcomplex C subunit [Clostridium thermocellum ATCC 27405] gi|255992951|gb|EEU03041.1| ATP synthase F0, C subunit [Clostridium thermocellum DSM 2360] gi|281407580|gb|EFB37839.1| ATP synthase F0, C subunit [Clostridium thermocellum JW20] gi|316939251|gb|ADU73285.1| ATP synthase F0, C subunit [Clostridium thermocellum DSM 1313] Length = 73 Score = 33.7 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 30/64 (46%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 ++ + L + +S + + R P AA + V++ A +AE+ ++ ++ Sbjct: 7 ISASLCVLTGVAAGIGISVATSKAVDAVARQPEAADKIRNIVVLGAALAEATAIYGFVIA 66 Query: 85 MLLL 88 +L++ Sbjct: 67 LLMV 70 >gi|315923924|ref|ZP_07920152.1| ATP synthase F0 sector subunit C [Pseudoramibacter alactolyticus ATCC 23263] gi|315622764|gb|EFV02717.1| ATP synthase F0 sector subunit C [Pseudoramibacter alactolyticus ATCC 23263] Length = 75 Score = 33.7 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 11/67 (16%), Positives = 29/67 (43%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + G+A L + + + R P A S +L+ +AE+ ++ ++ Sbjct: 8 LGAGIAVLTGIGAGVGIGIATGKAMDAIARQPEAESKISKNLLLGCALAEATAIYGFVIG 67 Query: 85 MLLLFVI 91 +L++ ++ Sbjct: 68 LLIIIML 74 >gi|222099817|ref|YP_002534385.1| ATP synthase C chain [Thermotoga neapolitana DSM 4359] gi|221572207|gb|ACM23019.1| ATP synthase C chain [Thermotoga neapolitana DSM 4359] Length = 87 Score = 33.7 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 19/87 (21%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Query: 6 MEAATFAAANGYYSLAAKYVAVGM-ACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKT 64 M+ + +L KY+ G+ +G + NI + R P T Sbjct: 1 MKMENLSDLAQGLALLGKYLGAGLCMGIGAIGPGIGEGNIGAHAMDAMARQPEMVGTITT 60 Query: 65 EVLIFAVIAESLGLFLLLVVMLLLFVI 91 +L+ +AE+ G++ LL+ ++L V+ Sbjct: 61 RMLLADAVAETTGIYSLLIAFMILLVV 87 >gi|289550276|ref|YP_003471180.1| ATP synthase C chain [Staphylococcus lugdunensis HKU09-01] gi|289179808|gb|ADC87053.1| ATP synthase C chain [Staphylococcus lugdunensis HKU09-01] Length = 70 Score = 33.7 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 L A +A+G++ LG + I + + G R P A + + I + E+L + Sbjct: 3 LIAAAIAIGLSALG---AGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPII 59 Query: 80 LLLVVMLLLF 89 +++ + LF Sbjct: 60 GVVIAFMTLF 69 >gi|195575263|ref|XP_002105599.1| GD16524 [Drosophila simulans] gi|194201526|gb|EDX15102.1| GD16524 [Drosophila simulans] Length = 115 Score = 33.7 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 29/70 (41%), Gaps = 23/70 (32%) Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80 AAK++ G A +G+ A + ++ ++E++GLF Sbjct: 68 AAKFIGAGAATIGVAGSAAVL-----------------------YAILGFALSEAMGLFC 104 Query: 81 LLVVMLLLFV 90 L++ LLLF Sbjct: 105 LMMAFLLLFA 114 >gi|11467780|ref|NP_050831.1| ATP synthase CF0 C subunit [Nephroselmis olivacea] gi|31562987|sp|Q9TL14|ATPH_NEPOL RecName: Full=ATP synthase subunit c, chloroplastic; AltName: Full=ATP synthase F(0) sector subunit c; AltName: Full=ATPase subunit III; AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c; AltName: Full=Lipid-binding protein gi|5880709|gb|AAD54802.1|AF137379_25 CF0 subunit III of ATP synthase [Nephroselmis olivacea] Length = 82 Score = 33.7 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 21 AAKYVAVGMAC-LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79 AA VA G+A L + + G R P A + +L+ E+L ++ Sbjct: 7 AASVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFMEALTIY 66 Query: 80 LLLVVMLLLFV 90 L+V + LLF Sbjct: 67 GLVVALALLFA 77 >gi|307729788|ref|YP_003907012.1| ATP synthase F0 subunit C [Burkholderia sp. CCGE1003] gi|307584323|gb|ADN57721.1| ATP synthase F0, C subunit [Burkholderia sp. CCGE1003] Length = 82 Score = 33.7 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 25/59 (42%) Query: 32 LGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 G A+A + R P +A + + + E++ ++ L++ +LLLF Sbjct: 19 FGAIGPAIAEGRAVAAAMDAIARQPDSAGTVSRTLFVGLAMIETMAIYCLVIALLLLFA 77 >gi|251799783|ref|YP_003014514.1| ATP synthase F0 C subunit [Paenibacillus sp. JDR-2] gi|247547409|gb|ACT04428.1| ATP synthase F0, C subunit [Paenibacillus sp. JDR-2] Length = 74 Score = 33.7 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 19/47 (40%) Query: 42 SNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLL 88 I + G R P +T + I + E+L + L++ + L Sbjct: 25 GLIVGRTVEGISRQPELRGTLQTTMFIGVALVEALPVITLVLAFIFL 71 >gi|116073692|ref|ZP_01470954.1| F0F1 ATP synthase subunit C [Synechococcus sp. RS9916] gi|116068997|gb|EAU74749.1| F0F1 ATP synthase subunit C [Synechococcus sp. RS9916] Length = 82 Score = 33.7 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 35 GLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVVMLLLFV 90 + + + G R P A + +L+ ESL ++ L+V ++LLF Sbjct: 22 IGPGIGQGSASQGAVEGIARQPEAEGKIRGTLLLSLAFMESLTIYGLVVALVLLFA 77 >gi|290969218|ref|ZP_06560743.1| ATP synthase F0, C subunit [Megasphaera genomosp. type_1 str. 28L] gi|290780724|gb|EFD93327.1| ATP synthase F0, C subunit [Megasphaera genomosp. type_1 str. 28L] Length = 85 Score = 33.7 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 3/66 (4%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + +G+A LG A+ N L G R P A +LI + E+L + +++ Sbjct: 16 IGMGLAALG---AAIGDGNAAAKMLEGTARQPEMAGKLFVNMLISVGLIEALPIIAVVIG 72 Query: 85 MLLLFV 90 ++L+F Sbjct: 73 IILVFA 78 >gi|19552430|ref|NP_600432.1| F0F1 ATP synthase subunit C [Corynebacterium glutamicum ATCC 13032] gi|62390095|ref|YP_225497.1| F0F1 ATP synthase subunit C [Corynebacterium glutamicum ATCC 13032] gi|145295346|ref|YP_001138167.1| F0F1 ATP synthase subunit C [Corynebacterium glutamicum R] gi|9757616|dbj|BAB08152.1| H+-ATPase c subunit [Corynebacterium glutamicum] gi|10039447|dbj|BAB13355.1| H+-ATPase c subunit [Brevibacterium flavum] gi|21323974|dbj|BAB98600.1| F0F1-type ATP synthase c subunit/Archaeal/vacuolar-type H+-ATPase subunit K [Corynebacterium glutamicum ATCC 13032] gi|41325431|emb|CAF19911.1| ATP SYNTHASE C CHAIN [Corynebacterium glutamicum ATCC 13032] gi|140845266|dbj|BAF54265.1| hypothetical protein [Corynebacterium glutamicum R] Length = 80 Score = 33.7 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 21/62 (33%) Query: 25 VAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFLLLVV 84 + + L + + L G R P A +T + + E+L L L+ Sbjct: 18 LGAVGYGIATIGPGLGIGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAG 77 Query: 85 ML 86 L Sbjct: 78 FL 79 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.326 0.156 0.443 Lambda K H 0.267 0.0467 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,787,302,233 Number of Sequences: 14124377 Number of extensions: 76841061 Number of successful extensions: 478535 Number of sequences better than 10.0: 3367 Number of HSP's better than 10.0 without gapping: 3002 Number of HSP's successfully gapped in prelim test: 1120 Number of HSP's that attempted gapping in prelim test: 474524 Number of HSP's gapped (non-prelim): 4584 length of query: 91 length of database: 4,842,793,630 effective HSP length: 61 effective length of query: 30 effective length of database: 3,981,206,633 effective search space: 119436198990 effective search space used: 119436198990 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 76 (33.7 bits)