RPSBLAST alignment of GI: 254781087 and protein with PDBid: 2xnd

>2xnd_J ATP synthase lipid-binding protein, mitochondrial; ATP phosphorylase (H+ transporting), ATP synthesis, F1FO ATP synthase, hydrolase, ION transport; HET: ANP; 3.50A {Bos taurus} Length = 72
 Score = 42.4 bits (100), Expect = 3e-05
 Identities = 20/69 (28%), Positives = 37/69 (53%)

Query: 21 AAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLFL 80
          AAK++  G A +G+      +  +F + + G  RNP       +  ++   ++E++GLF 
Sbjct: 4  AAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFC 63

Query: 81 LLVVMLLLF 89
          L+V  L+LF
Sbjct: 64 LMVAFLILF 72