RPSBLAST alignment of GI: 254781087 and protein with PDBid: 2xok

>2xok_K ATP synthase subunit 9, mitochondrial; hydrolase, ATP-binding, F(O), F(1), mitochondr inner membrane, transmembrane; HET: ANP; 3.01A {Saccharomyces cerevisiae} PDB: 2wpd_J* Length = 76
 Score = 41.9 bits (99), Expect = 4e-05
 Identities = 22/72 (30%), Positives = 40/72 (55%)

Query: 20 LAAKYVAVGMACLGMGLVALAVSNIFTTYLSGAFRNPCAASAHKTEVLIFAVIAESLGLF 79
          LAAKY+  G++ +G+    + ++ +F   ++G  RNP          ++   ++E+ GLF
Sbjct: 5  LAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLF 64

Query: 80 LLLVVMLLLFVI 91
           L+V  LLLF +
Sbjct: 65 CLMVSFLLLFGV 76