BLAST/PSIBLAST alignment of GI: 254781088 and GI: 23501286 at iteration 1
>gi|23501286|ref|NP_697413.1| F0F1 ATP synthase subunit A [Brucella suis 1330] Length = 249
>gi|62289372|ref|YP_221165.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 1 str. 9-941] Length = 249
>gi|82699297|ref|YP_413871.1| F0F1 ATP synthase subunit A [Brucella melitensis biovar Abortus 2308] Length = 249
>gi|161618358|ref|YP_001592245.1| F0F1 ATP synthase subunit A [Brucella canis ATCC 23365] Length = 249
>gi|163842666|ref|YP_001627070.1| F0F1 ATP synthase subunit A [Brucella suis ATCC 23445] Length = 249
>gi|189023625|ref|YP_001934393.1| F0F1 ATP synthase subunit A [Brucella abortus S19] Length = 249
>gi|225851922|ref|YP_002732155.1| F0F1 ATP synthase subunit A [Brucella melitensis ATCC 23457] Length = 249
>gi|254688687|ref|ZP_05151941.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 6 str. 870] Length = 249
>gi|254693170|ref|ZP_05154998.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 3 str. Tulya] Length = 249
>gi|254696814|ref|ZP_05158642.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 2 str. 86/8/59] Length = 249
>gi|254701194|ref|ZP_05163022.1| F0F1 ATP synthase subunit A [Brucella suis bv. 5 str. 513] Length = 249
>gi|254703739|ref|ZP_05165567.1| F0F1 ATP synthase subunit A [Brucella suis bv. 3 str. 686] Length = 249
>gi|254707881|ref|ZP_05169709.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis M163/99/10] Length = 249
>gi|254709535|ref|ZP_05171346.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis B2/94] Length = 249
>gi|254713048|ref|ZP_05174859.1| F0F1 ATP synthase subunit A [Brucella ceti M644/93/1] Length = 249
>gi|254716599|ref|ZP_05178410.1| F0F1 ATP synthase subunit A [Brucella ceti M13/05/1] Length = 249
>gi|254729721|ref|ZP_05188299.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 4 str. 292] Length = 249
>gi|256031029|ref|ZP_05444643.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis M292/94/1] Length = 249
>gi|256044104|ref|ZP_05447015.1| F0F1 ATP synthase subunit A [Brucella melitensis bv. 1 str. Rev.1] Length = 249
>gi|256112902|ref|ZP_05453818.1| F0F1 ATP synthase subunit A [Brucella melitensis bv. 3 str. Ether] Length = 249
>gi|256159087|ref|ZP_05456913.1| F0F1 ATP synthase subunit A [Brucella ceti M490/95/1] Length = 249
>gi|256254432|ref|ZP_05459968.1| F0F1 ATP synthase subunit A [Brucella ceti B1/94] Length = 249
>gi|256256934|ref|ZP_05462470.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 9 str. C68] Length = 249
>gi|256264566|ref|ZP_05467098.1| ATP synthase subunit A [Brucella melitensis bv. 2 str. 63/9] Length = 249
>gi|256368838|ref|YP_003106344.1| ATP synthase subunit A [Brucella microti CCM 4915] Length = 249
>gi|260168161|ref|ZP_05754972.1| F0F1 ATP synthase subunit A [Brucella sp. F5/99] Length = 249
>gi|260754163|ref|ZP_05866511.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 6 str. 870] Length = 249
>gi|260757383|ref|ZP_05869731.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 4 str. 292] Length = 249
>gi|260761207|ref|ZP_05873550.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 2 str. 86/8/59] Length = 249
>gi|260883188|ref|ZP_05894802.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 9 str. C68] Length = 249
>gi|261213410|ref|ZP_05927691.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 3 str. Tulya] Length = 249
>gi|261218398|ref|ZP_05932679.1| F0F1 ATP synthase subunit A [Brucella ceti M13/05/1] Length = 249
>gi|261221600|ref|ZP_05935881.1| F0F1 ATP synthase subunit A [Brucella ceti B1/94] Length = 249
>gi|261315372|ref|ZP_05954569.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis M163/99/10] Length = 249
>gi|261317061|ref|ZP_05956258.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis B2/94] Length = 249
>gi|261320753|ref|ZP_05959950.1| F0F1 ATP synthase subunit A [Brucella ceti M644/93/1] Length = 249
>gi|261751731|ref|ZP_05995440.1| F0F1 ATP synthase subunit A [Brucella suis bv. 5 str. 513] Length = 249
>gi|261754384|ref|ZP_05998093.1| F0F1 ATP synthase subunit A [Brucella suis bv. 3 str. 686] Length = 249
>gi|265988099|ref|ZP_06100656.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis M292/94/1] Length = 249
>gi|265990516|ref|ZP_06103073.1| F0F1 ATP synthase subunit A [Brucella melitensis bv. 1 str. Rev.1] Length = 249
>gi|265994344|ref|ZP_06106901.1| F0F1 ATP synthase subunit A [Brucella melitensis bv. 3 str. Ether] Length = 249
>gi|265997564|ref|ZP_06110121.1| F0F1 ATP synthase subunit A [Brucella ceti M490/95/1] Length = 249
>gi|297247785|ref|ZP_06931503.1| ATP synthase F0, A subunit [Brucella abortus bv. 5 str. B3196] Length = 249
>gi|75497286|sp|Q57EY0|ATP6_BRUAB RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|81753125|sp|Q8G2E1|ATP6_BRUSU RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|123754508|sp|Q2YM92|ATP6_BRUA2 RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|223634830|sp|B2S9M8|ATP6_BRUA1 RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|223634831|sp|A9M8F8|ATP6_BRUC2 RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|223634834|sp|B0CK70|ATP6_BRUSI RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|223634839|sp|Q8YFH6|ATP6_BRUME RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|254807647|sp|C0RH93|ATP6_BRUMB RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 Length = 249
>gi|23347174|gb|AAN29328.1| ATP synthase F0, A subunit [Brucella suis 1330] Length = 249
>gi|62195504|gb|AAX73804.1| AtpB, ATP synthase F0, A subunit [Brucella abortus bv. 1 str. 9-941] Length = 249
>gi|82615398|emb|CAJ10367.1| H+-transporting two-sector ATPase, A subunit [Brucella melitensis biovar Abortus 2308] Length = 249
>gi|161335169|gb|ABX61474.1| ATP synthase F0, A subunit [Brucella canis ATCC 23365] Length = 249
>gi|163673389|gb|ABY37500.1| ATP synthase F0, A subunit [Brucella suis ATCC 23445] Length = 249
>gi|189019197|gb|ACD71919.1| ATP synthase subunit A [Brucella abortus S19] Length = 249
>gi|225640287|gb|ACO00201.1| ATP synthase F0, A subunit [Brucella melitensis ATCC 23457] Length = 249
>gi|255998996|gb|ACU47395.1| ATP synthase subunit A [Brucella microti CCM 4915] Length = 249
>gi|260667701|gb|EEX54641.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 4 str. 292] Length = 249
>gi|260671639|gb|EEX58460.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 2 str. 86/8/59] Length = 249
>gi|260674271|gb|EEX61092.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 6 str. 870] Length = 249
>gi|260872716|gb|EEX79785.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 9 str. C68] Length = 249
>gi|260915017|gb|EEX81878.1| F0F1 ATP synthase subunit A [Brucella abortus bv. 3 str. Tulya] Length = 249
>gi|260920184|gb|EEX86837.1| F0F1 ATP synthase subunit A [Brucella ceti B1/94] Length = 249
>gi|260923487|gb|EEX90055.1| F0F1 ATP synthase subunit A [Brucella ceti M13/05/1] Length = 249
>gi|261293443|gb|EEX96939.1| F0F1 ATP synthase subunit A [Brucella ceti M644/93/1] Length = 249
>gi|261296284|gb|EEX99780.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis B2/94] Length = 249
>gi|261304398|gb|EEY07895.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis M163/99/10] Length = 249
>gi|261741484|gb|EEY29410.1| F0F1 ATP synthase subunit A [Brucella suis bv. 5 str. 513] Length = 249
>gi|261744137|gb|EEY32063.1| F0F1 ATP synthase subunit A [Brucella suis bv. 3 str. 686] Length = 249
>gi|262552032|gb|EEZ08022.1| F0F1 ATP synthase subunit A [Brucella ceti M490/95/1] Length = 249
>gi|262765457|gb|EEZ11246.1| F0F1 ATP synthase subunit A [Brucella melitensis bv. 3 str. Ether] Length = 249
>gi|263001300|gb|EEZ13875.1| F0F1 ATP synthase subunit A [Brucella melitensis bv. 1 str. Rev.1] Length = 249
>gi|263094931|gb|EEZ18639.1| ATP synthase subunit A [Brucella melitensis bv. 2 str. 63/9] Length = 249
>gi|264660296|gb|EEZ30557.1| F0F1 ATP synthase subunit A [Brucella pinnipedialis M292/94/1] Length = 249
>gi|297174954|gb|EFH34301.1| ATP synthase F0, A subunit [Brucella abortus bv. 5 str. B3196] Length = 249
>gi|326408421|gb|ADZ65486.1| ATP synthase subunit A [Brucella melitensis M28] Length = 249
>gi|326538135|gb|ADZ86350.1| ATP synthase F0, A subunit [Brucella melitensis M5-90] Length = 249
 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 176/249 (70%)

Query: 1   MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS 60
           M+  P+ QF V + +PI V G DLSFTN S  M+ ++++   F +   S   ++PTRLQS
Sbjct: 1   MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS 60

Query: 61  FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF 120
             E+ Y+F+ ++L DSAG++   FFPFVFSLF+F+  AN +GL PY ++ TSQI+VT + 
Sbjct: 61  VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL 120

Query: 121 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180
           SLLV+ +V+  GF+ +G GFL+LF+P  +P +I PLV  IE+ SFL RP+SLS+RLFANM
Sbjct: 121 SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM 180

Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240
           LAGH+ LKVFAGF  S+ S+G LGI  + LP+L  VA+T LEF VAF+QAY+F VL C+Y
Sbjct: 181 LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY 240

Query: 241 IGDVYRSDQ 249
           I D      
Sbjct: 241 INDAVHPGH 249