BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781088|ref|YP_003065501.1| F0F1 ATP synthase subunit A [Candidatus Liberibacter asiaticus str. psy62] (250 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781088|ref|YP_003065501.1| F0F1 ATP synthase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 250 Score = 488 bits (1255), Expect = e-140, Method: Compositional matrix adjust. Identities = 250/250 (100%), Positives = 250/250 (100%) Query: 1 MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS 60 MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS Sbjct: 1 MSKSPMSQFIVQKIVPIQVQGFDLSFTNSSLAMLVSLLVIFIFAFFAVSNCRVVPTRLQS 60 Query: 61 FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF 120 FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF Sbjct: 61 FFEIIYQFIMSTLCDSAGNQSKNFFPFVFSLFVFLTTANLLGLHPYLFSFTSQIVVTTSF 120 Query: 121 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM Sbjct: 121 SLLVVLSVVISGFYVNGLGFLRLFIPKDIPLLIKPLVCFIEVSSFLFRPVSLSLRLFANM 180 Query: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY Sbjct: 181 LAGHLMLKVFAGFSTSMMSIGMLGIAFSFLPVLANVAVTGLEFFVAFMQAYIFMVLACVY 240 Query: 241 IGDVYRSDQH 250 IGDVYRSDQH Sbjct: 241 IGDVYRSDQH 250 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 26.2 bits (56), Expect = 0.56, Method: Compositional matrix adjust. Identities = 8/11 (72%), Positives = 10/11 (90%) Query: 240 YIGDVYRSDQH 250 YIGD++RS QH Sbjct: 290 YIGDIHRSGQH 300 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 25.8 bits (55), Expect = 0.66, Method: Compositional matrix adjust. Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Query: 125 VLSVVISGFYVNGLGFLRLFIP-KDIPLLIKPLVCFIEVSSFLFRPVS 171 V+ I+GFYVNG + ++P LL K IE+SS RPV+ Sbjct: 45 VIGTHITGFYVNGESSFQTYMPLVGSKLLDKLQSKDIEISS---RPVN 89 >gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Score = 25.4 bits (54), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Query: 144 FIPKDIPLLI--KPLVCFIEVSSFLF 167 FIPK+IP L+ KP V F S L+ Sbjct: 79 FIPKNIPCLLSDKPEVSFAIAGSILY 104 >gi|254780473|ref|YP_003064886.1| cytochrome O ubiquinol oxidase subunit I [Candidatus Liberibacter asiaticus str. psy62] Length = 671 Score = 22.7 bits (47), Expect = 6.3, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Query: 5 PMSQFIVQKIVPIQVQGFDLSF---TNSSLAMLVSLLVIFIFAFF 46 PM I+ +VP+Q+ D+SF N S M V+ V+ + + F Sbjct: 127 PMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLF 171 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.336 0.145 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 142,181 Number of Sequences: 1233 Number of extensions: 5440 Number of successful extensions: 31 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 23 Number of HSP's gapped (non-prelim): 12 length of query: 250 length of database: 328,796 effective HSP length: 72 effective length of query: 178 effective length of database: 240,020 effective search space: 42723560 effective search space used: 42723560 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 37 (18.9 bits)