RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >gnl|CDD|30768 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]. Length = 908 Score = 30.4 bits (68), Expect = 0.11 Identities = 7/17 (41%), Positives = 14/17 (82%), Gaps = 2/17 (11%) Query: 6 SGKTTLLEAIF--LFGE 20 +GK+++L+AI L+G+ Sbjct: 36 AGKSSILDAITFALYGK 52 >gnl|CDD|31388 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]. Length = 363 Score = 30.2 bits (68), Expect = 0.12 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 2 GLSESGKTTLLEAIFLFGEALALALSND 29 G + GKT LLEAI+L + S D Sbjct: 30 GENGQGKTNLLEAIYLLALGRSHRTSRD 57 >gnl|CDD|133369 cd04169, RF3, RF3 subfamily. Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria. Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide. The class II release factor RF3 then initiates the release of the class I RF from the ribosome. RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state. GDP/GTP exchange occurs, followed by the release of the class I RF. Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome. RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts. Length = 267 Score = 28.3 bits (64), Expect = 0.46 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 7 GKTTLLEAIFLFGEALALA 25 GKTTL E + LFG A+ A Sbjct: 14 GKTTLTEKLLLFGGAIREA 32 >gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in macrophages, hepatocytes, and intestinal mucosa cells. ABCG1 (ABC8), the human homolog of the Drosophila white gene is induced in monocyte-derived macrophages during cholesterol influx mediated by acetylated low-density lipoprotein. It is possible that human ABCG1 forms heterodimers with several heterologous partners.. Length = 226 Score = 28.3 bits (63), Expect = 0.54 Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 14/54 (25%) Query: 1 MGLSESGKTTLLEAI--------------FLFGEALALALSNDPVSVFLKSDVF 40 +G S SGKTTLL+AI G+ V+ + D+ Sbjct: 39 LGSSGSGKTTLLDAISGRVEGGGTTSGQILFNGQPRKPDQFQKCVAYVRQDDIL 92 >gnl|CDD|33865 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]. Length = 528 Score = 27.9 bits (62), Expect = 0.66 Identities = 11/21 (52%), Positives = 15/21 (71%) Query: 5 ESGKTTLLEAIFLFGEALALA 25 ++GKTTL E + LFG A+ A Sbjct: 22 DAGKTTLTEKLLLFGGAIQEA 42 >gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism]. Length = 613 Score = 27.6 bits (61), Expect = 0.85 Identities = 11/16 (68%), Positives = 12/16 (75%) Query: 1 MGLSESGKTTLLEAIF 16 MG S SGKTTLL A+ Sbjct: 62 MGPSGSGKTTLLNALA 77 >gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains only bacterial members. Length = 268 Score = 27.1 bits (61), Expect = 1.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGKTTL EA+ Sbjct: 5 VGHSGSGKTTLAEAL 19 >gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]. Length = 386 Score = 26.9 bits (59), Expect = 1.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 MGLS SGK+TL+ + Sbjct: 60 MGLSGSGKSTLVRLL 74 >gnl|CDD|48380 cd03116, MobB, Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.. Length = 159 Score = 26.7 bits (59), Expect = 1.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Query: 2 GLSESGKTTLLEAI 15 G S SGKTTLLE + Sbjct: 8 GYSGSGKTTLLEKL 21 >gnl|CDD|72999 cd03240, ABC_Rad50, The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.. Length = 204 Score = 26.3 bits (58), Expect = 1.8 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Query: 2 GLSESGKTTLLEAIF--LFGEA 21 G + +GKTT++EA+ L GE Sbjct: 29 GQNGAGKTTIIEALKYALTGEL 50 >gnl|CDD|30194 cd02021, GntK, Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.. Length = 150 Score = 26.4 bits (58), Expect = 1.9 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 11/40 (27%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVF 40 MG+S SGK+T+ G+ALA L + F+ D Sbjct: 5 MGVSGSGKSTV-------GKALAERLG----APFIDGDDL 33 >gnl|CDD|145545 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination. Length = 1162 Score = 26.1 bits (57), Expect = 2.0 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Query: 6 SGKTTLLEAI-FLFGEALALAL 26 SGK+ +L+AI F+ GE A +L Sbjct: 34 SGKSNILDAILFVLGERSAKSL 55 >gnl|CDD|99964 cd03789, GT1_LPS_heptosyltransferase, Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.. Length = 279 Score = 26.1 bits (58), Expect = 2.1 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Query: 7 GKTTLLEAIFLFGEALALALSND 29 GKT+L E L A L ++ND Sbjct: 185 GKTSLRELAALLARA-DLVVTND 206 >gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 269 Score = 25.9 bits (57), Expect = 2.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 MGLS SGK+TLL I Sbjct: 56 MGLSGSGKSTLLRCI 70 >gnl|CDD|35745 KOG0525, KOG0525, KOG0525, Branched chain alpha-keto acid dehydrogenase E1, beta subunit [Energy production and conversion]. Length = 362 Score = 26.1 bits (57), Expect = 2.4 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 4 SESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDV-FDGI 43 E+G+ + +AL +AL DP +V DV F G+ Sbjct: 33 LEAGEKKKMNLYQSVNQALHIALETDPRAVVFGEDVAFGGV 73 >gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.. Length = 194 Score = 25.9 bits (57), Expect = 2.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 MG S +GK+TLL A+ Sbjct: 41 MGPSGAGKSTLLNAL 55 >gnl|CDD|133360 cd04160, Arfrp1, Arfrp1 subfamily. Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development. Length = 167 Score = 25.7 bits (57), Expect = 2.7 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +GL +GKTT LE + Sbjct: 5 LGLDNAGKTTFLEQL 19 >gnl|CDD|31949 COG1763, MobB, Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]. Length = 161 Score = 25.3 bits (55), Expect = 3.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 2 GLSESGKTTLLEAI 15 G SGKTTL+E + Sbjct: 9 GYKNSGKTTLIEKL 22 >gnl|CDD|73038 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.. Length = 213 Score = 25.2 bits (55), Expect = 3.7 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Query: 6 SGKTTLLEAIF--LFGEALALALSNDPVSVF 34 +GK+T+L+AI L+G+ + SVF Sbjct: 39 AGKSTILDAITYALYGKTPRYGRQENLRSVF 69 >gnl|CDD|147030 pfam04670, Gtr1_RagA, Gtr1/RagA G protein conserved region. GTR1 was first identified in S. cerevisiae as a suppressor of a mutation in RCC1. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1. Included in this family is the human Rag C, a novel protein that has been shown to interact with RagA/B. Length = 230 Score = 25.2 bits (56), Expect = 4.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 1 MGLSESGKTTLLEAIF 16 MGL SGK+++ IF Sbjct: 5 MGLRGSGKSSMRSIIF 20 >gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.. Length = 157 Score = 24.9 bits (54), Expect = 4.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G + SGK+TLL AI Sbjct: 31 VGPNGSGKSTLLRAIAGL 48 >gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]. Length = 226 Score = 24.7 bits (54), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGK+TLL + Sbjct: 37 VGPSGSGKSTLLNLL 51 >gnl|CDD|31303 COG1106, COG1106, Predicted ATPases [General function prediction only]. Length = 371 Score = 24.6 bits (53), Expect = 5.8 Identities = 12/57 (21%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Query: 2 GLSESGKTTLLEAIFLFGEAL-ALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKV 57 G + +GK+ LLEA++ + + S P I YG + + Sbjct: 29 GANGAGKSNLLEALYFLKGLISPGSESPIPFE------REINIWNGSYGKEESNLDI 79 >gnl|CDD|33393 COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair]. Length = 581 Score = 24.5 bits (53), Expect = 6.0 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Query: 2 GLSESGKTTLLEAIFLFGEALALALSNDPVS-VFLKSDVFDGISK 45 G + SGK++LL +AL L L + F D IS+ Sbjct: 30 GENNSGKSSLL-------DALRLLLDPESDLYSFTLDDFHFPISE 67 >gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.. Length = 218 Score = 24.7 bits (54), Expect = 6.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGK+TLL + Sbjct: 36 VGPSGSGKSTLLNIL 50 >gnl|CDD|37962 KOG2751, KOG2751, KOG2751, Beclin-like protein [Signal transduction mechanisms]. Length = 447 Score = 24.6 bits (53), Expect = 6.7 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 53 GKIKVDAQFILSEKMDIPHVFLPMVHFP 80 I +D + S++MDI + LP+ P Sbjct: 23 QPIHLDNSLLGSDRMDISELVLPLHKPP 50 >gnl|CDD|35296 KOG0073, KOG0073, KOG0073, GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport, Cytoskeleton]. Length = 185 Score = 24.5 bits (53), Expect = 7.0 Identities = 7/15 (46%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 +GL SGKTT+++ + Sbjct: 22 LGLDNSGKTTIVKKL 36 >gnl|CDD|29996 cd01130, VirB11-like_ATPase, Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.. Length = 186 Score = 24.4 bits (53), Expect = 7.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 1 MGLSESGKTTLLEAIFLF 18 G + SGKTTLL A+ F Sbjct: 31 SGGTGSGKTTLLNALLAF 48 >gnl|CDD|145956 pfam03081, Exo70, Exo70 exocyst complex subunit. The Exo70 protein forms one subunit of the exocyst complex. First discovered in S. cerevisiae, Exo70 and other exocyst proteins have been observed in several other eukaryotes, including humans. In S. cerevisiae, the exocyst complex is involved in the late stages of exocytosis, and is localized at the tip of the bud, the major site of exocytosis in yeast. Exo70 interacts with the Rho3 GTPase. This interaction mediates one of the three known functions of Rho3 in cell polarity: vesicle docking and fusion with the plasma membrane (the other two functions are regulation of actin polarity and transport of exocytic vesicles from the mother cell to the bud). In humans, the functions of Exo70 and the exocyst complex are less well characterized: Exo70 is expressed in several tissues and is thought to also be involved in exocytosis. Length = 356 Score = 24.2 bits (53), Expect = 7.0 Identities = 9/35 (25%), Positives = 18/35 (51%) Query: 12 LEAIFLFGEALALALSNDPVSVFLKSDVFDGISKN 46 + + FGEA+A P +F D+++ +S+ Sbjct: 40 ILQLLNFGEAVASKNKRSPEKLFELLDMYEALSEL 74 >gnl|CDD|111395 pfam02492, cobW, CobW/HypB/UreG, nucleotide-binding domain. This domain is found in HypB, a hydrogenase expression / formation protein, and UreG a urease accessory protein. Both these proteins contain a P-loop nucleotide binding motif. HypB has GTPase activity and is a guanine nucleotide binding protein. It is not known whether UreG binds GTP or some other nucleotide. Both enzymes are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression. UreG is required for functional incorporation of the urease nickel metallocenter. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins. This family of domains also contains P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, and the cobW gene product, which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans. Length = 174 Score = 24.5 bits (54), Expect = 7.1 Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 6 SGKTTLLEAI 15 SGKTTLLE + Sbjct: 11 SGKTTLLEHL 20 >gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]. Length = 352 Score = 24.1 bits (52), Expect = 8.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTTLL I Sbjct: 37 LGPSGCGKTTLLRMI 51 >gnl|CDD|133305 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta). SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane. Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP. SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane. The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane. SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon. High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this type of cancer. Length = 203 Score = 24.2 bits (53), Expect = 8.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 2 GLSESGKTTLL 12 G S+SGKT L Sbjct: 7 GPSDSGKTALF 17 >gnl|CDD|33076 COG3265, GntK, Gluconate kinase [Carbohydrate transport and metabolism]. Length = 161 Score = 24.1 bits (52), Expect = 8.3 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 7/27 (25%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALS 27 MG+S SGK+T+ G ALA L Sbjct: 1 MGVSGSGKSTV-------GSALAERLG 20 >gnl|CDD|30200 cd02027, APSK, Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.. Length = 149 Score = 24.3 bits (53), Expect = 8.4 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 10/51 (19%) Query: 2 GLSESGKTTLLEAIFLFGEALALALSND--PVSVFLKSDVFDGISKNQYGF 50 GLS SGK+T+ AL L PV V +V G++K+ GF Sbjct: 6 GLSGSGKSTI-------ARALEEKLFQRGRPVYVLDGDNVRHGLNKD-LGF 48 >gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]. Length = 1391 Score = 24.1 bits (52), Expect = 8.9 Identities = 9/12 (75%), Positives = 10/12 (83%) Query: 1 MGLSESGKTTLL 12 MG S +GKTTLL Sbjct: 823 MGESGAGKTTLL 834 >gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]. Length = 338 Score = 24.1 bits (52), Expect = 9.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S GK+TLL I Sbjct: 35 LGPSGCGKSTLLRMI 49 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.142 0.407 Gapped Lambda K H 0.267 0.0787 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 947,497 Number of extensions: 41968 Number of successful extensions: 308 Number of sequences better than 10.0: 1 Number of HSP's gapped: 308 Number of HSP's successfully gapped: 61 Length of query: 80 Length of database: 6,263,737 Length adjustment: 50 Effective length of query: 30 Effective length of database: 5,183,287 Effective search space: 155498610 Effective search space used: 155498610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.3 bits)