RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 32.2 bits (73), Expect = 0.031 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 17/67 (25%) Query: 20 EALALALSNDPVSVFLKSDVFDGISKNQYGFFTG--KIKVDA---Q----FILSE-KMDI 69 + + ++L N ++ V G ++ YG K K + Q F SE K+ Sbjct: 364 KQVEISLVNGAKNL-----VVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPF--SERKLKF 416 Query: 70 PHVFLPM 76 + FLP+ Sbjct: 417 SNRFLPV 423 Score = 26.8 bits (59), Expect = 1.3 Identities = 16/79 (20%), Positives = 29/79 (36%), Gaps = 6/79 (7%) Query: 3 LSESGKTTLLEAIFLFGEAL-ALALSNDPVSVFLKSDVFDGISKNQ---YGFFTGKIKVD 58 L + TTL++ L + A ++ P S +F + + F G+ D Sbjct: 108 LLQENDTTLVKTKELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTD 167 Query: 59 AQFILSEKMDIPHVFLPMV 77 F E D+ + +V Sbjct: 168 DYF--EELRDLYQTYHVLV 184 >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 Score = 29.7 bits (65), Expect = 0.15 Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 6 SGKTTLLEAIFLFG 19 +GKT LLEA +L Sbjct: 37 AGKTNLLEAAYLAL 50 >2f4p_A Hypothetical protein TM1010; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: UNL; 1.90A {Thermotoga maritima MSB8} SCOP: b.82.1.9 Length = 147 Score = 29.2 bits (65), Expect = 0.25 Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 37 SDVFDGISKNQYGFFTGKIKVDAQFILSEKMDIPHVFLPMVHFP 80 D+F+ SK FFTG + V +++++ + + + V F Sbjct: 15 DDIFERGSKGSSDFFTGNVWVKM--LVTDENGVFNTQVYDVVFE 56 >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322 Score = 28.6 bits (62), Expect = 0.33 Identities = 9/20 (45%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Query: 2 GLSESGKTTLLEAI-FLFGE 20 G + SGK+ +++AI ++FGE Sbjct: 31 GPNGSGKSNIIDAIKWVFGE 50 >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Length = 171 Score = 27.8 bits (60), Expect = 0.66 Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 +G S+SGKTTL+ + Sbjct: 8 VGTSDSGKTTLITRM 22 >2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, ketoacid dehydrogenase, branched-chain, multi- enzyme complex, acylation; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Length = 342 Score = 27.6 bits (60), Expect = 0.73 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Query: 4 SESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDG 42 ++ K L +++ AL +L+ DP +V DV G Sbjct: 16 GQTQKMNLFQSV---TSALDNSLAKDPTAVIFGEDVAFG 51 >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural genomics, PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Length = 169 Score = 27.2 bits (59), Expect = 0.95 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G SGKTTL+E Sbjct: 10 VGYKHSGKTTLMEKW 24 >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A Length = 529 Score = 27.2 bits (59), Expect = 0.99 Identities = 10/25 (40%), Positives = 17/25 (68%) Query: 1 MGLSESGKTTLLEAIFLFGEALALA 25 + ++GKTT+ E + LFG+A+ A Sbjct: 19 ISHPDAGKTTITEKVLLFGQAIQTA 43 >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173 Score = 26.8 bits (58), Expect = 1.1 Identities = 8/51 (15%), Positives = 13/51 (25%), Gaps = 11/51 (21%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFF 51 G K+T+ L+ L +K F+ F Sbjct: 7 EGPDCCFKSTV-------AAKLSKELKYP----IIKGSSFELAKSGNEKLF 46 >2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Length = 341 Score = 26.8 bits (58), Expect = 1.2 Identities = 11/46 (23%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Query: 8 KTTLLEAIFLFGEALALALSNDPVSVFLKSDV--FDGISKNQYGFF 51 + T+ +AI + + L D L +V +DG K G + Sbjct: 14 QVTVRDAI---NQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLW 56 >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, non-SMC subunit, ABC-type ATPase, WHD, ATP; HET: ATG; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Length = 483 Score = 26.8 bits (58), Expect = 1.2 Identities = 4/20 (20%), Positives = 8/20 (40%), Gaps = 1/20 (5%) Query: 2 GLSESGKTTLLEAI-FLFGE 20 G + +GK+T + Sbjct: 36 GGNGAGKSTTMAGFVTALIP 55 >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.40A {Bacillus halodurans c-125} SCOP: c.37.1.25 Length = 189 Score = 26.5 bits (57), Expect = 1.3 Identities = 11/62 (17%), Positives = 22/62 (35%), Gaps = 10/62 (16%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 G + GK+T + LA L S +++ D+ + + Y ++ A Sbjct: 8 TGPAGVGKSTT-------CKRLAAQL---DNSAYIEGDIINHMVVGGYRPPWESDELLAL 57 Query: 61 FI 62 Sbjct: 58 TW 59 >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Length = 227 Score = 26.2 bits (56), Expect = 1.7 Identities = 10/69 (14%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Query: 2 GLSESGKTTLLEAI-FLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 G + +GK+T + A L L + S D + +D Sbjct: 34 GGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTI 93 Query: 61 FILSEKMDI 69 +++ + Sbjct: 94 NSRHQRVVV 102 >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Length = 630 Score = 26.0 bits (57), Expect = 2.0 Identities = 12/41 (29%), Positives = 15/41 (36%), Gaps = 11/41 (26%) Query: 2 GLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDG 42 GLS +GKTT+ AL L + DG Sbjct: 59 GLSGAGKTTV-------SMALEEYLV----CHGIPCYTLDG 88 >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Score = 26.0 bits (57), Expect = 2.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTTLL + Sbjct: 36 IGASGCGKTTLLRCL 50 >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleotide binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Score = 26.2 bits (56), Expect = 2.1 Identities = 11/73 (15%), Positives = 20/73 (27%), Gaps = 9/73 (12%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 G S +GK+ + L + D + G I+ DA Sbjct: 9 NGGSSAGKSGI---------VRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDAD 59 Query: 61 FILSEKMDIPHVF 73 +S + + Sbjct: 60 GGVSIGPEFRALE 72 >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Score = 26.1 bits (57), Expect = 2.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 GL+ +GKTTLL + Sbjct: 53 YGLNGAGKTTLLNIL 67 >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Score = 26.0 bits (57), Expect = 2.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +GL +GKTT+L + Sbjct: 171 VGLDAAGKTTILYKL 185 >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Score = 25.8 bits (55), Expect = 2.2 Identities = 10/33 (30%), Positives = 12/33 (36%), Gaps = 7/33 (21%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSV 33 G SGK+T+ EALA V Sbjct: 15 SGHPGSGKSTI-------AEALANLPGVPKVHF 40 >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Score = 25.8 bits (56), Expect = 2.2 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GK+ LE I Sbjct: 30 LGPTGAGKSVFLELI 44 >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Score = 26.0 bits (57), Expect = 2.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGK+TLL I Sbjct: 35 LGPSGSGKSTLLYTI 49 >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Score = 26.0 bits (56), Expect = 2.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G SGKT+LL + Sbjct: 18 AGPQNSGKTSLLTLL 32 >2awn_A Maltose/maltodextrin import ATP-binding protein MALK; ATP-binding cassette, transport protein; HET: ADP; 2.30A {Escherichia coli K12} SCOP: b.40.6.3 c.37.1.12 PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 2r6g_A* 1q1b_A Length = 381 Score = 26.0 bits (57), Expect = 2.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S GK+TLL I Sbjct: 35 VGPSGCGKSTLLRMI 49 >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427 Score = 25.7 bits (55), Expect = 2.4 Identities = 6/16 (37%), Positives = 12/16 (75%) Query: 1 MGLSESGKTTLLEAIF 16 +G + GK+TL++ +F Sbjct: 48 VGETGLGKSTLMDTLF 63 >2wsm_A Hydrogenase expression/formation protein (HYPB); hydrogenase maturation factor, metal binding protein; 2.30A {Archaeoglobus fulgidus} Length = 221 Score = 25.7 bits (55), Expect = 2.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 MG SGKT L+E Sbjct: 36 MGAIGSGKTLLIERT 50 >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} Length = 607 Score = 25.8 bits (56), Expect = 2.5 Identities = 5/16 (31%), Positives = 10/16 (62%) Query: 1 MGLSESGKTTLLEAIF 16 +G + GKTT ++ + Sbjct: 388 VGPNGIGKTTFVKMLA 403 Score = 24.6 bits (53), Expect = 5.4 Identities = 5/15 (33%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GKTT ++ + Sbjct: 123 VGPNGTGKTTAVKIL 137 >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Aeropyrum pernix K1} Length = 186 Score = 25.8 bits (55), Expect = 2.6 Identities = 14/75 (18%), Positives = 23/75 (30%), Gaps = 11/75 (14%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 GL SGKTT+ LA L + + +V DG + + Sbjct: 19 TGLPGSGKTTI-------ATRLADLLQKE----GYRVEVLDGDWARTTVSEGAGFTREER 67 Query: 61 FILSEKMDIPHVFLP 75 +++ L Sbjct: 68 LRHLKRIAWIARLLA 82 >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, ABC ATPase, dimer, kleisin, mitosis, cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Score = 25.5 bits (54), Expect = 2.7 Identities = 7/16 (43%), Positives = 12/16 (75%), Gaps = 1/16 (6%) Query: 6 SGKTTLLEAI-FLFGE 20 SGK+ +++AI F+ G Sbjct: 37 SGKSNMMDAISFVLGV 52 >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Score = 25.5 bits (56), Expect = 2.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGKTT+L I Sbjct: 47 LGPSGSGKTTILRLI 61 >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Score = 25.5 bits (56), Expect = 2.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S +GKTT + I Sbjct: 37 LGPSGAGKTTFMRII 51 >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Score = 25.7 bits (55), Expect = 2.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +GL +SGKT L + Sbjct: 13 VGLCDSGKTLLFVRL 27 >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Score = 25.4 bits (54), Expect = 2.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +GL SGKTT++ + Sbjct: 27 LGLDNSGKTTIINKL 41 >1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Length = 324 Score = 25.5 bits (55), Expect = 3.0 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Query: 8 KTTLLEAIFLFGEALALALSNDPVSVFLKSDV 39 + T+++AI +AL + L NDP + DV Sbjct: 2 QMTMVQAI---TDALRIELKNDPNVLIFGEDV 30 >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Length = 174 Score = 25.7 bits (56), Expect = 3.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 2 GLSESGKTTLLEAI 15 S +GKTTLL+ + Sbjct: 13 AWSGTGKTTLLKKL 26 >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Score = 25.5 bits (55), Expect = 3.1 Identities = 4/15 (26%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 + + GK+TL +++ Sbjct: 25 IAHVDHGKSTLTDSL 39 >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, hydrolase; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 Score = 25.3 bits (54), Expect = 3.2 Identities = 10/41 (24%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Query: 1 MGLSESGKTTLLEAI--FLFGEALALALSNDPVSVFLKSDV 39 +G + SGKTTL +L ++ D L + Sbjct: 20 VGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEP 60 >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Length = 175 Score = 25.3 bits (54), Expect = 3.2 Identities = 8/26 (30%), Positives = 12/26 (46%), Gaps = 7/26 (26%) Query: 1 MGLSESGKTTLLEAIFLFGEALALAL 26 MG+S SGK+ + +A L Sbjct: 14 MGVSGSGKSAV-------ASEVAHQL 32 >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Score = 25.5 bits (55), Expect = 3.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 1 MGLSESGKTTLLEAIF 16 MGL SGK+++ + +F Sbjct: 26 MGLRRSGKSSIQKVVF 41 >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Length = 178 Score = 25.3 bits (54), Expect = 3.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G GKTTL++ I Sbjct: 6 TGEPGVGKTTLVKKI 20 >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Score = 25.2 bits (55), Expect = 3.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGK+T L I Sbjct: 38 IGSSGSGKSTFLRCI 52 >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Score = 25.1 bits (55), Expect = 3.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GKTT L AI Sbjct: 38 IGANGAGKTTTLSAI 52 >2qn6_A Translation initiation factor 2 gamma subunit; initiation of translation, GTP-binding, nucleotide-binding, protein biosynthesis; HET: GDP; 2.15A {Sulfolobus solfataricus P2} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2aho_A 2qmu_A* 2plf_A* 2pmd_A* 3cw2_A Length = 414 Score = 25.4 bits (54), Expect = 3.5 Identities = 7/10 (70%), Positives = 9/10 (90%) Query: 6 SGKTTLLEAI 15 GKTTL++AI Sbjct: 19 HGKTTLVQAI 28 >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Score = 25.2 bits (55), Expect = 3.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G S SGK+TL + I F Sbjct: 41 VGRSGSGKSTLTKLIQRF 58 >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Score = 25.2 bits (55), Expect = 3.6 Identities = 5/18 (27%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G + SGK+T+ + Sbjct: 51 VGPNGSGKSTVAALLQNL 68 >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Score = 25.3 bits (55), Expect = 3.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + SGK+TL+ I Sbjct: 39 IGPNGSGKSTLINVI 53 >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) class, TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima MSB8} Length = 359 Score = 25.3 bits (55), Expect = 3.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTT L + Sbjct: 35 LGPSGCGKTTTLLML 49 >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Score = 25.2 bits (55), Expect = 3.7 Identities = 6/18 (33%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G GK++LL A+ Sbjct: 37 VGQVGCGKSSLLSALLAE 54 >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Score = 25.2 bits (54), Expect = 3.8 Identities = 5/16 (31%), Positives = 7/16 (43%) Query: 1 MGLSESGKTTLLEAIF 16 +G SGK+T Sbjct: 8 IGCPGSGKSTWAREFI 23 >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Length = 179 Score = 25.1 bits (53), Expect = 3.9 Identities = 10/35 (28%), Positives = 14/35 (40%), Gaps = 7/35 (20%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFL 35 GLS +GKTT+ AL L + + Sbjct: 11 TGLSGAGKTTV-------SMALEEYLVCHGIPCYT 38 >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Score = 25.2 bits (55), Expect = 4.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTT L I Sbjct: 43 LGPSGCGKTTTLRMI 57 >3dhw_C Methionine import ATP-binding protein METN; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: c.37.1.12 d.58.18.13 Length = 343 Score = 25.2 bits (55), Expect = 4.1 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S +GK+TL+ + Sbjct: 37 IGASGAGKSTLIRCV 51 >1l2t_A Hypothetical ABC transporter ATP-binding protein MJ0796; ABC transporters, ATPase, walker-A, NBD, transport protein; HET: ATP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1f3o_A* Length = 235 Score = 25.2 bits (55), Expect = 4.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 MG S SGK+T+L I Sbjct: 37 MGPSGSGKSTMLNII 51 >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Score = 24.8 bits (54), Expect = 4.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G S GKTT L I Sbjct: 35 LGPSGCGKTTTLRMI 49 >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 Score = 24.9 bits (53), Expect = 4.3 Identities = 11/37 (29%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKS 37 +G S GK+TL+ + LF L P K+ Sbjct: 37 VGESGLGKSTLINS--LFLTDLYSPEYPGPSHRIKKT 71 >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Score = 24.9 bits (53), Expect = 4.3 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G +SG+T+L + Sbjct: 27 IGTEKSGRTSLAANL 41 >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Score = 24.8 bits (54), Expect = 4.4 Identities = 6/18 (33%), Positives = 9/18 (50%) Query: 1 MGLSESGKTTLLEAIFLF 18 G S GK+T+ + F Sbjct: 34 AGPSGGGKSTIFSLLERF 51 >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Score = 25.0 bits (55), Expect = 4.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G S +GK+T+L +F F Sbjct: 86 VGPSGAGKSTILRLLFRF 103 >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Length = 693 Score = 24.9 bits (54), Expect = 4.5 Identities = 6/14 (42%), Positives = 8/14 (57%) Query: 6 SGKTTLLEAIFLFG 19 +GKTT E I + Sbjct: 21 AGKTTTTERILYYT 34 >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Score = 25.0 bits (53), Expect = 4.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +GL SGKTT + I Sbjct: 28 VGLQYSGKTTFVNVI 42 >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Score = 24.7 bits (53), Expect = 4.5 Identities = 4/10 (40%), Positives = 8/10 (80%) Query: 6 SGKTTLLEAI 15 +GK+TL+ + Sbjct: 44 AGKSTLMGRL 53 >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* Length = 249 Score = 24.9 bits (54), Expect = 4.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GK+TLL + Sbjct: 32 VGPNGAGKSTLLARM 46 >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A Length = 260 Score = 24.7 bits (53), Expect = 4.7 Identities = 5/15 (33%), Positives = 8/15 (53%) Query: 1 MGLSESGKTTLLEAI 15 GL GK+T + + Sbjct: 10 TGLPGVGKSTFSKNL 24 >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Score = 24.9 bits (54), Expect = 4.8 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + GK+TLL+ + Sbjct: 37 LGQNGCGKSTLLDLL 51 >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Score = 24.8 bits (54), Expect = 4.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GKT LE I Sbjct: 32 LGPTGAGKTLFLELI 46 >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Score = 24.7 bits (53), Expect = 5.0 Identities = 5/16 (31%), Positives = 7/16 (43%) Query: 1 MGLSESGKTTLLEAIF 16 +G SGK+T Sbjct: 8 IGCPGSGKSTWAREFI 23 >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum 3D7} Length = 228 Score = 24.7 bits (52), Expect = 5.0 Identities = 3/15 (20%), Positives = 7/15 (46%) Query: 1 MGLSESGKTTLLEAI 15 G GK++ + + Sbjct: 35 SGAPNVGKSSFMNIV 49 >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Score = 24.9 bits (54), Expect = 5.0 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 G + +GKT+LL I Sbjct: 70 AGSTGAGKTSLLMMIMGE 87 >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Length = 211 Score = 24.7 bits (53), Expect = 5.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 2 GLSESGKTTLLEAIF 16 GLS SGK+TL + Sbjct: 32 GLSASGKSTLAVELE 46 >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Score = 24.6 bits (53), Expect = 5.1 Identities = 4/15 (26%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GK+T ++ + Sbjct: 53 VGPNGTGKSTAVKIL 67 Score = 23.9 bits (51), Expect = 7.9 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + GKTT ++ + Sbjct: 318 VGPNGIGKTTFVKML 332 >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Score = 24.8 bits (54), Expect = 5.3 Identities = 6/18 (33%), Positives = 13/18 (72%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G + SGK+T+ + ++ F Sbjct: 52 VGHTGSGKSTIAKLLYRF 69 >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Score = 24.5 bits (52), Expect = 5.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +GL +GKTT+L Sbjct: 27 VGLDNAGKTTILYQF 41 >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Score = 24.5 bits (52), Expect = 6.0 Identities = 5/10 (50%), Positives = 8/10 (80%) Query: 6 SGKTTLLEAI 15 GKT+L +A+ Sbjct: 19 HGKTSLTKAL 28 >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Score = 24.3 bits (53), Expect = 6.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 1 MGLSESGKTTLLEAIFLF 18 +G + SGK+TLL A Sbjct: 53 LGRTGSGKSTLLSAFLRL 70 >1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Length = 324 Score = 24.4 bits (52), Expect = 6.0 Identities = 12/46 (26%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Query: 8 KTTLLEAIFLFGEALALALSNDPVSVFLKSDV--FDGISKNQYGFF 51 T+++A+ AL ++ DP V L DV G+ G Sbjct: 3 LMTMVQAL---NRALDEEMAKDPRVVVLGEDVGKRGGVFLVTEGLL 45 >1sgw_A Putative ABC transporter; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Pyrococcus furiosus dsm 3638} SCOP: c.37.1.12 Length = 214 Score = 24.5 bits (53), Expect = 6.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 G + GKTTLL+ I Sbjct: 41 HGPNGIGKTTLLKTI 55 >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural genomics, joint center for structural genomics, JCSG; 2.10A {Thermotoga maritima MSB8} SCOP: c.37.1.12 Length = 256 Score = 24.5 bits (53), Expect = 6.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 +G + +GKTT L I Sbjct: 47 IGPNGAGKTTTLRII 61 >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Score = 24.4 bits (53), Expect = 6.5 Identities = 5/15 (33%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 +G + GK+TL + Sbjct: 40 LGGNGVGKSTLFQNF 54 >2yz2_A Putative ABC transporter ATP-binding protein TM_0222; cobalt transport, hydrolase, inner membrane, membrane, nucleotide- binding; 2.30A {Thermotoga maritima MSB8} Length = 266 Score = 24.4 bits (53), Expect = 6.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 G + SGK+TLL+ + Sbjct: 39 AGNTGSGKSTLLQIV 53 >2pze_A Cystic fibrosis transmembrane conductance regulator; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Score = 24.4 bits (53), Expect = 7.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Query: 1 MGLSESGKTTLLEAIFLF 18 G + +GKT+LL I Sbjct: 40 AGSTGAGKTSLLMMIMGE 57 >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Score = 24.0 bits (52), Expect = 7.5 Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 1 MGLSESGKTTLLEAI 15 +G + SGKTTLL AI Sbjct: 36 LGPNGSGKTTLLRAI 50 >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycoprotein; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Length = 971 Score = 24.1 bits (52), Expect = 7.6 Identities = 13/54 (24%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Query: 17 LFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQFILSEKMDIP 70 L+ E P + S F G++K F++ +D L DIP Sbjct: 821 LYAERQGFHQPQPPTQKWDSSSPFTGLTKPGIRFYSTSFDLD----LPSGYDIP 870 >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} Length = 704 Score = 24.2 bits (52), Expect = 7.9 Identities = 6/19 (31%), Positives = 9/19 (47%) Query: 1 MGLSESGKTTLLEAIFLFG 19 ++GKTT E I + Sbjct: 16 SAHIDAGKTTTTERILFYT 34 >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Score = 24.3 bits (52), Expect = 7.9 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +GL +GKT++L + Sbjct: 28 LGLDNAGKTSILYRL 42 >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Score = 24.1 bits (52), Expect = 8.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Query: 1 MGLSESGKTTLLEAI 15 MG + SGK+TL + Sbjct: 52 MGPNGSGKSTLSATL 66 >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus HB8} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 1zn0_B 1jqs_C 2bcw_C 1jqs_B Length = 691 Score = 23.9 bits (51), Expect = 8.5 Identities = 6/22 (27%), Positives = 10/22 (45%) Query: 1 MGLSESGKTTLLEAIFLFGEAL 22 ++GKTT E I + + Sbjct: 18 AAHIDAGKTTTTERILYYTGRI 39 >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.70A {Thermus thermophilus HB8} PDB: 2d2f_A* Length = 250 Score = 23.7 bits (51), Expect = 8.9 Identities = 6/18 (33%), Positives = 11/18 (61%) Query: 1 MGLSESGKTTLLEAIFLF 18 MG + +GK+TL + + Sbjct: 35 MGPNGAGKSTLGKILAGD 52 >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Score = 24.0 bits (51), Expect = 8.9 Identities = 4/10 (40%), Positives = 7/10 (70%) Query: 6 SGKTTLLEAI 15 GK+TL+ + Sbjct: 35 DGKSTLIGRL 44 >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Score = 24.0 bits (51), Expect = 9.1 Identities = 6/10 (60%), Positives = 8/10 (80%) Query: 6 SGKTTLLEAI 15 SGK+T+L I Sbjct: 188 SGKSTMLGRI 197 >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein LOLD; structural genomics, NPPSFA; 1.70A {Aquifex aeolicus VF5} PDB: 2pcl_A Length = 224 Score = 23.9 bits (51), Expect = 9.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 1 MGLSESGKTTLL 12 +G S SGK+TLL Sbjct: 36 IGASGSGKSTLL 47 >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Score = 23.6 bits (50), Expect = 9.5 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 1 MGLSESGKTTLLEAI 15 G + GKTTL + + Sbjct: 25 FGHIDHGKTTLSKVL 39 >3euh_A Protein KICB, chromosome partition protein MUKF; chromosome condensation, condensin, non-SMC subunit, kleisin, calcium, cell cycle, cell division; 2.90A {Escherichia coli} Length = 440 Score = 23.6 bits (51), Expect = 9.6 Identities = 11/40 (27%), Positives = 15/40 (37%), Gaps = 11/40 (27%) Query: 30 PVSVFLKSDVFDGISKNQYGFFTGKIKVDAQFILSEKMDI 69 SV +++FD I Q +D Q K DI Sbjct: 161 KYSV---AEIFDSIDLTQRL-------MDEQQ-QQVKDDI 189 >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* Length = 341 Score = 23.7 bits (50), Expect = 9.9 Identities = 4/11 (36%), Positives = 8/11 (72%) Query: 6 SGKTTLLEAIF 16 +GK+++LE Sbjct: 37 AGKSSVLENFV 47 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.324 0.142 0.407 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 658,668 Number of extensions: 24477 Number of successful extensions: 359 Number of sequences better than 10.0: 1 Number of HSP's gapped: 358 Number of HSP's successfully gapped: 117 Length of query: 80 Length of database: 5,693,230 Length adjustment: 49 Effective length of query: 31 Effective length of database: 4,505,274 Effective search space: 139663494 Effective search space used: 139663494 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.6 bits)