BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62] (80 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781089|ref|YP_003065502.1| hypothetical protein CLIBASIA_04955 [Candidatus Liberibacter asiaticus str. psy62] Length = 80 Score = 160 bits (406), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 80/80 (100%), Positives = 80/80 (100%) Query: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ Sbjct: 1 MGLSESGKTTLLEAIFLFGEALALALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQ 60 Query: 61 FILSEKMDIPHVFLPMVHFP 80 FILSEKMDIPHVFLPMVHFP Sbjct: 61 FILSEKMDIPHVFLPMVHFP 80 >gi|254780750|ref|YP_003065163.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 920 Score = 24.6 bits (52), Expect = 0.36, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%) Query: 24 LALSNDPVSVFLKSDVFDGISKNQYGFFTGKIKVDAQFILSEKMDIPHVFLPMVH 78 L +S+ + V GI+ + YG GK+ ++S DI F + H Sbjct: 790 LQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFEKLYH 844 >gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Score = 24.3 bits (51), Expect = 0.47, Method: Composition-based stats. Identities = 10/15 (66%), Positives = 13/15 (86%) Query: 1 MGLSESGKTTLLEAI 15 MGLS +GK+TLL +I Sbjct: 61 MGLSGAGKSTLLRSI 75 >gi|254780970|ref|YP_003065383.1| phosphoribosylformylglycinamidine synthase II [Candidatus Liberibacter asiaticus str. psy62] Length = 737 Score = 23.5 bits (49), Expect = 0.70, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 20 EALALALSNDPVSVFLKSDVFDGISK 45 E ALA S+D ++K+D F+G + Sbjct: 446 ETKALAFSSDVTPRYVKADPFEGTKQ 471 >gi|254780512|ref|YP_003064925.1| flagellar biosynthesis protein FlhA [Candidatus Liberibacter asiaticus str. psy62] Length = 692 Score = 22.3 bits (46), Expect = 1.6, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Query: 36 KSDVFDGISK------NQYGFFTGKIKVDAQFILSEK 66 + D+F +SK QYGF +IKV L EK Sbjct: 376 QEDLFLRVSKIRRKFAVQYGFIVPEIKVTTDISLPEK 412 >gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Score = 22.3 bits (46), Expect = 1.8, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 2/49 (4%) Query: 1 MGLSESGKTTLLEAI--FLFGEALALALSNDPVSVFLKSDVFDGISKNQ 47 +GL+ +GK+TL +AI + + ++++ N V LK+D+ I + + Sbjct: 44 IGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADLIAYIPQTE 92 >gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 21.9 bits (45), Expect = 2.0, Method: Composition-based stats. Identities = 9/13 (69%), Positives = 9/13 (69%) Query: 46 NQYGFFTGKIKVD 58 NQ GF GKI VD Sbjct: 211 NQKGFVLGKINVD 223 >gi|254780826|ref|YP_003065239.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Score = 21.6 bits (44), Expect = 3.0, Method: Composition-based stats. Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Query: 2 GLSESGKTTLLEAI--FLFGE 20 GLS +GKTTL ++ FL G+ Sbjct: 225 GLSGTGKTTLSASVDRFLIGD 245 >gi|254780664|ref|YP_003065077.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 536 Score = 20.8 bits (42), Expect = 5.2, Method: Composition-based stats. Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 20 EALALALSNDPVSVF 34 EA ALS DP+S F Sbjct: 304 EAYRRALSCDPISAF 318 >gi|254780181|ref|YP_003064594.1| phosphopantetheine adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 182 Score = 20.4 bits (41), Expect = 6.0, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 13/27 (48%) Query: 29 DPVSVFLKSDVFDGISKNQYGFFTGKI 55 DPV VFLK+ V + + F I Sbjct: 154 DPVCVFLKNIVISLVKYDSIKLFPNTI 180 >gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 20.0 bits (40), Expect = 7.8, Method: Compositional matrix adjust. Identities = 9/15 (60%), Positives = 11/15 (73%) Query: 1 MGLSESGKTTLLEAI 15 +G S SGK+TLL I Sbjct: 49 LGRSGSGKSTLLRII 63 >gi|254780147|ref|YP_003064560.1| 50S ribosomal protein L11 [Candidatus Liberibacter asiaticus str. psy62] Length = 142 Score = 19.6 bits (39), Expect = 9.7, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 26 LSNDPVSVFLKSDV 39 +S PVS FLK +V Sbjct: 71 MSQPPVSFFLKKEV 84 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.142 0.407 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,767 Number of Sequences: 1233 Number of extensions: 1779 Number of successful extensions: 13 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of query: 80 length of database: 328,796 effective HSP length: 49 effective length of query: 31 effective length of database: 268,379 effective search space: 8319749 effective search space used: 8319749 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)