RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781090|ref|YP_003065503.1| hypothetical protein CLIBASIA_04960 [Candidatus Liberibacter asiaticus str. psy62] (71 letters) >3fxq_A LYSR type regulator of TSAMBCD; transcriptional regulator, LTTR, TSAR, WHTH, DNA- binding, plasmid, transcription; 1.85A {Comamonas testosteroni} PDB: 3fxr_A* 3fxu_A* 3fzj_A (A:92-305) Length = 214 Score = 29.6 bits (65), Expect = 0.13 Identities = 5/24 (20%), Positives = 13/24 (54%) Query: 48 LADFIKDYPDCDLELENLVTDDIL 71 LA F +++PD + + + + + Sbjct: 20 LASFAREFPDVTVNVRDGMYPAVS 43 >2esn_A Probable transcriptional regulator; PA0477, APC5828,transcription, PSI, protein structure initiative, MCSG; 2.10A {Pseudomonas aeruginosa} (A:95-310) Length = 216 Score = 29.3 bits (64), Expect = 0.18 Identities = 4/24 (16%), Positives = 6/24 (25%) Query: 48 LADFIKDYPDCDLELENLVTDDIL 71 + P L L N + Sbjct: 26 MNRLQHSAPGVRLRLVNAERKLSV 49 >2ql3_A Probable transcriptional regulator, LYSR family protein; APC7314, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Rhodococcus SP} (A:1-78,A:178-209) Length = 110 Score = 28.3 bits (63), Expect = 0.32 Identities = 5/24 (20%), Positives = 9/24 (37%) Query: 48 LADFIKDYPDCDLELENLVTDDIL 71 L F +YP +E + + Sbjct: 24 LYAFTAEYPRASVEFREDTQNRLR 47 >3fzv_A Probable transcriptional regulator; LYSR, structural genomics, PSI-2, protein structure initiative; 2.71A {Pseudomonas aeruginosa PA01} (A:89-169,A:267-306) Length = 121 Score = 27.9 bits (62), Expect = 0.46 Identities = 4/24 (16%), Positives = 13/24 (54%) Query: 48 LADFIKDYPDCDLELENLVTDDIL 71 +A F + YP ++ + + +++ Sbjct: 26 IAGFRQAYPGVEIRIRDGEQQELV 49 >2fyi_A HTH-type transcriptional regulator CBL; Lys-R family, cofactor-binding domain, cysteine biosynthesis; 2.80A {Escherichia coli K12} (A:1-88,A:185-228) Length = 132 Score = 26.7 bits (59), Expect = 1.2 Identities = 6/24 (25%), Positives = 11/24 (45%) Query: 48 LADFIKDYPDCDLELENLVTDDIL 71 + F + +P+ LEL +I Sbjct: 33 IKAFRELFPEVRLELIQGTPQEIA 56 >1ixc_A CBNR, LYSR-type regulatory protein; long alpha helix connecting DNA binding and regulatory domains, DNA binding protein; 2.20A {Cupriavidus necator} (A:89-294) Length = 206 Score = 26.5 bits (57), Expect = 1.3 Identities = 5/24 (20%), Positives = 10/24 (41%) Query: 48 LADFIKDYPDCDLELENLVTDDIL 71 L F+ P + L + D+ + Sbjct: 22 LRAFLTSTPTATVSLTHXTKDEQV 45 >2hxr_A HTH-type transcriptional regulator CYNR; CYNR transcriptional regulator LYSR structural genomics, PSI-2, protein structure initiative; 2.05A {Escherichia coli K12} PDB: 3hfu_A (A:1-104,A:199-238) Length = 144 Score = 26.4 bits (58), Expect = 1.5 Identities = 8/23 (34%), Positives = 11/23 (47%) Query: 49 ADFIKDYPDCDLELENLVTDDIL 71 ADF YP L+L+ + I Sbjct: 50 ADFYARYPSITLQLQEXSQEKIE 72 >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* (A:203-259) Length = 57 Score = 25.7 bits (57), Expect = 2.2 Identities = 7/39 (17%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Query: 15 FRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIK 53 ++ + Y SG +++ ++ G+ E +K + F + Sbjct: 12 YKVI---YHSGISTRKALDELEASGNLIEQVKYIIKFFR 47 >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA; HET: SOG TLA; 2.10A {Helicobacter pylori} (A:204-270) Length = 67 Score = 25.0 bits (55), Expect = 3.7 Identities = 5/39 (12%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Query: 15 FRFLLDGYRSGKTSKDKYQKIVKIGDHAESIKTLADFIK 53 ++ L +R + ++ + ++ + +K + FI Sbjct: 11 YKRL---FRPIPSLRESAKLELEEHANNPFVKEICSFIL 46 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.321 0.144 0.434 Gapped Lambda K H 0.267 0.0735 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 570,325 Number of extensions: 20405 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's gapped: 76 Number of HSP's successfully gapped: 13 Length of query: 71 Length of database: 4,956,049 Length adjustment: 38 Effective length of query: 33 Effective length of database: 3,671,459 Effective search space: 121158147 Effective search space used: 121158147 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)