HHsearch alignment for GI: 254781091 and conserved domain: PRK03566

>PRK03566 consensus.
Probab=99.91  E-value=2.7e-22  Score=154.82  Aligned_cols=315  Identities=17%  Similarity=0.157  Sum_probs=197.1

Q ss_pred             EECCCCCC-CCCCHHHHHHHHHHHHH---CCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEECCHHHHHHHHHH
Q ss_conf             01215788-89898999999999964---288523658999999999999999999729897789886685387644556
Q gi|254781091|r    5 VYLDWNAT-APLLEVVRQSFVKSLDF---YGNPSSVHKEGQKTRLYIEESRRIIADFCGAKPDHVVFTSSATEAANWVLT   80 (383)
Q Consensus         5 iYlD~aat-tp~~~~v~~a~~~~~~~---~~n~~s~h~~~~~~~~~~e~aR~~ia~~~g~~~~ei~ft~~~T~a~~~~i~   80 (383)
T Consensus        35 i~l~~NeNp~gp~~~v~~a~~~~~~~~~~YPd~~------------~~~Lr~aiA~~~gv~~~~I~v~~Gs~e~i~l~~~  102 (365)
T PRK03566         35 VKLASNENPLGPSPKALEAIRAALSELHRYPDGN------------GFELKAALAEKLGVPPEQITLGNGSNDLLELLAR  102 (365)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCC------------HHHHHHHHHHHHCCCHHHEEECCCHHHHHHHHHH
T ss_conf             8821889998989999999999888616695966------------8999999999978486679987789999999999


Q ss_pred             HHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC
Q ss_conf             54421022456645873332122111222222222222222222211102345532443113565326540343444333
Q gi|254781091|r   81 PHFYQGSHKISIDSLYISAIEHPAVYAGGHFPSHKIHKIPVLSKGIVDIQALTDFLEQRNSTCGIPMIAVMFVNNETGVI  160 (383)
Q Consensus        81 ~~~~~~~~~~~~~~ii~s~~eH~s~~~~~~~~~~~v~~v~~~~~g~i~~~~l~~~i~~~t~~~~~~LVs~~~~~n~tG~i  160 (383)
T Consensus       103 a~~~------pGd~Vl~~~P~y~~Y~~~~~~~g~~~~~vp~~-~~~~dl~~l~~~i~~~~k-----lv~l~nPnNPTG~~  170 (365)
T PRK03566        103 AFLG------PGDEIIYSQYAFAVYPLATQAVGARAVEVPAK-DYGHDLEAMLAAITPKTR-----LVFIANPNNPTGTF  170 (365)
T ss_pred             HHCC------CCCEEEECCCCHHHHHHHHHHCCCEEEEECCC-CCCCCHHHHHHHCCCCCC-----EEEECCCCCCCCCC
T ss_conf             8558------99876766886689999999819748996176-767695889986388886-----89977999988773


Q ss_pred             CCHHHHHHHHCC--CCCCCCCCCCCC--CC--CC--CCC-CCCCCCEEEEECCCCCCCCCC--CHHHHCCCCCCCCCCCC
Q ss_conf             211235652034--465334443233--65--54--444-433431068730543322343--20110145742012212
Q gi|254781091|r  161 QPIKEIAQIVKE--YQGILVVDAVQA--AG--RI--PLS-IEEIKADFLIISSHKLGAPVG--AGALVFREDILLPSPLL  229 (383)
Q Consensus       161 ~pi~~I~~~~~~--~g~~~~vD~aqa--~g--~~--~id-~~~~~~D~~~~S~hK~~GP~G--~G~L~~r~~~~~~~p~~  229 (383)
T Consensus       171 ~~~~~l~~l~~~~~~~~~vV~DEaY~ef~~~~~~~~~~~~~~~~~n~iv~rSfSK~~glaGlRiGy~ia~~~li~~l~~~  250 (365)
T PRK03566        171 LSAAELEAFLAKVPPDVLVVLDEAYTEYAAPEERPDSLAWLKKYPNLVVSRTFSKAYGLAGLRVGYAVSNPEIADLLNRV  250 (365)
T ss_pred             CCCHHHHHHHHHCCCCCEEEEECCHHHHCCCCCCCCHHHHHHHCCCEEEEEECCHHCCCCCHHHEEEECCHHHHHHHHHH
T ss_conf             57065899997545674498524577750477777788876413772598545452057573014101699999999996


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCC
Q ss_conf             24774212222222112221001221100100245653210123333444443210001223221103652289857999
Q gi|254781091|r  230 RGGDQEKGQRAGTENYAVIGGFAVAAQQMVKDIQKRSSRVFAIRDYLEQELKKLIPNIIIYGKDAERISNTCCFSIPFLK  309 (383)
Q Consensus       230 ~Gg~~e~~~~~GT~~~~~i~~~~~al~~~~~~~~~~~~~~~~L~~~l~~~l~~~~~~~~i~~~~~~~~~~i~~~~~~~~~  309 (383)
T Consensus       251 ~---~-----p~~vn~~aq~aa~aaL~~-~~~~~~~~~~~~~~r~~l~~~L~~~--g~~~~ps~----~nF~l~~~~-~~  314 (365)
T PRK03566        251 R---Q-----PFNVNSLALAAAVAALDD-DDFLAKSRELNRAGMQQLEAGFDAL--GLEYIPSK----GNFVTVDVG-RD  314 (365)
T ss_pred             C---C-----CCCCCHHHHHHHHHHHCC-HHHHHHHHHHHHHHHHHHHHHHHHC--CCEECCCC----CEEEEEECC-CC
T ss_conf             1---8-----889779999999999589-9999999999998999999999978--79887899----808999789-99


Q ss_pred             HHHHHHHHHHCCCEEEECHHHCCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999999875896998711338864331014676288874765999907888999999999999999986
Q gi|254781091|r  310 AEVLQIALDLEGIAVSAGSACSSGKIKKNHVLAAMGFDTSQGAVRVSCGDSTTQEDIDIFLNALQKIIRT  379 (383)
Q Consensus       310 ~~~v~~~l~~~gI~v~~G~~C~~~~~~~~~vl~~~g~~~~~g~vRiS~~~~nT~~dId~l~~~L~~iv~~  379 (383)
T Consensus       315 ~~~l~~~L~~~gV~Vrp~~~--------------fgl---~~~lRis~g---~~een~~l~~aL~~il~e  364 (365)
T PRK03566        315 AAAIYQALLRQGVIVRPVAG--------------YGM---PNHLRVSIG---LPEENARFLAALKKVLAE  364 (365)
T ss_pred             HHHHHHHHHHCCEEEEECCC--------------CCC---CCEEEEEEC---CHHHHHHHHHHHHHHHCC
T ss_conf             99999999977918986898--------------999---897999958---999999999999998766