HHsearch alignment for GI: 254781091 and conserved domain: PRK06939

>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional.
Probab=99.95  E-value=4.5e-26  Score=177.67  Aligned_cols=319  Identities=17%  Similarity=0.196  Sum_probs=215.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCCHHHHH--HHHHHHHHHHHHHHHHHHCCCCHHHEEEECCHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             8989999999999642885236589--99999999999999999729897789886685387644556544210224566
Q gi|254781091|r   15 LLEVVRQSFVKSLDFYGNPSSVHKE--GQKTRLYIEESRRIIADFCGAKPDHVVFTSSATEAANWVLTPHFYQGSHKISI   92 (383)
Q Consensus        15 ~~~~v~~a~~~~~~~~~n~~s~h~~--~~~~~~~~e~aR~~ia~~~g~~~~ei~ft~~~T~a~~~~i~~~~~~~~~~~~~   92 (383)
T Consensus        57 ~~p~v~~a~~~a~~~yG~gs~~Srl~~G~--~~~h~~LE~~lA~~~g~e~-allf~SG-y~aN~~~i~aL~------~~~  126 (395)
T PRK06939         57 NHPELIAAAKAALDSHGFGMASVRFICGT--QDLHKELEQKLAKFLGTED-AILYSSC-FDANGGLFETLL------GKE  126 (395)
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHCCCC-EEEECCH-HHHHHHHHHHHC------CCC
T ss_conf             99899999999999729998776857478--3999999999999869994-9997552-776788999964------799


Q ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC-CCCCEEEEECCCCCCCCCCCHHHHHHHHC
Q ss_conf             45873332122111222222222222222222211102345532443113-56532654034344433321123565203
Q gi|254781091|r   93 DSLYISAIEHPAVYAGGHFPSHKIHKIPVLSKGIVDIQALTDFLEQRNST-CGIPMIAVMFVNNETGVIQPIKEIAQIVK  171 (383)
Q Consensus        93 ~~ii~s~~eH~s~~~~~~~~~~~v~~v~~~~~g~i~~~~l~~~i~~~t~~-~~~~LVs~~~~~n~tG~i~pi~~I~~~~~  171 (383)
T Consensus       127 d~i~~D~l~HaSiidG~~ls~a~~~~f~Hn-----D~~~Le~~L~~~~~~~~~~~~ivtegVfSMdGDiapL~~l~~L~~  201 (395)
T PRK06939        127 DAIISDALNHASIIDGVRLCKAKRYRYANN-----DMADLEAQLKEAKEAGARHKLIATDGVFSMDGDIANLPEICDLAD  201 (395)
T ss_pred             CEEEEECCCCHHHHHHHHHCCCCEEEECCC-----CHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             889984563588999998658947996689-----999999999960021586289999667777876015999999999


Q ss_pred             CCCCCCCCCCCCCCCCCC---------CCCCCCCCEEEEECCCC-CCCCCCCHHHHCCCCCCCC-----CCCCCCCCCCC
Q ss_conf             446533444323365544---------44433431068730543-3223432011014574201-----22122477421
Q gi|254781091|r  172 EYQGILVVDAVQAAGRIP---------LSIEEIKADFLIISSHK-LGAPVGAGALVFREDILLP-----SPLLRGGDQEK  236 (383)
Q Consensus       172 ~~g~~~~vD~aqa~g~~~---------id~~~~~~D~~~~S~hK-~~GP~G~G~L~~r~~~~~~-----~p~~~Gg~~e~  236 (383)
T Consensus       202 ~y~a~L~vDeAH~~GvlG~~G~G~~e~~gl~-~~vdi~~gTlsKA~~G~~G-gfv~g~~~~i~~l~~~~r~~if------  273 (395)
T PRK06939        202 KYDALVMVDDSHAVGFLGENGRGTVEHCGVM-DRVDIITGTLGKALGGASG-GYTAGKKEVIDWLRQRSRPYLF------  273 (395)
T ss_pred             HHCEEEEEECCCCEEEECCCCCCHHHHCCCC-CCCEEEECCCHHHHHCCCC-CEEECCHHHHHHHHHHCHHHHC------
T ss_conf             7273798614300003458998679980999-8868997732766624765-1451667889999984712211------


Q ss_pred             CCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCC-CHHHHHH
Q ss_conf             222222211222100122110010024565321012333344444321000122322110365228985799-9999999
Q gi|254781091|r  237 GQRAGTENYAVIGGFAVAAQQMVKDIQKRSSRVFAIRDYLEQELKKLIPNIIIYGKDAERISNTCCFSIPFL-KAEVLQI  315 (383)
Q Consensus       237 ~~~~GT~~~~~i~~~~~al~~~~~~~~~~~~~~~~L~~~l~~~l~~~~~~~~i~~~~~~~~~~i~~~~~~~~-~~~~v~~  315 (383)
T Consensus       274 ---Stalpp~~~aa~~~al~~~~~~-~~~r~~L~~n~~~~r~~l~~~--g~~~~~s~----spI~pi~iG~~~~a~~~~~  343 (395)
T PRK06939        274 ---SNSLAPAIVAASIKVLELLEES-DELRDRLWENARYFREGMTAA--GFTLGPGE----HPIIPVMLGDAKLAQEFAD  343 (395)
T ss_pred             ---CCCCCHHHHHHHHHHHHHHHHC-HHHHHHHHHHHHHHHHHHHHC--CCCCCCCC----CCEEEEEECCHHHHHHHHH
T ss_conf             ---5799879999999999998749-599999999999999999967--99868999----9979999699999999999


Q ss_pred             HHHHCCCEEEECHHHCCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             98758969987113388643310146762888747659999078889999999999999999862
Q gi|254781091|r  316 ALDLEGIAVSAGSACSSGKIKKNHVLAAMGFDTSQGAVRVSCGDSTTQEDIDIFLNALQKIIRTS  380 (383)
Q Consensus       316 ~l~~~gI~v~~G~~C~~~~~~~~~vl~~~g~~~~~g~vRiS~~~~nT~~dId~l~~~L~~iv~~~  380 (383)
T Consensus       344 ~L~~~Gi~v~-------~ir~Pt-------Vp~g~~rlRi~lta~ht~~did~lv~~l~~v~~~l  394 (395)
T PRK06939        344 RLLEEGVYVI-------GFSFPV-------VPKGQARIRTQMSAAHTKEQLDRAIDAFEKVGKEL  394 (395)
T ss_pred             HHHHCCCEEE-------EECCCC-------CCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             9997797482-------078998-------89898569988787799999999999999999963