HHsearch alignment for GI: 254781091 and conserved domain: TIGR00709

>TIGR00709 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR004637 This is a very small family, with two known examples at the time of model creation. This enzyme is a pyridoxal phosphate-containing class III aminotransferase and is quite similar to 4-aminobutyrate aminotransferase (2.6.1.19 from EC). Diaminobutyrate-2-oxoglutarate transaminase (2.6.1.76 from EC) is a homotetramer which catalyses the conversion of L-2,4-diaminobutyrate and 2-oxoglutarate to L-glutamate and L-aspartic 4-semialdehyde during 1,3-diaminopropane biosynthesis.; GO: 0008483 transaminase activity, 0009058 biosynthetic process.
Probab=98.10  E-value=4.9e-05  Score=50.25  Aligned_cols=340  Identities=19%  Similarity=0.250  Sum_probs=177.1

Q ss_pred             EECCCCCCC--C----CCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHC-CCCHHH--EEEE-CCHHHH
Q ss_conf             012157888--9----89899999999996428852365899999999999999999972-989778--9886-685387
Q gi|254781091|r    5 VYLDWNATA--P----LLEVVRQSFVKSLDFYGNPSSVHKEGQKTRLYIEESRRIIADFC-GAKPDH--VVFT-SSATEA   74 (383)
Q Consensus         5 iYlD~aatt--p----~~~~v~~a~~~~~~~~~n~~s~h~~~~~~~~~~e~aR~~ia~~~-g~~~~e--i~ft-~~~T~a   74 (383)
T Consensus        40 ~Y~DflaGAG~L~~GHN~~~~~Q~~~~~l~~~~---~~H~LDl-~T~~K~~F~~~l~~~~~~~r~~~Y~l~F~GP~GA~a  115 (445)
T TIGR00709        40 EYLDFLAGAGTLALGHNHPNLKQKIKDVLQSGL---PLHTLDL-TTPLKDAFIEALLNILPKPRKEDYKLQFPGPSGADA  115 (445)
T ss_pred             CHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCC---CEEEHHC-CHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCH
T ss_conf             021222100021046788899999999986078---5543002-200027899999997068877631787188898535


Q ss_pred             HHHHHHHHHHHCCCCCCCCEEEECCCC-CCCCCCCCCCCCC------------CCCCCCCCCC--------CCCCC----
Q ss_conf             644556544210224566458733321-2211122222222------------2222222222--------21110----
Q gi|254781091|r   75 ANWVLTPHFYQGSHKISIDSLYISAIE-HPAVYAGGHFPSH------------KIHKIPVLSK--------GIVDI----  129 (383)
Q Consensus        75 ~~~~i~~~~~~~~~~~~~~~ii~s~~e-H~s~~~~~~~~~~------------~v~~v~~~~~--------g~i~~----  129 (383)
T Consensus       116 ~EaA~KLA----~~~TGR~~visF~~GfHGMT~GaLa~TGN~~~~Na~~~~~~~~~~~PY~~~~~~P~G~GGeaG~~~~~  191 (445)
T TIGR00709       116 VEAAIKLA----KTYTGRTNVISFSGGFHGMTIGALALTGNLFAKNAVEMLLPGVQFLPYPHEYRCPLGLGGEAGSNAVI  191 (445)
T ss_pred             HHHHHHHH----HHCCCCCEEEEECCCCCHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCCHHHCCCCCCCCHHHHHHHH
T ss_conf             78999974----31178700476338851012213665224200012455677762278842324766677034467899


Q ss_pred             HHHHHHHHHHHC-CCCCCEEEEECCCCCCCCCC-C---HHHHHHHHCCCCCCCCCCCCCCC----CCC-CCCCCCCCCEE
Q ss_conf             234553244311-35653265403434443332-1---12356520344653344432336----554-44443343106
Q gi|254781091|r  130 QALTDFLEQRNS-TCGIPMIAVMFVNNETGVIQ-P---IKEIAQIVKEYQGILVVDAVQAA----GRI-PLSIEEIKADF  199 (383)
Q Consensus       130 ~~l~~~i~~~t~-~~~~~LVs~~~~~n~tG~i~-p---i~~I~~~~~~~g~~~~vD~aqa~----g~~-~id~~~~~~D~  199 (383)
T Consensus       192 ~Y~ENF~~~~~SG~~KPAA~I~E~iQGEGG~~~A~~~wL~~i~~v~~~~~I~lIlD~VQAG~~R~G~~FaFE~AGI~PD~  271 (445)
T TIGR00709       192 EYFENFIEDVESGVDKPAAVILEAIQGEGGVVAAPVEWLQKIREVTRKHDIKLILDEVQAGFGRSGKMFAFEHAGIEPDV  271 (445)
T ss_pred             HHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCEEECCCCCCCCE
T ss_conf             99877541366776576046886330788510224799999999874278479982234570125551100247898676


Q ss_pred             EEECCCC-CCC-CCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCC-HH-HHHHHHHHHHHHH
Q ss_conf             8730543-322-343201101457420122122477421222222211222100122110010-02-4565321012333
Q gi|254781091|r  200 LIISSHK-LGA-PVGAGALVFREDILLPSPLLRGGDQEKGQRAGTENYAVIGGFAVAAQQMVK-DI-QKRSSRVFAIRDY  275 (383)
Q Consensus       200 ~~~S~hK-~~G-P~G~G~L~~r~~~~~~~p~~~Gg~~e~~~~~GT~~~~~i~~~~~al~~~~~-~~-~~~~~~~~~L~~~  275 (383)
T Consensus       272 v~~S--KavGGng~PLAv~~i~~~fD~~~Pa----~H~GTFRGN--~lA~~TG-~~~L~~~kd~~L~~N~QE~~E~~t~~  342 (445)
T TIGR00709       272 VVLS--KAVGGNGLPLAVLLIKKEFDAWQPA----GHTGTFRGN--QLAMVTG-LEALNIIKDDNLAQNAQERGERITSF  342 (445)
T ss_pred             EEEE--CCCCCCCHHHHHHHHHHHCCCCCCC----CCCCCCCCH--HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8983--0338885068887763430456889----866554301--5788888-99999888766765554446789999


Q ss_pred             HHHHHHHHHHCCC-CC-C--------CCCCCCC--CEEEEEECCCCHHHHHHHHHHCCCEEEECHHHCCCCCCCCHHHHH
Q ss_conf             3444443210001-22-3--------2211036--522898579999999999875896998711338864331014676
Q gi|254781091|r  276 LEQELKKLIPNII-IY-G--------KDAERIS--NTCCFSIPFLKAEVLQIALDLEGIAVSAGSACSSGKIKKNHVLAA  343 (383)
Q Consensus       276 l~~~l~~~~~~~~-i~-~--------~~~~~~~--~i~~~~~~~~~~~~v~~~l~~~gI~v~~G~~C~~~~~~~~~vl~~  343 (383)
T Consensus       343 L~~~~K~-~P~~~~VRkGRGlM~Gi~~~~E~~~~D~~G~~P~D~~LA~~I~~~CF~~~Ll-----------------lE~  404 (445)
T TIGR00709       343 LDDLIKE-YPCIGNVRKGRGLMIGIEIVDERKSKDAIGAYPADSELAAAIQGACFENGLL-----------------LEK  404 (445)
T ss_pred             HHHHHHH-CCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE-----------------EEE
T ss_conf             9999873-7854762056633541321025774222478862148999998632205733-----------------430


Q ss_pred             CCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             28887476599990788899999999999999998623
Q gi|254781091|r  344 MGFDTSQGAVRVSCGDSTTQEDIDIFLNALQKIIRTST  381 (383)
Q Consensus       344 ~g~~~~~g~vRiS~~~~nT~~dId~l~~~L~~iv~~~~  381 (383)
T Consensus       405 ~G~~--~~V~~ll~p~~I~~~~~~~~~~~~~~av~e~~  440 (445)
T TIGR00709       405 GGRE--GEVVRLLCPITIDQEELEEVISRLKQAVEEAL  440 (445)
T ss_pred             CCCC--CCEEEEECCEEECHHHHHHHHHHHHHHHHHHH
T ss_conf             6899--73689706603245668999999999999999