HHsearch alignment for GI: 254781091 and conserved domain: TIGR03246

>TIGR03246 arg_catab_astC succinylornithine transaminase family. Members of the seed alignment for this protein family are the enzyme succinylornithine transaminase (EC 2.6.1.81), which catalyzes the third of five steps in arginine succinyltransferase (AST) pathway, an ammonia-releasing pathway of arginine degradation. All seed alignment sequences are found within arginine succinyltransferase operons, and all proteins that score above 820.0 bits should function as succinylornithine transaminase. However, a number of sequences extremely closely related in sequence, found in different genomic contexts, are likely to act in different biological processes and may act on different substrates. This model is desigated subfamily rather than equivalog, pending further consideration, for this reason.
Probab=99.76  E-value=7.4e-16  Score=115.79  Aligned_cols=332  Identities=17%  Similarity=0.161  Sum_probs=184.7

Q ss_pred             CEECCCCCC------CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEECCHHHHHHH
Q ss_conf             001215788------89898999999999964288523658999999999999999999729897789886685387644
Q gi|254781091|r    4 RVYLDWNAT------APLLEVVRQSFVKSLDFYGNPSSVHKEGQKTRLYIEESRRIIADFCGAKPDHVVFTSSATEAANW   77 (383)
Q Consensus         4 ~iYlD~aat------tp~~~~v~~a~~~~~~~~~n~~s~h~~~~~~~~~~e~aR~~ia~~~g~~~~ei~ft~~~T~a~~~   77 (383)
T Consensus        35 ~~ylD~~~g~~~~~lGh~~p~i~~Ai~~q~~~~~~~~~~~~--~~--~~~~la-~~L~~~~~--~~~v~f~~sGsEA~e~  107 (397)
T TIGR03246        35 KEYIDFAGGIAVNALGHAHPELVKALIEQADKLWHIGNGYT--NE--PVLRLA-KKLVDATF--ADKVFFCNSGAEANEA  107 (397)
T ss_pred             CEEEECCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCC--CH--HHHHHH-HHHHHHCC--CCEEEECCCHHHHHHH
T ss_conf             99999463487665578988999999999965777768634--88--999999-99975148--7769972867789999


Q ss_pred             HHHHHH-HHCCCCCCC-CEEEECC-CCCCCCCCCCCCCCCC---CCCCCCCCC----CCCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             556544-210224566-4587333-2122111222222222---222222222----21110234553244311356532
Q gi|254781091|r   78 VLTPHF-YQGSHKISI-DSLYISA-IEHPAVYAGGHFPSHK---IHKIPVLSK----GIVDIQALTDFLEQRNSTCGIPM  147 (383)
Q Consensus        78 ~i~~~~-~~~~~~~~~-~~ii~s~-~eH~s~~~~~~~~~~~---v~~v~~~~~----g~i~~~~l~~~i~~~t~~~~~~L  147 (383)
T Consensus       108 AlklAr~~~~~~~~~~k~~iis~~~~yHG~t~~~~s~~~~~~~~~~~~p~~~~~~~~~~~d~~~~~~~~~~~ia-----A  182 (397)
T TIGR03246       108 ALKLARRYALDKHGADKSEIVAFKNSFHGRTLFTVSVGGQPKYSQGFAPLPGGIKHAPYNDLAAAKALISDKTC-----A  182 (397)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCHHHHHHHHCCCEE-----E
T ss_conf             99999999985179997689997278689856410468996556788899976420452339999985288737-----9


Q ss_pred             EEEECCCCCCCCCCC----HHHHHHHHCCCCCCCCCCCCCC-CCCCC--CCCCC--CCCEEEEECCCC-CCCCCCCHHHH
Q ss_conf             654034344433321----1235652034465334443233-65544--44433--431068730543-32234320110
Q gi|254781091|r  148 IAVMFVNNETGVIQP----IKEIAQIVKEYQGILVVDAVQA-AGRIP--LSIEE--IKADFLIISSHK-LGAPVGAGALV  217 (383)
Q Consensus       148 Vs~~~~~n~tG~i~p----i~~I~~~~~~~g~~~~vD~aqa-~g~~~--id~~~--~~~D~~~~S~hK-~~GP~G~G~L~  217 (383)
T Consensus       183 vi~EPv~g~gG~~~~~~~yl~~lr~lc~~~gillI~DEV~tGfGRtG~~~a~~~~gv~PDiv~~g--K~l~gG~P~sav~  260 (397)
T TIGR03246       183 VIVEPIQGEGGVVPADPAFLKGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDILTSA--KALGGGFPIGAML  260 (397)
T ss_pred             EEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCEEECCCCCCCCCHHHCCCCCCCEEEEC--CCCCCCCEEEEEE
T ss_conf             99938778889873888999999999998593586341220787777831432269899878874--2246884048997


Q ss_pred             CCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             145742012-2122477421222222211222100122110010024565321012333344444321000122322110
Q gi|254781091|r  218 FREDILLPS-PLLRGGDQEKGQRAGTENYAVIGGFAVAAQQMVKDIQKRSSRVFAIRDYLEQELKKLIPNIIIYGKDAER  296 (383)
Q Consensus       218 ~r~~~~~~~-p~~~Gg~~e~~~~~GT~~~~~i~~~~~al~~~~~~~~~~~~~~~~L~~~l~~~l~~~~~~~~i~~~~~~~  296 (383)
T Consensus       261 ~~~~i~~~~~~~~h~-----~T~~g--npl~~aaala~L~~i~~--e~l~~~~~~~g~~l~~~L~~l~~~~~~i~~-VRG  330 (397)
T TIGR03246       261 TTTEIAAHLKVGTHG-----TTYGG--NPLACAVAGKVLDLVNT--PELLAGVKQRHDLFVDGLEKINARYNVFSE-IRG  330 (397)
T ss_pred             ECHHHHHHCCCCCCC-----CCCCC--CHHHHHHHHHHHHHHHH--CCHHHHHHHHHHHHHHHHHHHHHHCCCEEE-EEE
T ss_conf             448888651877738-----66882--99999999999999985--479999999999999999998741798775-422


Q ss_pred             CCCEEEEEECC---CCHHHHHHHHHHCCCEEEECHHHCCCCCCCCHHHHHCCCCCCCCEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             36522898579---999999999875896998711338864331014676288874765999907888999999999999
Q gi|254781091|r  297 ISNTCCFSIPF---LKAEVLQIALDLEGIAVSAGSACSSGKIKKNHVLAAMGFDTSQGAVRVSCGDSTTQEDIDIFLNAL  373 (383)
Q Consensus       297 ~~~i~~~~~~~---~~~~~v~~~l~~~gI~v~~G~~C~~~~~~~~~vl~~~g~~~~~g~vRiS~~~~nT~~dId~l~~~L  373 (383)
T Consensus       331 ~Glm~giel~~~~~~~a~~i~~~~~~~Gll~~~~-----------------g----~n~lrl~PPL~it~eeid~~l~~l  389 (397)
T TIGR03246       331 KGLLIGAVLTEAYQGKAKQFVNAAAEEGVIALIA-----------------G----PNVVRFAPSLVISDDDIDEGLARF  389 (397)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCEEEEC-----------------C----CCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             4359999972786335999999999789289307-----------------9----997999788518999999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999862
Q gi|254781091|r  374 QKIIRTS  380 (383)
Q Consensus       374 ~~iv~~~  380 (383)
T Consensus       390 ~~al~~v  396 (397)
T TIGR03246       390 ERAIEQV  396 (397)
T ss_pred             HHHHHHH
T ss_conf             9999986