>TIGR01249 pro_imino_pep_1 proline iminopeptidase; InterPro: IPR005944 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases . Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , . Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. This group of serine peptidase belong to MEROPS peptidase family S33 (clan SC). They are proline iminopeptidase (Prolyl aminopeptidase, 3.4.11.5 from EC), which catalyzes the removal of the N-terminal proline from peptides. This family represents one of two related families of proline iminopeptidase containing the alpha/beta fold. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members. ; GO: 0016804 prolyl aminopeptidase activity, 0005737 cytoplasm.

Probab=99.36 E-value=1.3e-11 Score=89.85 Aligned_cols=183 Identities=17% Similarity=0.242 Sum_probs=121.9 Q ss_pred EEEEEEECCCC-CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCC-CHHHHHHHHHH Q ss_conf 18799966888-77879999578998888998999999999999739849998531558876778521-02389999989 Q gi|254781093|r 12 RLEGRYQPSTN-PNAPIALILHPHPRFGGTMNDNIVYQLFYLFQQRGFVSLRFNFRGIGRSEGEFDYG-DGELSDAAAAL 89 (225) Q Consensus 12 ~l~~~~~~~~~-~~~~~vv~~Hp~p~~GG~~~~~~~~~la~~l~~~G~~vl~fd~RG~G~S~G~~~~g-~~E~~D~~aa~ 89 (225) T Consensus 13 d~H~LYye~~GnP~G~PV~~lHGGPGsGt~~~~r------~fFdpe~~rIvL~DQRGcGkS~p-~a~~~eNtTWdLV~Di 85 (310) T TIGR01249 13 DNHQLYYEQSGNPDGKPVVFLHGGPGSGTDPECR------RFFDPETYRIVLLDQRGCGKSTP-HACLEENTTWDLVADI 85 (310) T ss_pred CEEEEEEECCCCCCCCEEEEEECCCCCCCCCCCC------CCCCCCCEEEEEEEECCCCCCCC-CCCCCCCCCHHHHHHH T ss_conf 6135422106798995489975687899883446------45376635899983078889862-4332247705667439 Q ss_pred HHHHHHCCCCCCEEEEEECHHHHHHHHHHHCCCC-HHEEEECC---------------------------------CCCC Q ss_conf 9998623546740588872036878764503862-13301227---------------------------------5744 Q gi|254781093|r 90 DWVQSLNPESKSCWIAGYSFGAWISMQLLMRRPE-INGFISVA---------------------------------PQPK 135 (225) Q Consensus 90 ~~l~~~~~~~~~i~l~G~S~Gg~val~~a~~~p~-i~~~v~is---------------------------------p~~~ 135 (225) T Consensus 86 EkLR~~L-~I~~W~vFGGSWGStLALaYAq~HP~~v~~lvLRgiFL~R~~e~~w~~~~G~~~~~YP~~w~~F~d~IP~~~ 164 (310) T TIGR01249 86 EKLREKL-GIKKWLVFGGSWGSTLALAYAQTHPEKVTGLVLRGIFLLREKELSWFYEGGLASMIYPDAWQRFVDSIPENE 164 (310) T ss_pred HHHHHHC-CCCCEEEECCCHHHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCHHHHHHHCCCCCCC T ss_conf 9999862-897148853877899999986016246535565567632866789997268702347255665410587401 Q ss_pred CCCCCCC---------------------------------C--------------------------------------- Q ss_conf 3332223---------------------------------4--------------------------------------- Q gi|254781093|r 136 SYDFSFL---------------------------------A--------------------------------------- 143 (225) Q Consensus 136 ~~~~~~l---------------------------------~--------------------------------------- 143 (225) T Consensus 165 r~sY~~lv~ayh~~l~~~De~~~~~aAkAW~~WE~~t~~L~~~~~~~~~aed~~~~la~ArlEnHYfVNkgFl~~e~~lL 244 (310) T TIGR01249 165 RNSYEQLVNAYHDRLQSEDEETKLAAAKAWVDWESATTLLRPENEIVSTAEDAKFSLALARLENHYFVNKGFLDSENFLL 244 (310) T ss_pred CCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHH T ss_conf 36578999999874057537999999864666763565513471434111477899999877510220464053468888 Q ss_pred -C----CCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHH Q ss_conf -3----34773776168655028999999999986077996079997879847558589999999999997 Q gi|254781093|r 144 -P----CPSSGLIINGSNDTVATTSDVKDLVNKLMNQKGISITHKVIPDANHFFIGKVDELINECAHYLDN 209 (225) Q Consensus 144 -~----~~~p~LiIhG~~D~~vp~~~~~~~~~~l~~~~~~~~~~~~i~ga~H~f~~~~~~l~~~i~~fl~~ 209 (225) T Consensus 245 ~ni~~i~~i~~~iv~GRyDl~cPl~~awaL~kafPea-----~L~v~~~AGHs--a~dp~~~a~lv~a~~~ 308 (310) T TIGR01249 245 DNISKIRNIPTVIVHGRYDLICPLQSAWALHKAFPEA-----ELKVVNNAGHS--AFDPNNLAALVVALET 308 (310) T ss_pred HHHHHHCCCCEEEEECCEEHCCHHCCHHHHHHCCCCC-----EEEEECCCCCC--CCCHHHHHHHHHHHHH T ss_conf 6677640687379844600002003544675218551-----46674578866--5765479999999861

HHsearch alignment for GI: 254781093 and conserved domain: TIGR01249