>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS.

Probab=91.24  E-value=1.1  Score=23.68  Aligned_cols=30  Identities=37%  Similarity=0.565  Sum_probs=23.3

Q ss_pred             EEEEEEECHHHHHHHHHHHHHCCCE-EEEEEC
Q ss_conf             0799946146087899999987986-999607
Q gi|254781096|r    9 PIHFVGIGGIGMSGIAEVLHNTGHQ-VQGSDV   39 (474)
Q Consensus         9 ~i~~iGigG~G~s~lA~~l~~~G~~-V~g~D~   39 (474)
T Consensus         1 kVlivG~GglG-~~va~~L~~~Gv~~i~ivD~   31 (143)
T cd01483           1 RVLLVGLGGLG-SEIALNLARSGVGKITLIDF   31 (143)
T ss_pred             CEEEECCCHHH-HHHHHHHHHHCCCCEEEEEC
T ss_conf             99999979899-99999999937971999978