BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781097|ref|YP_003065510.1| N-acetylglucosaminyl transferase [Candidatus Liberibacter asiaticus str. psy62] (369 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781097|ref|YP_003065510.1| N-acetylglucosaminyl transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 369 Score = 755 bits (1949), Expect = 0.0, Method: Compositional matrix adjust. Identities = 369/369 (100%), Positives = 369/369 (100%) Query: 1 MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVS 60 MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVS Sbjct: 1 MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFITDFPADSIYEIVS 60 Query: 61 SQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSM 120 SQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSM Sbjct: 61 SQVRFSNPFVFWNSLVILWKAFIASLRLIKKLKPNVVVGFGGYHSISPLLAGMILRIPSM 120 Query: 121 VHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSS 180 VHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSS Sbjct: 121 VHEQNVIMGKANRLLSWGVQIIARGLVSSQKKVLLRKIIVTGNPIRSSLIKMKDIPYQSS 180 Query: 181 DLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDEL 240 DLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDEL Sbjct: 181 DLDQPFHLLVFGGSQGAKVFSDIVPKSIALIPEMQRKRLVIMQQVREDDKEKVQKQYDEL 240 Query: 241 GCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAY 300 GCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAY Sbjct: 241 GCKATLACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPAILVPYPHSVDQDQLHNAY 300 Query: 301 YLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEK 360 YLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEK Sbjct: 301 YLQEGGGAKVITENFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLMLSDLVEK 360 Query: 361 LAHVKVDLV 369 LAHVKVDLV Sbjct: 361 LAHVKVDLV 369 >gi|254780299|ref|YP_003064712.1| acyl-CoA dehydrogenase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 28.5 bits (62), Expect = 0.18, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Query: 93 KPNVVVGFGGYHSISPLLAGMILRIPSMVHEQNVIMGKANRLLSWGVQIIAR 144 +P + +G Y S S LL +I PS+VH++ ++G+ +LS Q +AR Sbjct: 27 QPPLFIGMNAYSSDS-LLVALIANFPSVVHKELELLGE--YVLSCTAQELAR 75 >gi|254780664|ref|YP_003065077.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 536 Score = 25.4 bits (54), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 18/25 (72%) Query: 121 VHEQNVIMGKANRLLSWGVQIIARG 145 VH + ++ A+RLLS G++II+ G Sbjct: 23 VHNKTGVVEFASRLLSRGIKIISTG 47 >gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Score = 24.6 bits (52), Expect = 2.8, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 17/29 (58%) Query: 28 LKNRGYAVYLITDRRARSFITDFPADSIY 56 L N G + +L + RA+ I D+P ++Y Sbjct: 167 LPNAGKSTFLASVTRAKPKIADYPFTTLY 195 >gi|254781194|ref|YP_003065607.1| hypothetical protein CLIBASIA_05505 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 24.3 bits (51), Expect = 3.2, Method: Compositional matrix adjust. Identities = 11/40 (27%), Positives = 22/40 (55%) Query: 314 NFLSPERLAEELCSAMKKPSCLVQMAKQVSMKGKPQAVLM 353 ++LS +L + L KK CLV + ++ +G P +++ Sbjct: 4 DYLSEAKLEKRLVKGSKKLDCLVFKTQFINQRGCPDRLII 43 >gi|254780754|ref|YP_003065167.1| inorganic polyphosphate/ATP-NAD kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 24.3 bits (51), Expect = 3.3, Method: Compositional matrix adjust. Identities = 8/37 (21%), Positives = 20/37 (54%) Query: 246 LACFFKDIERYIVEANLLICRSGALTVSEIAVIGRPA 282 + C F ++ + + + IC L ++E+++I +P Sbjct: 91 VECTFHPLKMTVFDYDNSICAENILAINEVSIIRKPG 127 >gi|254780480|ref|YP_003064893.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 24.3 bits (51), Expect = 3.6, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 282 AILVPYPHSVDQDQLHNAYYLQEGGG 307 A ++PY HS+ + ++H A + G G Sbjct: 274 AEMIPYDHSIGEFRVHYAGFFDPGFG 299 >gi|254780747|ref|YP_003065160.1| putative protease IV transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 293 Score = 23.5 bits (49), Expect = 6.2, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 16/28 (57%) Query: 262 LLICRSGALTVSEIAVIGRPAILVPYPH 289 L+ C S + +E +++G +L YP+ Sbjct: 113 LISCASNIIVAAETSLVGSIGVLFQYPY 140 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 23.1 bits (48), Expect = 7.1, Method: Compositional matrix adjust. Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 1 MSENNVILLVAGGTGGHVFPAVALSHELKNRGYAVYLITDRRARSFIT 48 +S + L++ G V+ ++ L L+ RG V + + A+ FIT Sbjct: 3 LSGKKIALIMCGSVA--VYKSLDLIRRLRERGAVVIPVMTKSAQKFIT 48 >gi|254780885|ref|YP_003065298.1| hypothetical protein CLIBASIA_03910 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 23.1 bits (48), Expect = 8.5, Method: Compositional matrix adjust. Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 30 NRGYAVYLITDRRARSFITD 49 NRGYAV ++T R + D Sbjct: 82 NRGYAVRIVTSENERRKLAD 101 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.138 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 233,924 Number of Sequences: 1233 Number of extensions: 9745 Number of successful extensions: 26 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 13 length of query: 369 length of database: 328,796 effective HSP length: 75 effective length of query: 294 effective length of database: 236,321 effective search space: 69478374 effective search space used: 69478374 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 39 (19.6 bits)