>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006 One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate. 2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+. This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including Escherichia coli. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.

Probab=97.46 E-value=0.00068 Score=45.99 Aligned_cols=69 Identities=30% Similarity=0.411 Sum_probs=52.5 Q ss_pred CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH---------------------HHHHHHCCCEEECC----CC-- Q ss_conf 8987999836854899999999859869998189647---------------------88999789899645----31-- Q gi|254781099|r 7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA---------------------VKQAKDMGIEVIDF----RE-- 59 (468) Q Consensus 7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~---------------------~~~l~~~g~~~~~~----~~-- 59 (468) T Consensus 142 ~g~rVAviGAGPAGLaCAD~L~RaGV~v~VfDRhP~iGGLLtFGIPsFKLdK~V~~~Rr~if~~MGi~F~Ln~EvGrD~~ 221 (480) T TIGR01318 142 TGKRVAVIGAGPAGLACADILARAGVQVVVFDRHPEIGGLLTFGIPSFKLDKAVLSRRREIFTAMGIEFKLNTEVGRDIS 221 (480) T ss_pred CCCEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECCCEEECCCC T ss_conf 78278997788602579998751785599974770307601368885110278999999999758927865816503255 Q ss_pred --CCCCCCCEEEECCCCCCC Q ss_conf --572258889988886856 Q gi|254781099|r 60 --IPWSIISFLVLSPGIALT 77 (468) Q Consensus 60 --~~~~~~d~vv~Spgi~~~ 77 (468) T Consensus 222 l~~LLe~YDAVFl--GvGTY 239 (480) T TIGR01318 222 LDDLLEDYDAVFL--GVGTY 239 (480) T ss_pred HHHHHHHCCEEEE--ECCCC T ss_conf 5444311484896--11433

HHsearch alignment for GI: 254781099 and conserved domain: TIGR01318