>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate,

Probab=96.52 E-value=0.011 Score=37.64 Aligned_cols=75 Identities=13% Similarity=0.224 Sum_probs=37.2 Q ss_pred HCCCCCCEEEECCCCCCCCHHHHH-HHH-C-CCCEEEEECCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCC Q ss_conf 013332001203210122068989-984-2-7868999889989988863168988998799999999999998448985 Q gi|254781099|r 344 LNEKRRIYWIAGGLSKSDDFSTLF-PFI-S-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420 (468) Q Consensus 344 ~~~~~~i~lI~GG~~K~~d~~~L~-~~~-~-~~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gD 420 (468) T Consensus 174 ~~l~~~~vLviGa----Gem~~l~~~~L~~~g~~~i~v~nRt~~r-a~~la~~~g~~-~~~~~~l~~~l~-------~~D 240 (311) T cd05213 174 GNLKGKKVLVIGA----GEMGELAAKHLAAKGVAEITIANRTYER-AEELAKELGGN-AVPLDELLELLN-------EAD 240 (311) T ss_pred CCCCCCEEEEECC----CHHHHHHHHHHHHCCCCEEEEECCCHHH-HHHHHHHCCCE-EECHHHHHHHHH-------HCC T ss_conf 8721167999868----7999999999996599825997686789-99999974989-972999999997-------689 Q ss_pred EEEECCCCCCC Q ss_conf 99945221663 Q gi|254781099|r 421 IVLFSPGCASF 431 (468) Q Consensus 421 iVLlSPa~aS~ 431 (468) T Consensus 241 vvisaT~s~~~ 251 (311) T cd05213 241 VVISATGAPHY 251 (311) T ss_pred EEEEECCCCCC T ss_conf 99992799962

HHsearch alignment for GI: 254781099 and conserved domain: cd05213