HHsearch alignment for GI: 254781101 and conserved domain: COG4109

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription].
Probab=90.97  E-value=0.43  Score=26.43  Aligned_cols=95  Identities=18%  Similarity=0.311  Sum_probs=54.6

Q ss_pred             CCHHHHHHHHCCEEECCCCC--CEEEEEEEEC-------CCCCCCCEEEECCCCCCCHHHHHHHHHHCCCEEEEEC----
Q ss_conf             56788998727999526887--1474677402-------2237898889716887476888999998698899985----
Q gi|254781101|r    5 WTFHDLLQAIQGHSIGIVPQ--GFVNGISIDS-------RSIAPQEAFFAIKGPHYDGHDFILHAVQKGAGLVVVN----   71 (472)
Q Consensus         5 ~~~~~l~~~~~g~~~~~~~~--~~i~~i~~dS-------r~v~~g~lFval~g~~~DGh~~i~~A~~~Ga~~~i~~----   71 (472)
T Consensus        71 LTf~Eiv~iidgqVLgG~~Gl~k~~sKFvIGAMt~~~i~rY~~~g~LlI--VGnR~~iq~l---AL~~~~AVLvTGGF~~  145 (432)
T COG4109          71 LTFAEIVNIIDGQVLGGRAGLEKELSKFVIGAMTLDAILRYLDPGGLLI--VGNREDIQLL---ALENGNAVLVTGGFDV  145 (432)
T ss_pred             HHHHHHHHHHCCCEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE--EECHHHHHHH---HHHCCCEEEEECCCCC
T ss_conf             1199998762350432632266654665043521988996107895699--9468999999---9864985999579886


Q ss_pred             -CCCCCCCCCCCCCEEEEC-CHHHHHHHHHHHHHH
Q ss_conf             -521245544697289959-989999999999983
Q gi|254781101|r   72 -TDMVASIGSLSIPVFGVD-DVLGALNKLAVAARL  104 (472)
Q Consensus        72 -~~~~~~~~~~~~~~i~v~-d~~~al~~la~~~~~  104 (472)
T Consensus       146 s~evi~lAne~~lPvlstsYDTFTVAtmIN~Al~n  180 (432)
T COG4109         146 SDEVIKLANEKGLPVLSTSYDTFTVATMINKALSN  180 (432)
T ss_pred             CHHHHHHHCCCCCCEEEECCCCEEHHHHHHHHHHH
T ss_conf             58899764014884487045213099999899877