RPSBLAST alignment for GI: 254781101 and conserved domain: PRK10773

>gnl|CDD|182718 PRK10773, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed. Length = 453
 Score =  213 bits (544), Expect = 9e-56
 Identities = 127/416 (30%), Positives = 188/416 (45%), Gaps = 49/416 (11%)

Query: 6   TFHDLLQAIQGHSIGIVPQGFVNGISIDSRSIAPQEAFFAIKGPHYDGHDFILHAVQKGA 65
           T   L   + G   G      ++ ++ D+R + P   F A+KG  +D HDF   A   GA
Sbjct: 5   TLSQLADILNGELQGADIT--IDAVTTDTRKVTPGCLFVALKGERFDAHDFADDAKAAGA 62

Query: 66  GLVVVNTDMVASIGSLSIPVFGVDDVLGALNKLAVAARLRSKATIIAITGSVGKTTTKEM 125
           G ++V+  +      + +P   V D   A  +LA   R +  A ++A+TGS GKT+ KEM
Sbjct: 63  GALLVSRPL-----DIDLPQLVVKDTRLAFGQLAAWVRQQVPARVVALTGSSGKTSVKEM 117

Query: 126 LTIALSSIKKTYACIGSYNNHIGVPLTLARMPVDVDFGIFELGMSHLGEIRFLTHLVRPH 185
               L     T    G+ NN IGVPLTL R+  + D+ + ELG +H GEI +   L RP 
Sbjct: 118 TAAILRQCGNTLYTAGNLNNDIGVPLTLLRLTPEHDYAVIELGANHQGEIAYTVSLTRPE 177

Query: 186 IAVITTIAPAHLSNFSGIEEIASAKAEIFEGLEKTGTIFLNYDDSFFELLKAKSHALGIK 245
            A++  +A AHL  F  +  +A AK EIF GL + G   +N D + +   +     +G K
Sbjct: 178 AALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADSNDWLNWQ---SVIGSK 234

Query: 246 TIYSF--GKSKNADFQLRKWKQCSEQSWMEVQLQGKSMEVVHHG-----------IGYHM 292
           T++ F    + + DF           +   + +     E   H             G H 
Sbjct: 235 TVWRFSPNAANSVDF-----------TATNIHVTSHGTEFTLHTPTGSVDVLLPLPGRHN 283

Query: 293 AQNMLMTLGIVSILTADVD---TAIKA-LSVFHPKEGRGKRYRCALNQGFFTLIDESYNA 348
             N L      + L   V     A+KA L+      GR    + A  Q    L+D+SYNA
Sbjct: 284 IANALAA----AALAMSVGATLDAVKAGLANLKAVPGRLFPIQLAEGQ---LLLDDSYNA 336

Query: 349 NPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLAEVLSLYNISHV 404
           N  SM AA  VL+++     G R+ V+GDM E+G  S++ H  + E      I  V
Sbjct: 337 NVGSMTAAAQVLAEMP----GYRVMVVGDMAELGAESEACHRQVGEAAKAAGIDKV 388