BLAST/PSIBLAST alignment of GI: 254781104 and GI: 327194629 at iteration 1
>gi|327194629|gb|EGE61479.1| hypothetical protein RHECNPAF_1140040 [Rhizobium etli CNPAF512] Length = 160
 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 64/102 (62%)

Query: 1   MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ 60
           M KT D +++GV+ A+  +TY+IKH  E K E++  LE +I  E++ IDLLKA WAL  Q
Sbjct: 1   MLKTFDLVLIGVMTATAAVTYTIKHRAELKLEEVHRLEAEIKLEKDTIDLLKADWALQSQ 60

Query: 61  PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPE 102
           P+R++ LV  Y  ELQLQ T    L+   +L  LK    LP+
Sbjct: 61  PNRLERLVKAYDDELQLQPTESTALVHAKELPMLKSEVPLPD 102