RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >gnl|CDD|35021 COG5462, COG5462, Predicted secreted (periplasmic) protein [Function unknown]. Length = 138 Score = 87.8 bits (217), Expect = 8e-19 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 9/113 (7%) Query: 1 MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ 60 M +T D +++ +++A+ T+TYSIKHE E + ++R L +I SE++ IDLLKA WALL Q Sbjct: 1 MLRTFDIVLIAIMVAAATVTYSIKHEAETQLAEVRKLHAQIKSEEDTIDLLKADWALLTQ 60 Query: 61 PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVE 113 P+R++ L + Y+ EL+L+ L+ LP RS+LP Sbjct: 61 PNRLEKLAAAYKTELKLEPVKSTQLV---------GPPELPMLRSDLPFNPNI 104 >gnl|CDD|39994 KOG4797, KOG4797, KOG4797, Transcriptional regulator [Transcription]. Length = 123 Score = 28.6 bits (63), Expect = 0.51 Identities = 14/63 (22%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query: 19 ITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQ 78 + ++++ E E KE++R LE + ++ + LLK L P+++ L + +L + Sbjct: 61 LMFAVREEVEVLKEQIRELEERNSALERENSLLKT----LASPEQLAQLPAQLSPQLCPE 116 Query: 79 ATN 81 + Sbjct: 117 SPQ 119 >gnl|CDD|38797 KOG3590, KOG3590, KOG3590, Protein kinase A anchoring protein [Signal transduction mechanisms]. Length = 602 Score = 26.3 bits (57), Expect = 2.6 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Query: 66 DLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPK 109 D + LY K LQAT+P+ DD+ RL+ + + LP Sbjct: 372 DAMILYDKYFSLQATHPLGF---DDVVRLEIESNICREGGPLPN 412 >gnl|CDD|37433 KOG2222, KOG2222, KOG2222, Uncharacterized conserved protein, contains TBC, SH3 and RUN domains [Signal transduction mechanisms, General function prediction only]. Length = 848 Score = 25.9 bits (56), Expect = 3.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Query: 101 PENRSNLPKRTVERRQHRK 119 P NLPK+ + RR+ RK Sbjct: 448 PAAAPNLPKQQLARRKLRK 466 >gnl|CDD|73383 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain. LMO is a FMN-containing enzyme that catalyzes the conversion of L-lactate and oxygen to acetate, carbon dioxide, and water. LMO is a member of the family of alpha-hydroxy acid oxidases. It is thought to be a homooctamer with two- and four- fold axes in the center of the octamer.. Length = 383 Score = 24.8 bits (54), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 87 TYDDLARLKKHTLLP 101 T++DLA L++ T LP Sbjct: 241 TWEDLAFLREWTDLP 255 >gnl|CDD|73376 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain. FCB2 (AKA L-lactate:cytochrome c oxidoreductase) is a respiratory enzyme located in the intermembrane space of fungal mitochondria which catalyzes the oxidation of L-lactate to pyruvate. FCB2 also participates in a short electron-transport chain involving cytochrome c and cytochrome oxidase which ultimately directs the reducing equivalents gained from L-lactate oxidation to oxygen, yielding one molecule of ATP for every L-lactate molecule consumed. FCB2 is composed of 2 domains: a C-terminal flavin-binding domain, which includes the active site for lacate oxidation, and an N-terminal b2-cytochrome domain, required for efficient cytochrome c reduction. FCB2 is a homotetramer and contains two noncovalently bound cofactors, FMN and heme per subunit.. Length = 344 Score = 24.8 bits (54), Expect = 7.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 86 ITYDDLARLKKHTLLP 101 +T+DD+ L+KHT LP Sbjct: 200 LTWDDIKWLRKHTKLP 215 >gnl|CDD|35682 KOG0461, KOG0461, KOG0461, Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis]. Length = 522 Score = 24.6 bits (53), Expect = 8.4 Identities = 7/22 (31%), Positives = 13/22 (59%) Query: 103 NRSNLPKRTVERRQHRKEIVQQ 124 N NLP + +R+ +K V++ Sbjct: 414 NGKNLPPLRIFKRKCKKGHVER 435 >gnl|CDD|176985 CHL00044, rpl16, ribosomal protein L16. Length = 135 Score = 24.1 bits (53), Expect = 9.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 108 PKRTVERRQHR 118 PKRT R+QHR Sbjct: 4 PKRTKFRKQHR 14 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.135 0.367 Gapped Lambda K H 0.267 0.0706 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,433,131 Number of extensions: 66452 Number of successful extensions: 186 Number of sequences better than 10.0: 1 Number of HSP's gapped: 186 Number of HSP's successfully gapped: 19 Length of query: 125 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 43 Effective length of database: 4,491,799 Effective search space: 193147357 Effective search space used: 193147357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)