RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Length = 251 Score = 28.1 bits (63), Expect = 0.58 Identities = 10/42 (23%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query: 34 LRILENKITSEQNYIDLLKAQW--ALLIQPDRIKDLVSLYQK 73 + +E+ + +YID +K W + +I D +K+ ++ Y+ Sbjct: 25 PKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKD 66 >1u83_A Phosphosulfolactate synthase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, lyase; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Length = 276 Score = 26.6 bits (59), Expect = 1.4 Identities = 8/40 (20%), Positives = 20/40 (50%) Query: 34 LRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQK 73 L+ ++ I +YID +K W + +++ +S ++ Sbjct: 52 LQFFKDAIAGASDYIDFVKFGWGTSLLTKDLEEKISTLKE 91 >2vga_A Protein A41, A41; immunomodulator, chemokine binding protein, glycoprotein, viral protein, early protein; 1.9A {Vaccinia virus} Length = 207 Score = 24.7 bits (53), Expect = 6.6 Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 65 KDLVSLYQKELQLQATNPINLITYDDLARLKKHTLL 100 +D V L T PIN +T+DDL +L + ++ Sbjct: 79 RDTVYAKFASLDPWTTEPINSMTHDDLVKLTEECIV 114 >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 24.5 bits (52), Expect = 7.8 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 7/48 (14%) Query: 26 ETEGKKEKLRILE--NKITSEQ---NYIDLLKAQWALLIQPDRIKDLV 68 E E +++ + LE N+ SEQ N I+ A A QPD D++ Sbjct: 109 EQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPD--ADII 154 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.318 0.135 0.367 Gapped Lambda K H 0.267 0.0483 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,016,870 Number of extensions: 42119 Number of successful extensions: 158 Number of sequences better than 10.0: 1 Number of HSP's gapped: 158 Number of HSP's successfully gapped: 22 Length of query: 125 Length of database: 5,693,230 Length adjustment: 81 Effective length of query: 44 Effective length of database: 3,729,466 Effective search space: 164096504 Effective search space used: 164096504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.0 bits)